1ZVQA

Structure of the q61g mutant of ras in the gdp-bound form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGGEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
publication title Structure of a transient intermediate for GTP hydrolysis by ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zvqA00
1UBFA 5B30A 4Q00A 3TAUA 1Z6GA 1GWNA 1QDEA 2C2HA 2WJIA 2BHRA 2JJ2A 3HJNA 4URYR 1JJVA 2HT1A 1W5TA 2VSFA 2C98A 5CIWA 1KNXA 1IXSB 1Z0FA 4F92B 4YMUA 1JECA 4HDQB 4KLNA 5LDDC 4EFLA 3BGWA 1F2TA 4KBFA 1MABA 2H16A 2ODWA 4C0JA 5JBQA 2GNOA 5C46F 1KIMA 5LPNA 1Z83A 1JAHA 1F2UB 4ERNA 4V02A 4LGMA 3U7HB 4JT2A 4X8MA 5FOTA 1KAOA 4A0FA 2HF8A 3GFOA 4MUBA 3PJRA 3BBPA 1UADA 1DTSA 4M1WA 5G40A 3B82A 4ESVA 4FWIB 3PXGA 5CYPA 2DFKB 4Z1MA 1TQ2A 1FNNA 4TSFD 4OQNA 1G9XA 5EE1A 3A6PC 2JJ8A 1W44A 3RRYA 4B74A 1XXHB 1Z5ZA 3HWSA 4C9BA 5IRCD 3BJIC 4OK3A 1S3GA 4DCUA 1YE8A 4CT5A 1RYHA 1EFRA 2HF9A 4BWYA 4Q21A 2VP9A 2GRJA 4PPNA 3RS0A 1Q57A 3A1VA 3H4MA 3WYFA 2R62A 2CLCX 6Q21A 2BCGY 1XCPA 4QG7A 2BV3A 5JEDA 3FHCB 3OEEA 1YR6A 3RC3A 2ZRKA 1OXSC 4P4UA 5BYKA 4MITA 5KNCA 1K5GA 1D9XA 4LV6A 1CTQA 2WPDA 1E9AA 2YV5A 4CW7A 2P5SA 4NZYA 1LV7A 4DCTA 1HE1C 2QPAA 3AB3A 4Q18A 2X19A 3RLFA 1Q0UA 2Z43A 4YLGA 4BFVA 3GJ5A 2ZYTX 4A2WA 3IEUA 4GSYA 4LJ9A 1UJ2A 4JIMA 1ZBDA 3KKOA 1IONA 1ZD9A 3A1SA 5IT5A 2FOLA 1IN6A 4Q9IA 3HU1A 4B76A 4A2QA 3QXJA 5JI3E 4Q48A 4Z8YA 5AUOB 3GLIB 5H68A 2A9KA 2QRNA 3THXB 4TLEA 4DXAA 2QMHA 2ZUBA 3CO5A 4XJXA 3REGA 3QSYA 2W2XA 2REBA 2CLSA 1TEXA 2G6BA 3THOA 3VU9A 1AJEA 4NCKA 2V3CC 1LS6A 1U99A 3I92A 3OIVA 3VKHA 5AJVB 2QBYB 1ZU5A 2BBSA 4IEEA 4DUGD 2XB2A 1QHHB 3MWYW 1NL3A 5IF9A 1A2BA 3WY9A 1N5KA 1E2FA 2QP3A 3ZZ0A 2HEIA 2RHDA 4HLQB 3AVUA 1J2JA 4IVQA 2AR7A 4DC9A 4PFSA 5IK2A 1J99A 2SHKA 1NN3A 1ZC3A 2V6IA 3MAAC 5KDLA 3ONWA 5SZJA 3SJZA 5JLJA 1FX0A 2AWNA 4QXAA 4PC6A 2OEPA 2V8OA 1I2DA 4QGFA 1G3RA 3NG1A 2MSEB 3IIKA 3U4QB 4GRAA 3CRQA 3K9HA 1D5CA 1NBME 1P62B 1M7BA 1SKYB 2K5UA 3DEFA 4WZBE 2G9NA 5GVRA 3PUXA 4DSNA 2ZRFA 1T4GA 3TK1A 2ZRMA 3TH5A 2ZM5A 1N0VC 1S2MA 3KFXA 3OF5A 1NNEA 3TQCA 2W6JA 4D0GA 2CEAA 3Q7PA 2QTVB 2OE2A 1L8QA 4P4SA 3RNLA 1SVSA 2NO6A 3CNOA 2Q0HA 1NIJA 5E95A 1E2LA 1NI3A 1F2TB 3E1SA 5JCZA 1UKYA 2Q9BA 2ZU0C 4JBWA 3MWJA 1IBRA 2QSZA 3CWZA 3SYLA 2KE5A 1BH2A 1T8UA 2VP0A 2JLQA 1OH5A 4LHWA 5JZVA 4B2LA 5EXXA 3FMFA 2JDID 2PCLA 2Z83A 2ZJAA 4JLPA 4A0HA 5KSOA 1G5PA 1KI4A 1ESMA 3WBKA 1M2OB 4ZO4A 2VHTA 4LJ7A 2VYFA 2CCKA 4LC0A 4B47A 2ZRAA 2FEOA 3CX7A 4I1OA 2H1LA 4AY2A 3UWKA 3CF6R 1BYUA 4YMSA 2V1XA 2O8CA 1F60A 2WSSD 1M6NA 3RRZA 4E03A 1G8GA 2GJ9A 2VBCA 3TSWA 1HT1E 1IHUA 3HYTA 4BPBA 4M8NE 1E2HA 2RGNA 5CK4A 2O8EA 2E9SA 1RIFA 3HDTA 3DDCA 3BD9A 1Q3TA 4D0NA 3QOFA 2BOVA 1KGDA 1W0KA 5FL3A 3QQ5A 1TAGA 4NCJA 3L0PA 1NKTA 3RS7A 5BN4A 2J87A 1S1CA 2ZREA 2GVDC 3CM0A 1R4AA 3NXSA 3ZYCA 4JBYA 1E2QA 1Q1EA 2PZGA 4HZUA 3T06B 1OHHA 4L15A 2IS4A 4QJ3A 2VHQA 3AVVA 2QQ0A 3EIHA 4Q9KA 1S0UA 1GVNB 1JAIA 1E0AA 4PO9A 1KHTA 3TKLA 2IUUA 4DT1A 1RRCA 1DAEA 4FI3C 4ITRC 3AVXA 2GXQA 2QZ4A 5JWOA 1KO7A 1CRPA 1TNDA 1WE2A 4JL5A 1U9IA 2CE2X 4B2IA 5GADl 1U0HC 1NVVQ 1T6NA 2QMUA 2EQBA 1WP9A 3H0KA 5JHGB 3N2EA 1GZSA 3VMFA 1CJMA 1DO2A 1YZGA 3D3QA 1UDXA 4PSVA 1W7AA 3OHMA 2VH5R 3U3JA 1II9A 1ZNZA 3QBTA 4YMVA 2YYZA 4HYYA 1RJ9A 1XRJA 1R10A 1NMYA 2UZ3A 2ZSAA 3TRFA 5JS8A 4I1SA 2R9VA 4A6PA 3ADKA 2QUZA 1FX0B 1Z0IA 2ZS7A 3CB4A 5F2EA 4DSTA 3K9NA 3EZFA 3NEYA 4LJ5A 4YMTA 3AKEA 4MKGA 1WRBA 2V54A 4JSYA 4B2PA 2X77A 1T0JB 3SJAA 4UXJA 4URVR 4MH0R 5EE0A 1C9KA 4LZZA 1QHGA 4PC3A 2O8BA 1QRAA 2B92A 4JLVA 2GETA 2XZLA 1IY2A 2QQEA 1E2MA 1NMZA 2B8WA 2ZSEA 1SGWA 5K8UA 2VF8A 3OEHD 2XGJA 4IRUB 4IDQA 5L3QB 1HYQA 3O8RA 4PQYA 1KK2A 3L8ZA 3K09C 3SDZA 2EU8A 3IDQA 3ASZA 4TMVA 5JMTA 1LF5A 2IYZA 5D3QA 2WMOB 2O8FA 1OIXA 1R6BX 4ZDJA 2YWFA 3UG7A 1UM8A 1W4AA 4Q7JB 1U94A 4G1UC 4YDSA 5CJ2A 4Z51A 2LCFA 5CLLA 3I5YA 2ASEA 4XOIA 4DB2A 3C8UA 2JAQA 3P4XA 4YXWA 5AJZA 3I4LA 5J47A 2VP2A 1KJWA 1LVGA 4R9UC 5C4GB 4DLSA 2OBLA 4UNPA 5EP3A 5FUYA 2ZAMA 4OI2A 1JALA 2GBLC 4L5BA 2C5LA 4LYFA 1UDWA 2IWRA 2O8CB 1E32A 1NF3A 4P0TA 4BZXA 3Q5DA 2XZPA 2JJ1D 3GJ3A 3Q3JB 1FQJA 1WXQA 3I3SR 1VG1A 2REXB 1P2UA 1X1SA 3U7EB 4QBFA 2IYWA 4GMXA 2X2FA 4X8HA 2QP4A 2RHMA 2O8EB 3GEHA 4PX9A 2XOKA 3P32A 3ND8A 3MWLA 1GUAA 3Q8XB 1W48A 1JB1A 821PA 2AX4A 3RABA 3Q72A 3ZD6A 1CLUA 3VX3A 1Q1ZA 4B3BA 1AZSC 2CCGA 2UZIR 1KI3A 1QHIA 1TTTA 4TZ0A 1HEIA 2ZR9A 3I5XA 4HZUB 5HPYB 3GCGA 3R7WB 1QHXA 2NGRA 1JR3D 5GVSA 1T3LA 5IHPA 3GJXC 1XF9A 4US1R 5HR5A 3IBYA 3QXSA 4MRNA 1KK3A 3T1VA 3FKSA 2P6RA 1WBBA 2AKYA 4G0NA 2X1VA 4MYHA 4DT1B 2QE7A 4B75A 5DI9A 1OT3A 3CR8A 3GLFA 2VHUA 5ANRB 4NCNA 2BBTA 3B6EA 2GILA 3THWA 3EAQA 2AK2A 4R98A 4EAQA 1ZYUA 2Q9CA 3ZS9A 3VKGA 3GLGE 1KY3A 1E9CA 1M7HA 2YWHA 2P3SA 2ERXA 4AKEA 4AKGA 2XITA 3IKJA 1FP7A 1HQYE 1CXZA 3CR7A 1U8ZA 5CDFA 3ZQ6A 5AJYA 1AIPA 1P7CA 2V7QA 2W2TA 3F5FA 2CDNA 1W2GA 4M1YA 3DHWC 4XD7A 2YZ2A 3GPLA 2GCNA 1ZM2A 4URXR 5EP1A 4PC1A 1OW3B 2EYQA 3QUSA 4BFTA 2ZSBA 1KMHB 2QAGA 1K6MA 5M04A 1G6OA 4HUQA 1T5LA 1U2RA 2YOGA 2BM0A 4B3XA 4URUR 1RRGA 2FFHA 4Q1AA 1COWD 4RFSA 2OFXA 3NWJA 5E7JA 5D3MA 1DAFA 2DBYA 3HU2A 2VLIA 1A5TA 3T15A 1CBUA 1DVRA 4IOMA 3A36A 3MRSA 1XPRA 3ZD7A 4LJYA 3SHFA 4QL3A 2HCBA 3WNCA 4PPGA 1VG0B 1JR6A 2I1QA 4TL6A 4U7DA 5F3WB 3V4RA 2GAAA 1RRPA 3QEJA 1VIYA 1HUQA 2F6RA 2IF2A 1NVWQ 4PR0A 3FHTA 3B1XA 3IIMA 4QJ5A 5E7MA 4TYYA 1H8HA 1W47A 1UBEA 3I8SA 1PVOA 4PZZA 1IXZA 3LA6A 5HE8A 1E1RA 4Z54A 2VF7A 2QTFA 4HLDA 1AN0A 5KO2A 3ICQB 2GAOA 1SQ5A 5BWMA 5EXSA 2AL7A 4LHVA 2GVZC 2JLSA 2AN9A 1AKEA 1W36C 2NO1A 4KVAA 4Q02A 2XNSA 3LQQA 1E9FA 1RC8A 1Q22A 2I3BA 4DZZA 2PZEA 2REOA 1CJKC 5FUWA 4HAUA 3ZVRA 2HYDA 4Q03A 4ZCMA 4A0RA 2JEOA 2QPOA 2J7PA 1HV8A 4NCIA 2KWIA 3GQBA 4A15A 2R6AA 1DO0A 4HB4A 2PT7A 3B9PA 3PQCA 4BFSA 4BRUA 4EUNA 1KI2A 2AD5A 4V03A 1R8SA 3UK6A 5CJPA 2IS2A 2N46A 2ZI3A 4CEIA 1DBSA 2HXSA 4FMCB 2EFEB 1FOEB 1Z2AA 1G3QA 4K81B 2QU8A 4OBEA 2D2FA 1G8YA 3X2SA 4AKIA 2RGCA 2Z5FA 2BDTA 3AF2A 3THWB 4HB3A 5GJVC 5KU1A 2V55B 3AVWA 2D3WA 1K8RA 2ZI5A 3EIQA 1SVLA 4BGDA 4OHZA 2C99A 2WOOA 1ELOA 3RHFA 4QNRA 4TYQA 1FNMA 3LH5A 3UXMA 3LY5A 2ZJBA 4NE2A 4NONA 5FTJA 4MKFA 5L3VA 4JKYA 4AI6A 2WJVA 1MRNA 2OT3B 1NKSA 2JLZA 3DMDA 1NVXQ 3PEWA 1AZTA 3K0SA 5LD2C 2R44A 4ABYA 5DYGA 4C0LA 4DJTA 2JLVA 2QAGB 2J41A 2ZJ8A 4QNMA 5LBIA 2O5VA 2CK3D 4HUQB 1Z06A 3VX4A 2XNDA 4HAXA 1OB5A 3ZGXA 5FTNA 1MO6A 3E5HA 2PL3A 2CHQA 3EW9A 1KDPA 3KB2A 1NJFA 1CRQA 3TW4A 1N5LA 2ZI7A 2LWIA 4RFSB 3BXZA 5DI3A 1XD9A 2IA5A 5TV2A 2R6GA 2IYQA 1OE0A 4H1UA 5D3MB 1QZXA 2FX3A 1G1MA 2HXYA 3A1WA 2D06A 3Q9LA 5BYJA 1XMJA 4DVGA 1GNPA 2OV2A 3KJIA 5HZKA 1ZCAA 1XJ0A 2AXNA 4RZXA 3PITA 4IOJA 1AM4D 4RZUA 3ZIAA 1MOZA 5AJXA 1MT0A 3D8BA 3B13B 5ELXA 3O8BA 5C4MA 1RVDA 2ZITA 4O3MA 2V4ZA 4PHTA 1UKZA 4LV5B 5L8VA 2IYSA 4HEJA 2H8KA 1QHSA 3NBYC 4RD3A 1VCIA 1V5WA 4UNSA 2EFCB 2EFHB 4PSAA 3CPEA 5SZHB 1GITA 3GMTA 2FSHA 2GEUA 1SXJA 2ORIA 3JVUA 3MG9A 2DYKA 5EZ5A 3IGFA 4AG6A 3U6KA 1X3SA 1UEIA 1XCGB 1Z47A 4TMWA 2CBZA 4GPTA 2WZQA 4LCBA 2WV9A 5TARA 1KO4A 1P2TA 2UVQA 4LBVA 1CJTC 3IQWA 4TQ9A 5JWRA 5KPDA 4A4DA 1TU3A 1YVDA 4HLUC 5FTLA 3ECCA 1N6OA 4Q47A 4A0GA 1DS6A 4FMDF 3LLUA 1KSGA 4LPSA 5JCPA 1SXJE 1BIFA 1QF9A 3W3AA 1NIPA 1BMFA 2GK6A 3VR3A 5FBVB 3NTUA 4M2LA 4RFVA 3DOEA 4DDTA 4NHOA 2IF0A 3OAAD 5FUVA 3AEZA 1R0ZA 3CNNA 2N1BA 3PIRA 4M9XA 3FPAA 4F4CA 4Q5IA 4ZCLA 1HA3A 4FINA 1N6PA 3QKSA 1XTSA 4PQRA 3W8RA 4IXNA 4AIIA 4D80A 1ZRHA 3AV0B 5KYKA 3QIAA 1KO8A 2GTPA 3K0EA 1E2IA 3K0CC 1OXXK 2A78A 3BWDD 2D2EA 2IS1A 2OCAA 2GDJA 4TQAA 2XJ9A 4AG5A 1XPOA 2BM1A 1T5IA 2F43B 2PCJA 2FN4A 3THYB 4HAZA 4MA4A 4KVGA 1GRNA 3MFYA 3BORA 4LHXA 2CNWD 121PA 2ZRDA 1YKSA 3TUZC 3CF0A 2RKOA 4KYUA 5FBLB 3PCRB 4FN5A 1N6KA 4IJMA 1XMIA 4DSUA 3PUVA 2R6DA 3ZVMA 1XX6A 3TAHA 3LXRA 1TMKA 3L0IB 3KQKA 4PZLA 1TQDA 4KI0A 4F4JA 2KBEA 4OKSA 2WWWA 5K8IA 3K9GA 3PUWA 4MGKR 1DG1G 3TE6A 2XXAA 4GDFA 2H57A 5J5CA 3SZRA 5FPTA 1Z0KA 5DI3B 1UBCA 1W4BA 3W6PA 4IDPA 3SC3A 2JJ2D 3W90A 3IILA 1XTKA 2H92A 2HJVA 1J90A 1FTNA 2C04A 3W8NA 2OXCA 1QVRA 1EX6A 5FH9A 2QGZA 3QPUA 1UF9A 4EJSC 4XVUA 3AQ4A 3QEOA 4YONB 5G3ZA 1KSFX 1E94E 3C41J 4HB0A 4ZDKA 3L8YA 1CS4C 1JQLB 2D4HA 3K0FA 1RW4A 4DRZA 3KQNA 2OAQ1 1JXOA 4BLQA 4HAVA 1RRFA 2ZUCA 3HU3A 1Q20A 4YMWA 2ZANA 5EP4A 4DEYA 3NH9A 1KI7A 3QENA 4PAMA 4Q1FA 1ZNWA 4QHTA 2F1HA 4Z1MD 5KSZA 2L0XA 1E79A 2IT1A 3W6OA 1JEDA 5FUXA 2DWOA 4HB2A 4MDFA 2IXFA 1GAJA 1E9RA 3MMPA 1SHKA 1EFRD 2F1IA 2IWHA 4G01B 1IXRC 2V6JA 2PLRA 2PMKA 2QP9X 2QROA 1IM2A 2J59A 4AD8A 5EXPA 2A30A 1G7SA 4ZKEA 1YZKA 1N5IA 2YJTD 4NYMQ 4HSEA 1G20E 2BMJA 5JWHA 3X1XA 5DLQC 2WPDD 4LJ6A 4DLVA 5KNBA 2EYUA 3U3OA 3WMFA 5DO9A 2J0SA 1WMSA 1TUEA 2MMCA 1EK0A 4JJKA 3TUIC 1KK0A 3ADBA 2P2LA 1M8PA 2OXRA 2IHBA 1EGAA 2WKQA 5UKDA 4D4KA 2ZYUX 3HYRA 2B8TA 1U8YA 3QKSB 4JYBA 4C30A 3ZQJA 4BFXA 5DSZA 4M0LA 5DNYB 4B71A 3DZDA 1AKYA 1GTVA 2BKUA 3QBVA 4PHHA 3TR0A 2YKGA 3A4LA 4ZI2A 2CE7A 1NN0A 4LBYA 5J40A 2NMVA 3GJ4A 4QBIA 2FFQA 4FWTA 2ZRJA 1OFUX 1CIPA 2HDNB 2RGDA 3HR8A 2O0KA 4BFWA 1XU4A 5C1BA 1OH7A 2FFAA 1NBMA 3BE4A 4PPFA 2JLYA 2A3RA 3AP2A 4NP6A 1NRJB 1ZVQA 2I4IA 3F0TA 4A8JB 1Z0DA 3AVPA 3GEEA 3KL4A 2IK8A 1G16A 2JCSA 2IYRA 3W6NA 4OHXA 4P33A 1DAHA 2G3YA 3WRXC 1GG2A 2W58A 3CRMA 2YVUA 1NN5A 4W5WA 5FOVA 4V0LA 1E9SA 4JLMA 1E98A 2ZI4A 3P27A 3DO6A 5CITA 2QPTA 3WYAA 1KTVA 2WIAA 3B1WA 4MYTA 2XXAB 4MGIR 1GL7A 1JBKA 2ZRCA 3L43A 4PZYA 3I32A 5FOUA 5AUPB 1D8TA 1OXUA 1EFTA 1AGRA 3L0SA 3FVQA 3L82B 3S1AA 1ZW6A 3B8HA 1MABB 1G17A 2IW3A 3T1QA 2CHGA 4S2EA 5GJWC 1HT2E 4EFNA 1XJCA 2C9OA 2Z4RA 4HAYA 4TMZA 2J45A 4PAQA 4EPTA 3TGPA 4CT4B 1F48A 1TX4B 2FDCA 3AH8A 3QKRA 1KOFA 1N6HA 2W2VA 2XSZA 4ZIRA 3D6TB 3K70B 2J5XA 1M34E 3K0FB 2WKRA 3O8DA 1HH4A 4J0QA 4RD2A 3A37A 5KSPA 3I62A 1VG8A 2G83A 2IYTA 4M9ZA 3ZS8A 3KXKA 1G41A 2LKCA 2QN6A 4EPVA 1KDRA 2CL6X 5L3SA 4JLBA 1PLKA 4XIGS 1OJLA 2IS6A 1GP2A 4FCVA 2JDIA 3OIWA 4D0LB 4QGHA 3QVVA 1IN5A 4G5QA 5TDHA 1XEWY 2IXEA 1Z6AA 4ZV4A 2F9MA 3SNHA 3EC1A 1FPMA 1D2EA 4YC7A 2IYVA 4WOPA 5KHOC 3NBZC 2D74A 2IC5A 4B32A 3KQHA 1VIAA 4B73A 1I4LD 5FBWB 3QF7A 2GKSA 1E4YA 4WXRA 2WBLC 2MSCB 421PA 1W0JD 2BCJQ 3KUDA 5KDOA 3UMSA 4C0KA 4KFTA 3R8FA 2QORA 1W0KD 2ATXA 4NYIQ 4A92A 1VHLA 1IQPA 2P67A 4LJ4A 3IPXA 3HP1A 4P32A 1ZP6A 4M1MA 5B57C 4XVRA 4LYJA 1R7RA 5G53C 1OHHD 3FKQA 3AUYA 4DCSA 4TWZA 2NPFA 1VYTA 1TU4A 4OJKA 1OLOA 2Q3FA 2GA8A 3ETLA 1WF3A 3NDPA 1ZAKA 3BFXA 1MRSA 3H84A 2J0UA 3VU9B 4URWR 2BKEA 3FFBA 5JJIA 3R9WA 1E99A 4LHYA 4MYUA 4H9GA 2WTUA 3JZAA 4KFUA 4Q4HA 4D25A 3SN6A 1SHZA 3I8XA 5HZHA 1G4UR 2ORVA 3QG1A 1E1QD 3B1ZA 2ZROA 3V00A 4RJLA 2ANCA 4U5XA 4QBGB 4O2LA 3ZZUA 1DELA 2FPLA 2ECKA 2YC2C 2D7DA 2OUKA 3SJBA 1I4DD 5KSYA 3LNCA 4XVQA 1Z0JA 1GNQA 2FGJA 1OYYA 2WSMA 4M1OA 1UAAA 4FD2A 4ACBA 4HDCA 2DB3A 2QMOA 3BS4A 1H65A 3RS3A 4QHYA 2B7BA 4P4SB 3GLHE 1G8HA 1N6NA 2IXGA 3CPHA 2R2AA 4R2HA 4I1VA 3S1AB 3C5CA 2BBOA 1XD2A 2IYXA 1X1RA 1XB2A 2HCJB 3BH7A 4U02A 2ZVPX 1Y63A 1B0UA 1P2VA 1P6XA 2C77A 2J7KA 3CRVA 2ZETA 1NY5A 4C0QC 1EG7A 5KNDA 4A6XA 3WNDA 4WA7A 3WP1B 2F3TA 2RGBA 2ZE5A 4ON9A 3ZLJA 2FPMA 4ZIRB 3W5JA 2AXPA 2KB0A 1OXTA 3K8YA 4L8GA 1Z3IX 1EXMA 4S35A 5BXQC 2NG1A 1VTKA 4RZ3A 2ZI6A 1FL9A 2OBMA 1VHTA 2NQ2C 3C15C 1Q1QA 5GJBA 1YQTA 3TVTA 2XAUA 1QHNA 3SOPA 4PHGA 1O87A 4OL0A 4IOLA 1P5ZB 2ZS8A 3UIEA 1PJRA 2XTMA 4CZ2A 4TT3A 1RPZA 4M21A 1W5SA 3TSOA 4NYMR 1P3JA 3RC8A 3OIUA 3U7GA 2EWWA 1IN8A 1G5RA 4OHWA 5AUNB 4MDEA 3T1TA 3U7FB 2VP5A 4LRWA 5G3YA 3AM1A 4BLTA 5E4FA 2XOKD 1R0WA 4JKIA 2RGGA 2Z0MA 1Q44A 1A2KC 2P0EA 1T3HA 1B23P 2PJRA 1LY1A 2ZTSA 3SR0A 1U98A 3T1OA 4TMKA 3GJ7A 5TXGA 4D4JA 1CR0A 4E09A 2DHRA 2Q3MA 1KO1A 3O47A 3IQXA 4LWZA 3DKVA 3PR1A 4GOJA 1NLYA 2F3RA 3EASA 3GLGA 1XMVA 1NSFA 1TL7C 3C16C 3H86A 3KKMA 4N0DA 3DKPA 4F91B 4PSKA 2D62A 4XSHA 5FPSA 1JJ7A 3TNFA 5DHFA 1SKQA 1D6JA 4IOKA 4PO1A 3KXIA 3FYHA 2QE7D 5GJCA 3WRYC 3H1TA 2J0UB 3FDIA 3TMKA 3CH5A 1E0KA 2ZQ5A 1N2CE 1V43A 5CB8A 1G3IA 4TLDA 1A7JA 2RB4A 2NO9A 5HE9A 3TBKA 2Q9AA 1P60A 1R8QA 2WWXA 4N0EA 3VFDA 3FMOB 2IX3A 2R6FA 3DPUA 4PHFA 1IN4A 2ERYA 1ZMXA 1RJ9B 2H18A 2DFTA 3B78A 1QG2A 1MR3F 2C96A 4B44A 4I81A 2YOFA 2V7QD 1JR3E 1Z8FA 2FZ4A 3P4YA 2HYIC 4GI7A 2GZHA 2Z4SA 4DKXA 4JLOA 3B5JA 4US0R 3IUYA 3SYNA 2IYUA 2C03A 3TR5A 5J4LA 4M1SA 1KDOA 1OIVA 4ZI3A 3QG5A 2O8BB 2GJ8A 4B48A 3NKVA 1YZQA 4US2R 5JS7A 4OK5A 1OF1A 1ZD1A 3FE2A 3OFND 3LDAA 4YQFA 3VQTA 1XWIA 3A8TA 3HR7A 1GNRA 4AYTA 2ZXUA 4DLRA 3WHLA 2OO7A 2NO0A 4Q7LA 2ZEJA 1IAQA 3OIYA 4DCVA 1JNYA 4TMTA 3FWYA 2O8FB 3WYGA 1F3OA 1RFLA 1WCV1 1Z07A 4NTZA 3GP8A 1DPFA 1FUUA 2JIZA 3DMNA 3U6BA 3BFKA 1J8MF 4F38A 1G18A 3SBDA 2NTYC 4Q1DA 3ZDQA 4M1TA 3CPJB 1XPUA 1UPTA 1X6VA 1C4OA 2QAJA 5J4YA 3J81k 3TVDA 2QRZA 3SQXA 1AS0A 2H5EA 1XEWX 4C3ZA 4JT4A 4LBZA 4NCHA 5EXTA 3MSXA 1RKBA 4NL4H 4Q9LA 4F4IA 3X1ZA 1H8HD 2O0JA 2PJZA 2G0TA 3WP0A 3WHKA 1KO5A 5B2ZA 5FBRB 2EWVA 1E1RD 2CJWA 3EA5A 3OE7A 2ZS9A 5FL7A 2YWGA 4O2RA 4C2UA 1VDZA 4GMDA 5FTMA 2F7SA 4JYCA 3BOSA 5IDVA 2AWOA 2QG6A 4X8OA 2W83A 1PV4A 4HAWA 1OFTA 4B3GA 5TB5A 1R2QA 4LX0A 2NIPA 2WJYA 3K09A 3EPKA 1GOTA 4V0ME 5JJLA 4AK9A 5JSZA 4GNKA 2LKDA 5HCNA 3JZMA 1R5NA 2QY9A 4GBMA 1Z0AA 4C0BA 1BO6A 1NLZA 1P75A 2J7PD 1OXVA 1ZNYA 2ZIAA 3OZXA 2NZ8A 3DM5A 5FFMA 1OFHA 4W5JA 4TL9A 1S96A 2KI5A 4DLWA 4A8JC 1W4RA 1NVVR 2ZE8A 1L4YA 5DISB 3SJCA 1KZ7B 2FV8A 2CCJA 3GLFB 3LD9A 2ODBA 2PEZA 2WJGA 1OKKA 4G5RA 3D7MA 3AKYA 2GBLA 4P4TA 2OSBA 2WVJA 2ZRPA 4ASUA 1XEXA 1MV5A 1P61B 5J4HA 4V0NA 3M1IA 4B3FX 1T91A 3WNBA 2ANBA 1G6HA 3IHWA 4KCGA 4RSGA 2ZYVX 4PC2A 4ZDIA 4CEJA 2WAXA 3KDSE 4KBGA 3EPJA 4XWKA 5K8TA 1YRAA 3LLMA 5FPKA 3KJEA 4UJ5A 3ICEA 2CVFA 4OQLA 2GWHA 4Q1CA 4DDUA 3FGNA 4Q66C 4C0SA 4B43A 3U44A 3LRPA 2DWPA 4WIAA 3NC1C 4B33A 2FEMA 1ZUHA 2JLXA 2QTHA 4C7OA 3QJYA 4QC2A 3NHAA 2N42A 4OI1A 3N5CA 5AK0A 1ZNXA 2PEYA 3KJHA 4I99A 2O8DA 4TL7A 3ADDA 4GZLA 4BFUA 4DSOA 4XWOA 4IEIA 5A4JA 3AP3A 3CWQA 4LSGA 3U60B 1M7GA 3T34A 1LF0A 4A1FA 5HKKA 4OQXA 1ZJ6A 2WJHA 1H8EA 5TVKA 4Q4JA 4OI0A 2FSIA 2W6IA 3A1TA 4TTPA 2VPPA 2WJJA 3LFUA 4TTQA 2VEDA 1XNJA 3EX7C 3U61B 2GJKA 4D81A 3AF4A 3LX5A 4TLAA 3ZIAD 4MGYR 2CVHA 4UNNA 5FOXA 521PA 1LFDB 1E2NA 2CL7X 1FP6A 1QVAA 3QNUA 3TW8B 4JLDA 4JLJA 4B3DA 2ZE6A 3E70C 4UJ3A 3RVBA 1RZ3A 4BFZA 3ZZTA 2WMNB 2C95A 3TQFA 2ODEA 1J70A 1YRBA 4DWJA 1E2PA 1GKYA 4LK2A 3SI7A 3IO5A 2ZUDA 3R9XA 4LY6A 5CM8B 2VQSA 2CJWB 1FUKA 4EPWA 2O52A 3QI2A 4DB4A 5FTKA 2X8AA 2CHVA 2WM9B 2WKPA 3DVLA 2V1UA 3SS8A 1KJZA 4B35A 4QM7A 4TLBA 3RRNA 5CM9C 1MO5A 1PLJA 2NOAA 1SVMA 4GZMA 1KY2A 1G291 1KAGA 4D26A 1KI6A 5HTKA 4TTRA 2FNAA 1ZIOA 4XTRA 2AK3A 2CXXA 2ZJ2A 5JSZB 3EZ6A 4MQBA 4V0OA 3WXMA 1II8A 3CZPA 3VNVA 4DCNA 1IN7A 4POAA 4D2IA 1YR8A 1OPXA 5G41A 2W0MA 5H1YA 2E87A 1KI1A 1DARA 1JPJA 2OLKA 3EG5A 3QXXA 2F1RA 3KUCA 3NC0C 4F93B 4CEIB 1J8YF 1YU9A 3P20A 3CKLA 2G1KA 2QSYA 3VHLB 1G19A 1XXHE 2EFGA 2YHSA 4KLZA 4OQMA 4W5HA 5DN6A 1VCMA 4TZ6A 4MKHA 1KSJA 3AKCA 3RS4A 1OYWA 2IBMA 1HURA 2QL6A 2JLUA 4JVLA 3MJHA 5FR1A 1E69A 2GF9A 3CRRA 1W46A 3LO5A 1XTIA 5FBQB 3KZ1E 4NPHA 4BQSA 1W4CA 1GL6A 5DYIA 5EE5B 2BEKA 4A82A 4B3CA 4UXHA 1A4RA 1ANKA 1OH8A 1LB1B 3SFZA 4B6FA 1TUIA 1XTQA 1EESA 4D4MA 1XEFA 4HATA 3AF0A 1NLFA 1VMAA 1E4VA 2FH5B 3EXAA 4GFDA 1ZD8A 2QBYA 3IPYA 2P65A 1ZINA 2HLDA 2MMGA 1QHHA 3LQRA 4MYCA 3VR1A 3ZVNA 4BLSA 4QM6A 1G4AE 4JLKA 3CH4B 2WAYA 3KJGA 3B1YA 4RD4A 3GLIE 3KQUA 4OK6A 1NY6A 5CIQA 1ETUA 1G7CA 4OJQA 1WB9A 3K9LA 3B60A 4M53A 1T0HB 1E6CA 4FCTA 4Q4JB 2ODNA 4EPXA 2YC4C 3U4QA 2JLRA 2J9RA 4JVMA 4TYPA 2W0SA 1ZC4A 1GFIA 1FTSA 3FFAA 3MLEA 2IYLD 1G8FA 1Z28A 1AQYA 1VCOA 2FF7A 2RGNC 1BKDR 2GCOA 5LB4A 1LNZA 1MKYA 1ZM7A 1TQ6A 4FW9A 3K70D 5DE3A 3BRWD 4Q4LA 4DHEA 4IVPA 2OCYC 2VHJA 3CONA 2RMKA 1W1WA 4WXPA 1SKYE 1SXJB 4Y0VA 3X1WA 3AGPA 4CGZA 2IHYA 3NEJA 3QF4A 1IOZA 1LTQA 1E79D 4NDZA 4E5UA 2GJSA 1CU1A 5EQTA 2H17A 4KFSA 2RH5A 3EC2A 3UPUA 4TSFA 2ZR7A 2XB4A 4CDGA 3KTAA 5KPJA 1NG9A 2BWJA 2FWRA 2PT5A 1KI6B 3CX6A 3LVQE 3OEED 1C1YA 1R0XA 2BJVA 2IL1A 8OHMA 4EDHA 3FB4A 1U9IC 3H2YA 4DDWA 4Q1BA 3AF1A 1UKEA 4KFRA 1TQ4A 4D6PA 1II8B 3O8CA 4RD1A 1Z2CA 2A7QA 2X2EA 1G8PA 4B6EA 2FZLA 3R20A 1RE0A 4BZQA 2PBRA 1PUIA 4TN1A 2WHXA 2C9YA 3NHBA 4HUTA 3CRW1 1G21E 5FOSA 3RWMB 2FU5C 2OFWA 3L0OA 3LV8A 1G3MA 4UQOA 1Y3AA 1A82A 3QKTA 3E2IA 4RY2A 2QMEA 4JL6A 4II7A 5AUQA 3KXLA 2JLWA 1GM5A 3F8TA 4ZCIA 2GEVA 1W2HA 2OFOA 3PEUA 3U3KA 4LUCA 4M4SA 3GD7A 3W9YA 4BECA 1W36B 4DLUA 1KK1A 1DADA 4DLXA 3AVYA 1NBMD 3RS2A 4HLUA 3UMFA 1T9HA 4ZKDA 4F7WA 3X1YA 4IHQA 3KKPA 3VR2A 2OAP1 5IK2D 1S9DA 1EX7A 3UWOA 2KSQA 2VRWA 4OQFA 4DUGA 4FXPA 2A5GA 4ESHA 2BBWA 1NG1A 3VR4A 2A5DA 1ZM9A 1P9NA 3VR6A 621PA 4QKQA 1DAGA 4G5SA 4MRPA 4FMDB 4KJZA 1CULC 1FMJA 3PVSA 3NIBA 2C78A 3KKNA 2V9PA 3VR5A 3ADCA 2BVNA 2W6JD 1SVKA 1YR9A 3CLVA 1II0A 2J0VA 1Q12A 3SBEA 4KITB 4UNRA 1R0YA 1VYUA 2FPKA 4Q9JA 1RYFA 2ZU6A 4NU0A 1XCMA 1TADA 3K53A 3K0CA 5JHHB 4AYWA 1AGPA 4DEXA 1IY0A 1E9BA 1YJ5A 3U3RA 2VIIA 3SHWA 4BLOA 2GCOB 3Q7QA 2YNMA 4LI0A 3ZJYA 4TMXA 4IDOA 3UMRA 4BRWA 2ZJYA 1GL9B 2JATA 3NVAA 2XSZD 1FMLA 2ZRGA 3QKUA 4GOKA 3LVRE 4M9QA 5L3QA 5FPYA 3EPLA 2ZRNA 1XFAA 4PC7A 1MO3A 3IBGA 5LD2B 1BS1A 1OSNA 1S3SA 4NYJQ 4CEHA 1JQJC 2OG2A 3CZQA 3QF4B 4KAXA 4TLCA 4M1KA 3GFPA 3I72A 4RD0A 1KKMA 4LOAA 3R8CA 1DEKA 2VP4A 3PUYA 4EQ6A 5TMPA 1F5NA 2FA9A 5EP2A 4RKEA 3U5ZB 1KKLA 2FGKA 2GK7A 2NZJA 1Z6YA 2R65A 3KTAB 4PO8A 3IEVA 4MRRA 4BEBA 2WWHA 1Z29A 4XSGA 3U2QA 3ZVLA 5F9HA 3B7GA 1ZCBA 4A2PA 1NJGA 1T3SA 1ZM3A 2ATVA 2OCBA 3FOZA 2WSSA 3C7KA 2WWYA 4Q1EA 2XJ4A 1N6IA 1XBTA 5FPHA 1XTJA 4HZIA 1Z6TA 2ZJZA 1TEVA 3B1VA 4D82A 2F1JA 4EJSA 4W9MC 3LBHA 1DAKA 4M22A 3UATA 1XZQA 4L9SA 3T61A 2B6HA 2FE4A 2BIFA 2TMKA 4UNQA 4RD6A 4PPQA 2QEQA 4MRVA 5EE3A 1CR1A 1P73A 2ZPTX 1J7KA 2H7VA 3BH0A 2P6NA 1W0JA 1MH1A 2BJWA 2IEZA 1D2NA 2J46A 2GF0A 2EFDB 2XZOA 4QRHA 3BB4A 1FFHA 5FI1B 3KQLA 2A2ZA 4NBSA 3U3MA 1G7RA 3W34A 4O25A 1FW6A 1S9HA 3DL0A 2QAGC 4ARZA 3RDPA 3QXHA 3VTKA 4WAUA 1U0LA 3R7WA 1N0WA 3PFIA 2QGNA 4AWXA 1EFHA 4RCZA 5B58C 1E2DA 3ASYA 1A1VA 1U81A 1ZU4A 1X8JA 3D31A 2ONKA 3GLHA 1U0JA 2GXSA 1EFUA 1NSTA 4HI0E 1AS3A 4FCWA 4C0AC 4NMMA 1E2EA 1SVOA 1E1QA 2IYYA 3V9PA 2AHOA 4LJAA 2ZRLA 4TQUS 1U8AA 3G5UA 2OBNA 2F55A 2IEYA 4DLZA 3RANA 3MCAA 4Q4AA 1T8TA 4JS0A 2JASA 5JEEA 3PEVA 3AP1A 3GFTA 2VSOA 4ZPXA 3B2EA 3UANA 4K8OA 5EE9A 1BYIA 2WWFA 3WMEA 4MGZR 4N1AA 2FJUA 1CR4A 5JJKA 2AD1A 2GCPA 4H1VA 1OV4A 3SQWA 1KMHA 4RCYA 2G88A 4IVRA 2XTNA 3QKRB 1ODFA 3EZ9A 4GP7A 3OEHA 4KODA 1HQCA 4EPYA 2VTKA 4PANA 5SZKB 2KJQA 4YXWD 4EPRA 1UKVY 1US8A 4IW3B 3WBJA 1X86B 3LBNA 4FMCF 4E22A 1EWRA 1XP8A 4M9SA 3BC1A 5L3SB 4CEHB 5F9FA 3I73A 3BB3A 3VHXA 5J4VA 2J1LA 4R2IA 3TUJC 5EJEA 4AKHA 1O3YA 2B7CA 1E2KA 1E0JA 4EQ6B 3G0HA 4CF7A 4BLPA 1CJVC 4TT3D 1Z08A 3TJZA 4JLNA 5TY0A 1WBDA 4Q19A 2VP6A 4P31A 1LS1A 2PH1A 5EUQB 2PX3A 3MJRA 3QXCA 2VHCA 3NDBB 3LW7A 2BC9A 2QA5A 4Q01A 2QT1A 4MKIA 1OH6A 3UKDA 2BMEA 1WQ1R 2JJ1A 4I4LA 3GJ0A 2RGEA 5P21A 2J3EA 5FI0B 3KB1A 4EJSB 4BLRA 5JI2E 2A5JA 2PMDA 1E2JA 1I2MA 1E3MA 5JECA 1KI9A 1VPLA 3GJ8A 5DGXA 3RSOA 1IY1A 4IFBA 4I1UA 2J0QA 1CJUC 4KO8A 3L2OB 4OHYA 2AKAB 4GOXA 2QM7A 2QI9C 3X1DA 4JZKA 1S1MA 1N25A 1N0UA 3FKSD 3PENA 4GT1A 5KDDA 2OLJA 2ZJ5A 4TYWA 1S4QA 3UG6A 1TF5A 4KV9A 4G5GA 2XTZA 1YHNA 3CBQA 2Q3HA 1JR3A 1M1YE 2OM2A 4ARZB 3SEAA 2Y8EA 4Q4HB 4D4LA 1JEEA 2DFNA 1VECA 5A0FA 4JSTA 4QGAA 3AVQA 5BW8A 3AVTA 2YWEA 3Q85A 2XX3A 2WOJA 4ACAA 1X8KA 4HLCA 3CX8A 4DIEA 4FMBB 3ZH9B 5K8LA 4IKEA 2IUTA 3GLHB 4RZ2A 2ZE7A 2BMDA 3AF3A 2FSFA 3FHOA 1S8FA 2JA1A 4KYIB 1N5JA 1SULA 1PZNA 4NKRA 2UKDA 4XD7D 3NBXX 2VA8A 1SZPA 1JXMA 4U00A 1KSHA 1P9WA 1Q3HA 2DR3A 3T12A 1ONBA 3DZ8A 1GIAA 1KDTA 2ORWA 3GJ6A 4DLTA 1VKJA 2O0HA 4O0MA 2OESA 2ZRIA 4URZR 5KOYA 4Q4AB 1KYIA 1MO4A 3LX8A 4QGGA 2ONJA 2RCNA 1N6RA 4EIWA 3GLFE 3V4FA 1P9RA 1XD2B 2ZSFA 2RGXA 3QPWA 5AWFC 1GKUB 1GRQA 1YZLA 5FOWA 1NMXA 1SXJC 4QOSA 1R5OA 5CB6A 1KI8A 5BN3A 2VSXA 4JVSB 1OB2A 1HTWA 2R8RA 2F9LA 3EWAA 4RVCA 2W00A 4JLAA 1NP6A 3TIFA 3EPHA 2ZI9A 3CUEF 2HUPA 3T35A 2WICA 3OFNA 1KMQA 4A9AA 2JIZD 5CDFE 5H8WA 3C14C 1COWA 2CL0X 721PA 4NYJR 2WIBA 1IJFA 2B21A 4LV8B 4G5OA 4BASA 4YDHB 1Z63A 3I61A 4PXAA 4DBLC 1US8B 4GL2A 3IIJA 3QPVA 3TSZA 5EZ6B 4QJ4A 1LW7A 3BH6A 1DE0A 1SVIA 1UFQA 4BFYA 5C2JB 3K0AA 1Z6XA 4IFEA 5CYOA 1CEEA 2QNRA 4JMPA 2DFLA 1UBGA 2OILA 2KBFA 1G64A 1DG3A 4V0MA 4N3NA 2Z6VA 3VAAA 2GXAA 1L4UA 2GHIA 4IXMA 1CF4A 4LJ8A 4CRWB 4KSCA 1BOFA 3BB1A 4LHZA 3OE7D 4NYIR 5FL7D 2FMXA 2YINC 4OHVA 1QHYA 4L9WA 3CW2A 4JL8A 3PEYA 1E9DA 1DOAA 1DAMA 3SE0A 4LC1A 4DLYA 5DHAA 4L4UA 2PX0A 4EKDA 1YR7A 3P1JA 1AA9A 1KJYA 3BFVA 3C5HA 5BQ5A 4AYXA 4HDOB 3C4JA 1X8LA 4WZAE 1D9ZA 5DIFA 3GLGB 4L16A 4DIDA 5CK5A 2BEJA 1G3UA 2R6CA 2G1JA 3CNLA 4Q7MB 1P4SA 3QY0A 4LYAA 5E7IA 3VNUA 2PZFA 1XTRA 5AJWA 1GDDA 1YZUA 3BK7A 1KNQA 1CP2A 2GXUA 3W3ZB 5KTYA 2OHFA 4UKDA 2GZDA 5FR2A 4CVNA 5JRZA 1D2MA 1ESNA 1N6LA 1OKKD 3F3YA 1G7TA 2XEXA 3SU8A 5KUTA 2DCUA 2VO1A 3CIOA 1XMSA 4MUAA 4KSBA 4ASUD 4E07A 1U90A 1TF7A 2IUSA 2EVWX 4C2TA 4AC9A 4Q7KA 4IDNA 4PAOA 221PA 2NO7A 2RAPA 5LB2A 1EWQA 2CLDX 2G77B 4KHZA 4WVFA 3EIEA 3EZ7A 3KKQA 3MWKA 2DY1A 5EUMA 2ZAOA 4Y0AA 4OYHA 4JVNA 1KZGB 3KX2A 3R9IA 1EFCA 4QHSA 1XZPA 4DDVA 2ZJOA 2FSGA 3SFVA 5AR1A 3M4YA 3LXXA 3HPQA 4BUJA 5JFGA 1JPNA 1F6BA 1G5TA 3IO3A 4B34A 2NPIA 2C9CA 1CKEA 2WWGA 4QBHA 2F43A 2YOHA 3MGCA 3K70C 3WMGA 3QVUA 2QT0A 1PUJA 4WW0A 2XNDD 3THYA 2OZEA 3HPRA 1GSIA 2G0NA 1GILA 4W7SA 4ILEA 4PQFA 4KXFB 2ZVQX 1AS2A 3RSLA 1ZUIA 3RRMA 2Q21A 3EA0A 5HKKD 2CK3A 2ZSDA 5JRJA 2DPXA 4A36A 1H8ED 2P5TB 1QG4A 5A5GA 1PLLA 3BAFA 3A4MA 2W6ID 1Q1BA 3OESA 4LBWA 4Q9HA 3RAPR 1ZUNB 3B85A 4C4PA 3FMIA 4BEJA 2AFIE 3RYTC 1QBKC 4WZ6A 1P2SA 4JBXA 2PLFA 1DAIA 1NN1A 3T5GA 1FZQA 5HCIA 3JVVA 1YZNA 3AKDA 3T5DA 1XDBA 2HV8A 4IDHA 1OIWA 2HJGA 5BN5A 3N70A 3K0AB 4TYNA 1YZTA 2ZRBA 1K5DA 1W49A 5C18A 3QE0A 3VKWA 3FTQA 5F98A 1F2UA 1SXJD 2EW1A 2VL7A 1VYVA 3CF2A 3RWOA 4MRSA 2QENA 4ZDWA 3M0EA 4CIDA 2FG5A 3LWNA 3EZ2A 5B64A 3SYKA 1GRRA 1TF2A 3DM9B 4PTLA 4C0HA 1Z22A 1AQUA 4CYMA 1M74A 1NVUQ 1L2TA 1XXHA 3TLXA 2JGNA 1BMFD 2HT6A 3K1JA 3MUFA 3RS5A 4Z8XA 4BE7B 1XJQA 2ZR0A 4R7ZA 2P6UA 4R71A 4KU4A 1E2GA 4X8LA 4LDJA 3W5IA 1UEJA 2A5YB 2FFBA 3MD0A 3PG5A 2ZYWX 3B9QA 3LBIA 4V0KA 1P72A 3PUZA 2ZRHA 2DWQA 5L3RA 2RGAA 3OAAA 4GP6A 4RKFA 1WA5A 3BIFA 1E0SA 1XEXB 3AUXA 3AGQA 2MSDB 5DN6D 2C8VA 2E1RA 4XWAA 4UXIA 2GJAA 1I4TD 1Q21A 3GEIA 5H70A 3G82C 4K46A 1HE8B 1R5BA 3NH6A 1OFIA 3A1UA 3EWSA 3FMPB 4NH0A 1E9EA 1ZIPA 4QFMA 2BMFA 1GKIA 4CEJB 5SZIA 4XTCS 2Q6TA 1VG9B 2A5FA 3EARA 4WBSA 3P26A 3LW8A 3A4NA 1IJEA 1W36D 3BERA 4TL8A 1XD8A 3KFVA 3M6AA 3REFA 3NBFA 3U44B 3GLIA 3Q5EA 2WWIA 2GZAA 3THXA 4LPKA 5CLQA 4G3XA 4C7OB 3IHLA 1AK2A 2OCPA 2I1VB 4EFMA 4P3YA 1L7VC 3I1FA 2GESA 4BZPA 4OI4A 3ND9A 4LYHA 1JI0A 4FIDA 2O8DB 1N3BA 4JJZA 2CNWA 1CR2A 2AFHE 1SVWA 2HLDD 2QM8A 4A8JA 3N2IA 1HY3A 1FQKA 1ZM4A 1TPZA 1E96A 2D7CA 5DH9A 5J4KA 3PV0A 1VCNA 2CMKA 3DOFA 1WDTA 3AVOA 3A58B 3LAWA 4AURA 4XH9B 2GEDA 5E3HA
chains in the Genus database with same CATH superfamily
1UBFA 4QPJC 4Z4FA 2JGLA 3AEKA 5B30A 2YN0A 3VVBA 4Q00A 3JS5A 4JUDX 1Z6GA 2C2HA 2WJIA 3AUUA 3HJNA 2BHRA 4KO4S 2HBRA 4URYR 5F3DA 3BEOA 2HT1A 5EIBC 1E92A 3IURA 1V8BA 2ETVA 4M7RA 2FCAA 2NO5A 2C92A 1GKKA 1KNXA 1IXSB 5SYMA 3NJ8A 4XB6B 5PNTA 1JECA 4HDQB 3CTMA 5TT1A 1WCXA 1VMDA 3TL6A 5JBQA 1GPMA 2H11A 3QUCA 3RI3A 3ETNA 2C4UA 1Z83A 1VE5A 2XVAA 3U7HB 4LGMA 1WF6A 5IHXA 1ZXLA 3V8RA 1ADFA 2ONCA 4X8MA 4XUDA 4XX0B 4XJSA 3HKDB 1HDZA 4A0FA 1C9EA 2C5EA 2HF8A 4MIKA 4TWRA 5KJ6A 3BBPA 1JHVA 4UTNA 1OAOC 5KTSA 3UUWA 2EGHA 3PXGA 1CD5A 3K2IA 5TVGA 1FNNA 4CFZA 3VPSA 1GQOA 5EE1A 4DCJA 2CYCA 4Q3CA 1PG2A 3UW3A 5WRFA 3ER8A 2D1YA 5BRAA 4Q3NA 3EOZA 3I0ZA 3I52A 2R0QC 2V98A 3RSCA 4OK3A 3TOZA 1DLJA 3HRKA 3L0DA 5B3JA 2FR0A 3K0HA 1CQPA 5CXUA 4N03A 3O1JC 4BVLA 1YL5A 1RPJA 2GRJA 2XRFA 1Y1PA 3DVAB 1XZBA 3A1VA 3H4MA 3MCVA 4PPNA 4BVGA 3EGDA 5JU6A 3RM3A 4PICA 2BCGY 1A50B 1XCPA 4I50A 2BV3A 4MARA 4XQEA 5JEDA 2PS3A 2HJRA 1EINA 5FYDA 1GTMA 2WILA 3RC3A 4MITA 1CUWA 2UVDA 1D9XA 3A6EA 1CTQA 2PGOA 4CW7A 2P5SA 4NZYA 2PO5A 1LV7A 3FH0A 4DCTA 4HQNA 3C39A 3NNDA 5DNVA 2QT9A 4KXYA 4LWQA 2R8ZA 3IQEA 4YV0A 2Z43A 3GJ5A 5JR3A 5BUZA 4A2WA 5KQRA 1C0IA 1X2EA 5HBGA 4INPA 4LJ9A 4P84A 2GZSA 1ZBDA 4ZEXA 1HOTA 4UM5A 3V8NA 1TTHA 2PGJA 3E58A 2WA1A 5BSEA 1KRXA 1PFGA 1YBHA 3M49A 4Z53A 1WJGA 2CFSA 4Z8YA 1IZ7A 2GK4A 4EOGA 4KQJA 3I9NA 3LP8A 3PXBA 4CDNA 3D9QX 3KOZA 4ZC8A 5BRJA 3R75A 4YUYA 2JI4A 1WMDA 3LWZA 4LMPA 4ZOLA 1BG6A 2ZUBA 1AJEA 2REBA 1Y4UA 1GPKA 3E2PA 3FPHA 5I9MA 2PE5A 1PHPA 3I92A 3VKHA 1SVUA 1Q16A 1NZDA 1ZU5A 2CLFB 2HWWA 3ESRA 3HEBA 3PGJA 3QW2A 4IEEA 2XB2A 1ZUWA 3WGTA 4GYYA 1D04A 1XKXA 3MWYW 3BQ9A 3WY9A 4IHJA 2AXQA 1MQAA 1N5KA 2Y66A 5ES3A 3SIPA 3ZZ0A 4RVHA 3AWIA 2F8SA 4HLQB 5IC4A 1T4MA 5IFKA 3HXKA 2DBRA 2IH4A 4BIIA 4D45A 4TQGA 1L4LA 3ZV7A 1QIJA 1ZC3A 3L7CA 3H11A 3ZH2A 4UUMA 2DFPA 1FX0A 1KBOA 1KQFA 2OEPA 2ZT7A 1A9XB 1R6UA 1Z5OA 1E7WA 2G9ZA 3NG1A 2MSEB 3U4QB 3D3WB 3GL9A 5TEVA 1S4MA 5GINE 3R3YA 5JTUA 1I3KA 1D5CA 2EP8A 2K5UA 4WZBE 2EGGA 3TPZA 1P8JA 4UTVA 3H5TA 3FNFA 4BNVA 3TK1A 1QU2A 2X1MA 2ZRMA 3B3JA 4COKA 2ZM5A 1Q6ZA 2ERCA 1ZIYA 3OF5A 4TZKA 3MYYA 1KP9A 4UATA 5EKTA 2MYPA 2W6JA 2GN2A 2QX7A 1F0KA 2QTVB 3DDUA 5AJUA 5DEOA 3RNLA 1SVSA 3FG9A 4RANA 2Q0HA 1RBYA 2EX0A 1BW9B 2YWCA 2EEPA 1JDVA 3EHDA 3KFLA 2CNNA 2ZYAA 5JCZA 1F2TB 3VR4H 5JSFA 3ZX4A 2FF5A 4JBWA 1CUGA 1IBRA 1RWVA 2CKMA 5KYXA 3A9UA 2WQZA 2VT2A 4QDZA 4AL4A 3CMMA 4XQCA 2L18A 1O94D 3UKOA 2XNHA 2G06A 2NNWB 3FMFA 4YJ2B 5DP1A 3QW4B 5IYZA 5E6RA 3HJHA 5DT2A 1XI2A 1UOQA 1ESMA 5CXSA 3FBTA 3I4CA 3KZVA 1XEAA 2VHTA 1LSUA 4G5XA 3IDAA 4LJ7A 4N0PA 3B12A 3E15A 2PYZA 2VYFA 2YHIA 4F7DA 2CF5A 2ZRAA 4I1OA 3LYUA 5ALNA 5BO5A 2PBLA 1ST3A 4YACA 2JGAA 3UWKA 5LP6B 4OBWA 4CMHA 3QTBA 3A04A 1BRTA 2V1XA 1F60A 2WSSD 4K88A 1M6NA 2GN4A 4WASA 3NMUF 1KVRA 1CDOA 1T0UA 1UXOA 2VBCA 1NBAA 2C9DA 3HYTA 1I32A 2F00A 2P2NA 3AI3A 4EATA 4M8NE 2IEBA 2VJNA 1Y6FA 2F1KA 1E2HA 4RVUA 1APBA 5IT9A 1XALA 2Q6LA 2FPPA 3SK0A 5DLPA 2O3JA 4DR1B 1RIFA 4OUDA 5CT6A 3HDTA 3NHPA 1NPTO 2GS9A 4J75A 2BOVA 1KGDA 1SD1A 2Y93A 3IRUA 1W0KA 5FL3A 3QQ5A 3LUAA 1TAGA 3FDFA 4F6CA 3HBLA 3VKFA 2GVDC 2AVDA 3ND5A 2NV0A 1HQDA 1OZFA 4LOKA 4N7JA 2IS4A 1CE8A 2PH7A 3A6LA 1KBZA 3ELYA 4G9EA 2QQ0A 3V1YA 4QJ3A 5C5DA 3AVVA 1QHFA 4Q9KA 1HX7A 7ADHA 2XLCA 5MGBA 3RADC 5JZMA 3GT4A 3V4VB 4GOND 2R8XA 4QU0A 3QX8A 4CHGA 2IBTA 1A72A 1TIKA 1U6JA 3NVDA 4XW2A 4KXNA 5CVDA 5GY7A 4B17A 4IRMA 1CDDA 4BUZA 5LZ4A 5HIKA 2GXQA 4EF4A 5I7RA 1NUAA 3ETHA 4LDNA 2EBWA 2X7HA 5GADl 3EZYA 3FJOA 2YMMA 5DRTA 5LMNB 1Y8RB 2CB9A 1C7EA 2JGIA 3VMFA 1CJMA 1DO2A 1IHDA 1NVGA 3GVCA 2DPLA 2RGYA 3Q87B 4F8YA 1W7AA 1JG6A 4FYVA 2SECE 3OHMA 2VH5R 2VDPB 4ZCRA 3P96A 2HPVA 3HBFA 1ZNZA 4U9IS 4YMVA 1EYZA 2YYZA 1RJ9A 3IUPA 1R10A 4HYYA 2UZ3A 1AZLA 1SU7A 2ZSAA 1F6DA 4JBGA 3TRFA 3VA7A 3NASA 1H4QA 4A8PA 2ZS7A 3CB4A 1PFKA 5DIZA 5F2EA 2HJSA 1LDNA 4O59O 3DE7X 2C57A 3EZFA 4LJ5A 3V8VA 5THXA 1Q7CA 1QX3A 1ZD2P 3U80A 4G8DA 1JHXA 3HSKA 1B6TA 5LQUA 1T0JB 1USKA 1XNGA 4UXJA 1U0GA 1W9HA 4WCFB 1XUOA 4YFVA 5J5AA 1C9NA 4DLNA 5KJCA 1DCFA 4ZTBA 3O3NB 5IN4A 4AZ0A 4PC3A 4YV1A 3KSBC 2Z2ZA 4MMZB 3TLYA 2HUNA 3U3ZA 1ZGGA 1GQQA 2XZLA 9LDTA 1IY2A 2JCGA 1DHRA 1NMZA 1X0VA 2B8WA 3HDGA 3ICPA 5DASA 5FBHA 3ZKWA 3PJEA 3VTFA 4Z4IA 2C4KA 4PYRA 1O96A 4G4JA 4IDQA 2YY7A 2A0UA 4IV0A 1K0UA 1KK2A 2EF1A 1ZK2A 4A6DA 2BP7A 1WOYA 5K3SA 1C1DA 5HJ7A 1V95A 4MWCA 2Q2QA 3EGXA 4IH4A 4Y67A 2V6FA 2YWFA 4NOLA 5I5GA 3T9DA 2LCFA 5CLLA 1P0IA 1N5DA 4DIBA 1N32B 2F3SA 1WPXA 3DBHB 4RH3A 3LGAA 5AJZA 4YXWA 2NU9B 4C43A 4O4JF 1V6AA 5IEBA 1LVGA 1POXA 3N8IA 4R9UC 3RT1A 2PNFA 5JH7A 3G23A 4QFDA 4AY6A 4NENA 4OI2A 2WA2A 1UDCA 2Z6AA 4LYFA 3LO8A 1UDWA 5CDSA 2I62A 5L45A 1E32A 2BSXA 1CRLA 1NF3A 1X39A 1MAHA 1O77A 4P0TA 5DSXA 3V42A 3DTVD 4Q24A 5IKMA 4Y9RA 1N9GB 2QUBA 3Q9NA 3ZLVA 1Z36A 4K1XA 4YN3A 3U7EB 3CLTD 3TX2A 1YI8A 3P9NA 4QBFA 1HG1A 4GW3A 4X8HA 4Y9TA 4MQFA 3OY2A 3G8AA 4RGQA 3U4MA 1NXXA 2NU6A 1QF7A 2XOKA 3MJTA 3P32A 5IJAA 1AK1A 5JQWA 1G5IA 2VUHB 4M8IA 1RAGA 1UUFA 3ROXA 1NXTA 1W48A 3L4EA 2XVZA 1R16A 4G1FA 4U5QA 2OA0A 3RABA 1PQ4A 5ILGA 3REOA 4PQGA 3ZD6A 2O23A 3AMVA 3IR5A 2Z3ZA 3KUUA 2CL5A 5GOZA 5BN1A 5KNBD 4FZJA 4CL3A 1KI3A 1QHIA 3PHBE 4LFCB 2FETA 3R2JA 4L07A 3BIOA 3I04A 3WLPA 2HPHA 2X0IA 4ZRNA 2XOEA 1U0OC 1EJ0A 4HZUB 1Z25A 1U4NA 1NNUA 2XQJA 1QHXA 4DMUB 3UUEA 4J1TC 1CUVA 3GGSA 1T3LA 4YS6A 5IHPA 4FZRA 1ZPDA 2H00A 3ZXUB 1FVOA 2IPXA 3IBYA 3PXEA 4D9IA 3FKSA 3QQPA 4ENVA 4G0NA 1IQRA 5KHLB 3G9TA 4GBGA 4DDHA 3KV1A 5A7FA 3S0JA 4ZGBA 2H1WA 1K7SN 3CR8A 1Y5NA 3GLFA 4MYDA 3OP4A 5ANRB 2HA5A 4CNQA 3SX2A 3MMSA 4ZVPA 4GYJA 4X7RA 4LF4B 3B6EA 2Y2VA 3EAQA 1EQUA 2AK2A 3K6RA 1I80A 1ZYUA 3B70A 4EAQA 1QRUA 1FMFA 4HAOA 3ZS9A 5DM70 2GH1A 1KY3A 1PEYA 2OQIA 1MTZA 1XZGA 5CBKA 1FS6A 1F4VA 2ZIXA 5LSAA 5GMOA 2VYND 4AKGA 3BMNB 3IKJA 3NANA 4K6KA 3LBAA 2PTHA 5IAOA 1BDJA 2PGLA 2A88A 5CDFA 5KVSA 4W6ZA 4U7PB 5AJYA 1O6CA 2V7QA 1ZI6A 3P0RA 4BJ1A 1KYZA 2SNIE 1ZD4A 1E6LA 1D0IA 2YZ2A 5IULC 3GPLA 1EM6A 1IPEA 1ZM2A 5KWSA 1J0DA 1OW3B 4EJ2A 3MCZA 3HJFA 2Y4OA 3QFHA 4GWGA 1ORTA 3MAGA 1W8DA 2O3TA 2ZSBA 3T7DA 2QAGA 4DYVA 4F4UA 2R11A 3U4GA 1GN9A 2ST1A 5M04A 2OVBA 1E64A 3ERCA 4EQZA 4GR5A 2PWZA 1LLCA 5ILOA 2CGEA 1L5WA 4URUR 3VC1A 1RRGA 1OFGA 2NYUA 3DVSX 5ICGA 2IHTA 2FFHA 3H6KA 1SPXA 4OCZA 2GFIA 5SY4A 5JBIA 3I45A 3CZRA 5LWHA 2FQQA 3L4KA 1GUZA 1Q3KA 5D3MA 4FJ1A 2V4MA 1QIHA 4IJ6A 4E46A 1WULS 2WV7A 5LKAA 2VLIA 4Z6KA 5HOQA 1CBUA 1HL7A 3AO0B 1NQWA 1U2ZA 2HO4A 1IHXA 1XZMA 4P82A 4QL3A 2HCBA 3RROA 4GSLA 4D7AA 1RQRA 4KVZA 5DYYA 5LJIA 3GZJA 2EJBA 2P4UA 3K05A 1GPH1 3VZSA 5EKDA 4EVRA 1QB7A 4REMA 1H3NA 1QH8B 4RENA 5F1YA 1QJCA 2DECA 1I13A 1SCNE 4HRAA 3WGHA 5IM4A 1FDUA 3CHYA 1HUQA 2F6RA 3IIMA 3KUKA 4B4DA 3BCHA 4I19A 4MWBA 3HO8A 2VWGA 1M6VA 4KK3A 2W5UA 3UUFA 2WIJA 1BKYA 3LA6A 5MN6A 5HE8A 2ZSIA 4Z54A 3Q3EA 2R8OA 1P1JA 1CVLA 2VF7A 1N2CB 2YJ4A 5KO2A 2IP1A 3PKZA 5GONB 3A2LA 5EVCA 5JYCA 4ISCA 1VBNA 4LCEA 3N6RA 4FP9A 4E32A 4RTRA 5DHQA 5HA5A 1E3WA 4KGZA 1KERA 3NATA 2FW0A 3TINA 4GXNA 1UMKA 1RC8A 1T0PA 3C1UA 4E4YA 2PZEA 4PY2A 4QU5A 1CJKC 2BI4A 4HYTA 3COPA 4MWTA 3LCUA 3HA2A 3SJ7A 3EMKA 4HGPA 4FFVA 4WXYB 2G4CA 4OYYA 4ZCMA 3JVEA 2AW5A 3TLAA 2XXBA 4ZOCA 4A15A 3B36A 4IKPA 4QOHA 5FADA 4BRUA 4BFSA 1TQ8A 3TNYA 1ISPA 1VP3A 1JSRA 1XZFA 2CUZA 3QUQA 5CJPA 4HNAB 4KZPA 1N5RA 4KACA 4WXEA 1QK3A 3F6RA 4R2WA 5CX1A 3O4IA 4I4TB 1IVNA 4QYWA 3P9CA 5SYNA 2D54A 3STXA 1G3QA 5KYXB 2J5QA 3DWFA 4ZD6A 3ZWOA 5LFAA 2FMTA 2J09A 5LOVA 1TPYA 4KUGA 1IEWA 3JQFA 4LVOA 5KU1A 1YDFA 3H1GA 4XLLA 4DQ0A 3F7MA 4XDYA 3AKZA 1E2BA 3CH6A 1NXOA 3VDXA 3IESA 3GPBA 4OHZA 1U1DA 2R2GA 5HYVA 1DDGA 3ILHA 4QNRA 4ZK2A 3AR7A 1BU8A 5D5HA 5AVTA 3JQ9C 3LH5A 5I7WA 1I3LA 2ZJBA 3WLFA 5EJFA 1J0XO 5CVUA 4LY9A 1IHPA 4NQZA 4C01A 3KPYA 1EUYA 1ZOPA 1QYVA 1JG4A 1MRNA 5C8ZA 3IMGA 2RHLA 4RU1A 2H06A 3PEWA 5IKXA 1YVPA 4Y98A 5LD2C 4HNGA 4QTZA 1E1LA 5IAKA 4YRAA 5KOHB 1L5GB 2YRWA 4QNMA 1T2EA 1ARZA 4ZT2A 3M3DA 3BT7A 2BF7A 3EVBA 5JSKA 2ZUFA 4HAXA 3EXHB 1SH7A 3ZGXA 4CM8B 4BZWA 1EVYA 3NRCA 1CUAA 2OY0A 3EW9A 1KDPA 2X7XA 1BROA 1CRQA 1N5LA 2ZI7A 1G60A 4RFSB 2BFOA 3PC2A 5ESXA 2R6GA 4H1UA 3O7MA 5K3CA 4PBRA 3OQBA 4OH7A 3KU1A 4QECA 1QZXA 4L6CA 3CVXA 2FX3A 3F9IA 1G1MA 2HXYA 3ZDBA 3VU8A 1CCWA 1P74A 1XMJA 4CL0A 1DL5A 3V1KA 1NJ1A 3VYRB 1YQGA 4IOJA 3ZHOA 2VQEB 1VLHA 3TLGB 5G4KA 2C4WA 2WSYB 1MT0A 3U4AA 3ZIAA 1FFEA 2YCLA 3RSFA 5ELXA 1E9VA 1YKFA 3JALB 1E20A 2Q1YA 1XZLA 2AZ4A 2NSDA 2V4ZA 3AESB 4WT7A 3ZK9A 3CNBA 5LC1A 1ZHHA 2H8KA 2QR5A 3VUFA 1NJ2A 5H7XA 1MJFA 4ZAFA 4YQEA 4CR6A 2QPLA 1VCIA 4CEIA 4B9EA 5K0NA 2H1VA 3UAYA 3W5CA 3DFKA 1DDOA 1Y7TA 3GMTA 4RF2A 4UOQA 3RIEA 3FCOA 4TM7A 1WS6A 1U8XX 1X3SA 3BFPA 1ZA2A 3V8BA 1Z47A 3AC0A 3N74A 5EGNA 4GPTA 1N36B 2BM8A 3NORA 5B2FA 4DKXA 2V7TA 4D9BA 1P2TA 2OHVA 3IHTA 4LBVA 1FYFA 1RPNA 3IQWA 4A4DA 1UBJS 1YVDA 3PC7A 4HLUC 5ECWA 5FTLA 3ZWKA 4JD5A 4FU0A 4A0GA 3LLUA 2P4SA 4HEQA 1KSGA 3FCYA 4DMGA 5JNTA 4Z0TA 1QF9A 3W3AA 5AKHA 2GK6A 3QOXA 4CKBA 5C7LO 3V3KA 2A84A 1H2BA 3K3PA 5B7QA 2B1RA 4F2DA 4TRJA 2HA6A 2J3LA 2QTBA 3UMYA 5A9SA 4MUYA 3V1LA 2N1BA 4M9XA 5JNWA 1WUTA 3EIUA 4CG1A 1SBTA 4I3GA 1U2GC 2D3TA 2UAGA 3U13A 2EP7A 1TYDE 2FRXA 1YAHA 2RHCA 2ZBGA 3QKSA 4W6QA 1CUSA 3G02A 4H77A 1G2QA 3TJRA 3ZCVA 2FSVA 3DMGA 3TDNA 3T4PA 3QYPA 4NSNA 2RDMA 4ZHQF 4AJ1A 4J7CA 3T3DA 1P4GA 4QODA 2OB1A 1A8HA 1SD5A 5JD5A 5E6UB 2NO4A 1QKKA 2GTPA 1CS0B 3K73O 3LUGA 9LDBA 4MR9B 4FFPA 5LR6A 1OXXK 3M6VA 4PLGA 1FFGA 2D2EA 2OCAA 3DO8A 1GTJ1 3C3DA 3CUWA 4AUEA 2A67A 1T5IA 1KVSA 2F43B 2PCJA 3VJKA 3W3AH 2FRDA 2YNMC 2V7VA 4HAZA 5I7EA 2C83A 3MFYA 4I8DA 4LHXA 1NUUA 3WLTA 2AFIB 3KKLA 3E81A 4PLVA 2I4NA 1YKSA 3ZYZA 4FN5A 3KPVA 4DSUA 1T8WA 4IEFB 3N7UA 2OGSA 1MX1A 3KNZA 2M98A 4G8BA 1Z37A 3FSRA 2WIGA 4XGKA 2J6BA 2XRYA 1TGVA 5C81A 3KQKA 4XYBA 1Z45A 1JIIA 5CHEA 1L5FA 1PQPA 1ENYA 3B8EA 2YJ6A 3V32A 1TM7E 3DEHA 1RJDA 3EVTA 3D4PA 2VQ6A 3PUWA 3Q9SA 4UAGA 5I7SA 1HFWA 1GDHA 3CKKA 2VP3A 2XXAA 1SCDA 1PTJA 4GDFA 1PQYA 4AUNA 1JDNA 1GEEA 3D6UA 5DI3B 3MFQA 1V5FA 4NFYA 4IMJB 1IN1A 1UPUA 3W6PA 3GW8A 4YRIA 4Q7EA 3HXPA 3RRXA 3U56A 1S2NA 3JR7A 3DW3X 4QIHA 1Z33A 3DCYA 3F2IA 5FWDA 2BZGA 3ZD9A 3M9WA 3H83A 2Q7DA 1QVRA 2J9GA 2MDTA 1VGVA 2V7GA 1KH1A 1H6AA 3EVDA 3IUSA 1JI3A 1LLQA 1MG5A 2BN4A 3SPXA 3QEOA 4GF5A 4XQ0A 1OZGA 4L27A 1E94E 2C7GA 3N7AA 3UY4A 4NRDA 1U5BA 3ZE1B 2XQVA 3F3KA 3C41J 5K99A 3ZU6A 5JATA 4B3RB 2OHHA 5FHQA 1QO0D 2QK4A 3DT9A 2V5UA 3OLQA 4D8XA 3PNPA 1K4YA 1SKMA 2D4HA 4XIFA 3K0FA 3CVWA 1T25A 3KQNA 3TQSA 5H5JA 2OAQ1 3DLBA 4HAVA 2ZUCA 5TQ2B 1Q20A 2ZANA 3G2NA 1WMAA 3QFRA 4HG2A 4DEYA 1X70A 3QENA 2VJAA 1DUSA 4QHTA 2F1HA 5I9SA 4OGWA 5H0IA 1XMPA 2V3WA 3HWWA 1EFVA 1P4RA 3OKCA 4RQAA 4IPTA 2IT1A 5CLIA 3OIDA 2JRLA 2OCLA 5FUXA 3DLIA 2IHNA 3BHIA 1KJNA 5F7JA 1QB8A 2HPAA 5E4TA 5E6SB 4HB2A 3WLOA 2ZCJA 4GEKA 4ZYWA 1XRRA 1J9GA 1NNLA 2WVHA 1QTQA 1SHKA 3PTZA 1Y1LA 2YASA 3QITA 1FU7A 5CXQA 4RKWA 5JJ5A 2IWHA 4G01B 4ZZ2A 1B15A 2HL6A 2V6JA 1K8XB 2VHXA 1IM2A 3PGKA 4O0LA 4NAVA 2ZM6B 2ZAGA 2ZXFA 5EXPA 3HTXA 2A30A 3C3AA 1YZKA 1N5IA 1QP0A 4DJJA 2BMJA 4RUKA 4QEDA 4X85A 1LDEA 1YDHA 2RHOA 2BKXA 4FBGA 2A9RA 2P27A 1FFXA 3AFOA 2O0LA 4QLAA 4DLVA 4MK4A 2IGBA 2J0SA 3IE0A 3H9EO 4M0EA 4EY8A 3L4BA 4YLYA 1GGVA 1ECCA 2DKFA 4JA2A 2OXRA 4QOEA 1F8YA 1M2GA 2AV6A 4FUQA 2C4MA 1QE3A 4G24A 1F38A 2ZB7A 4XUEA 4JYBA 4A03A 3KEFA 3PPIA 2NYAA 5DSZA 3HCRA 2O50A 2PYIA 3DFFA 4B71A 1AKYA 1VFNA 5I4CA 4PHHA 4HT3B 3CEPB 1YGPA 3TR0A 3PR3A 1HI9A 1ZMOA 3ILXA 1GY8A 1BA2A 1XTZA 4LBYA 5J40A 2AQHA 5BRNA 4IQ4A 4QBIA 4HDRB 2OYCA 2FFQA 4DMCA 2IYAA 4KAAA 4FWTA 1NMEA 3HCDA 1CIPA 2VPYA 2H7YA 3C0KA 4J16A 3TXXA 2PUFA 2ZSJA 3D6MA 4RIIA 2QRVA 4C2BA 2HLNA 1AGNA 1DPGA 1NBMA 1JX6A 2FFAA 3BE4A 4PPFA 3VR4D 1PK8A 1D4ZA 1HMPA 4GR9A 4RETA 4NP6A 1A97A 4U2BA 1Y3FE 2I4IA 1PL6A 1Q7EA 4DBVO 1TA9A 4KR7A 2CUNA 2XCQA 1ODJA 5EZYF 2IHUA 1ZY2A 1YDGA 3OZWA 4C4ZA 1G16A 1GAXA 3H97A 4OHXA 4S05A 1YUMA 3A1FA 2D1TA 2XT6A 4EW1A 2W58A 2IQ5A 1MB3A 3CRMA 4KQIA 1YQXA 1NN5A 4OP1A 4RIFA 1M66A 4H7KA 4MHTA 1XRLA 5AHKA 1E9SA 4KYTA 4AJNA 3T9FA 2J33A 5HK8A 2QPTA 1CUYA 2JVKA 3WYAA 5ADUS 4MQLA 2ZJ7A 4MGIR 3S99A 4PGGA 4AZ0B 1GL7A 5EWLA 2ZRCA 3MINA 3PDJA 3I32A 1YOBA 1A0OA 1SXPA 4U63A 1EUDA 5HDQA 4C4RA 1T9DA 5EIAA 5CFZA 2FQWA 1A8PA 2Z2JA 3FVQA 4JBLA 4WN9A 3FKJA 3CSSA 3GXBA 1MABB 2OCGA 1G17A 2KLBA 4J29A 3T1QA 1Z8NA 2X42A 1H2HA 1HT2E 3AWDA 2C9OA 4EFNA 1TZ2A 3B20A 1J8VA 1JMKC 1TD9A 4TRNA 1QTIA 2E2WA 3D0KA 3FLMA 3OWHA 5CFQA 1GZHB 4JV5B 1QH9A 3NC4A 2PQMA 4BU0A 1Q0QA 4EYKA 1NT4A 4ZIRA 5BUCA 3GYBA 3EF3A 2J5XA 3CUUA 3BRCA 1KPGA 1M8FA 3ZDFA 2ACKA 1J22A 3A37A 4RD2A 2EXXA 4I1YA 1SFRA 1VG8A 4M9ZA 4UARA 2TMDA 3KXKA 1T2VA 4EPVA 1KDRA 2YW2A 1IVYA 1YAJA 4Y6RA 2LD4A 3CG4A 2CL6X 3B1JA 4U3JB 2RSLA 4Y6QA 3RYHB 1PLKA 4JCCA 2R7AA 4IDGA 4Z7OB 5L3SA 5AW2A 2P6OA 4ND6A 3TFQA 4YFYA 5KTNA 2ZLBA 1VHJA 3K35A 3L8GA 4D0LB 2C2GA 3QVVA 4PGAA 3UJCA 2DWUA 1RM0A 1Z6AA 3A6GA 2F9MA 1PWHA 5BT9A 1FPMA 2AT1A 3KLPX 3DB1A 1N4AA 3OZBA 1Y4AE 2IC5A 2YN2A 1S2OA 2BFBB 1WEKA 3QF7A 3SLKA 3OECA 2PGXA 2IV2X 1P31A 4WXRA 4B6PA 1TB4A 1QFXA 5CLFA 1W0JD 5BY2A 4BNLA 1KEEA 5AOCA 3ULKA 1KGSA 5MN4A 1NUHA 3Q3GE 2JI9A 4FOTA 3T3IA 2YYYA 1W0KD 4NYIQ 1V37A 3DPSA 4MPTA 1TO1E 1R0SA 2NTVA 4R8LA 3VSDA 1EXDA 3FRJA 4XFKA 3IPXA 4I1PA 3HP1A 1ZL0A 1ZP6A 3IMCA 3WJAA 4LYJA 1XZJA 1VBKA 1ZOSA 2Z4TA 4UVHA 5LUBA 2VYQA 1AMNA 2G67A 4PPYA 1C4XA 4L02A 4PRZA 5GM1A 1RWBA 2CDBA 3GFRA 3O3CA 1VYTA 3ILVA 1TU4A 5DW3A 1JMYA 3NALA 4OJKA 2NPFA 5MGNA 1DC5A 2GYVA 3LOQA 3W5HA 1G0OA 2IU3A 4CTMA 4B7CA 3KPJA 5M29A 2J3QA 3NDPA 2FW9A 2AKEA 1K6EA 1ZEMA 3CUVA 1OOEA 3UMMA 2ZATA 5CYGA 5IXJA 1J5XA 2J0UA 2LCQA 2HLHA 3VU9B 2BKEA 3O92A 2BFDB 5A3SA 1E99A 1X87A 1X94A 1G2PA 1A27A 1QORA 3JZAA 1UH5A 2G9RA 3TBHA 4BVKA 3DMTC 4DMHA 4ND4A 5IJZA 4AP9A 2GQ0A 1MTOA 3QX7A 3S2IA 5HZHA 1G4UR 1NP3A 4JX8A 1E1QD 3B1ZA 3R41A 4OAOA 3W4IA 2ZROA 4DNQA 4NH4A 4GX5A 1QP7A 4NBNA 4OVKA 4DILA 1CY1A 4JOCA 4U5XA 3MT7A 3FB1A 4HGOA 1AMUA 2QJRA 2SBTA 2GI4A 1L1QA 3AJRA 4J91A 4YO7A 1GGJA 1SOUA 2IIPA 3W2TA 1TUBB 2FPLA 4JI6B 2ZIUB 2YC2C 2OUKA 3NP7A 3LNCA 1Z0JA 2VNKA 1PHRA 2WSMA 2BGKA 1COZA 1R27A 3ABZA 1HRKA 3EGVA 4GYWA 4OB8A 4PW0A 4WKBA 2QL9A 5AM5A 1U3VA 3TZ6A 2R25B 3MC1A 3OTWA 3QV2A 1H65A 4Z99A 4QATA 2YDYA 3MZ0A 2PX2A 1KZHA 5KS2A 2C2OA 1VGQA 2E4AA 3CPHA 2XCIA 1H2YA 4DM7A 3DXYA 3AZQA 3M3PA 2FK7A 2CZQA 2FK8A 1GZ3A 1XD2A 2GHQA 2NM0A 2IYXA 3C5CA 3M70A 4HDMB 3ZLTA 3BH7A 3CMCO 1U2PA 2NTJA 2C84A 3IJRA 5ALJA 2E4YA 2FPSA 1Y3DE 4PNEA 2X8JA 3OKAA 4ZVSA 3PC8C 2C77A 5CBPA 5JYBA 4BIMA 2IXTA 3QA9A 4L8WB 2AJDA 4J0GA 1A7AA 3WNDA 2F3TA 4PINA 1IIRA 2ZIFA 4WOBA 3ZLJA 3OF3A 4QWWA 1JIVA 3W5JA 2GNAA 2KB0A 2CXPA 2GT1A 3KT6A 4P93A 2II6A 4CKCA 1I4WA 3BXHA 1RQNA 3K8YA 4O4HB 4UTPA 4IIDA 4CQMA 1SB9A 4UU8A 2VK8A 2DHCA 5HQ3B 4HVLA 3SHOA 5JV5A 1EDZA 2E4XA 1QPBA 4V3BA 1IBSA 3LIIA 2FZGA 1O87A 3BN3A 2Z2KA 1P5ZB 5GZ3A 1DWOA 1PGQA 1RPZA 4G2NA 4MIEA 1RQ2A 1W5SA 5C1DA 1USUA 1V7PC 3DCNA 4NYMR 2Q3CA 3JD0A 1W581 3BAZA 4YWHA 2VI5A 3U7GA 4F12A 2XWQA 1R0CA 2WIKA 2Y2UA 5DNCA 2WFMA 3H7IA 3O84A 3FNRA 4BLTA 2D13A 2A0XA 2XOKD 4XUGB 4JKIA 5C52B 2DWCA 4AQYB 1AZWA 3ESXA 3ORSA 4KE9A 1GARA 3L7IA 4D99A 4XQGA 3PBKA 4EL0A 1WUYA 2P0EA 1A95A 2PSJA 4Q9DA 2XNKA 3ZDXB 4RADA 1U98A 5F1KA 3T1OA 4ECAA 4D4JA 1N2ZA 3TB4A 1F9EA 2GHRA 4ONEA 1WB5A 2A4KA 2DHRA 1KO1A 2WTEA 4OGKA 4TKUA 4U0JA 2P0AA 3IQXA 3Q3IA 4Z3OA 1RC1A 3R3JA 3CISA 2F3RA 3EASA 3R5JA 3P0IA 2DP4E 3SBXA 2AR9A 1N57A 4Z86A 3JARA 4B40A 4B3IA 3MUOA 3FPBA 4N0DA 2FY8A 3HL4A 3DKPA 4F91B 5F2NA 1HFKA 2BI7A 1LSJA 3F1KA 5DHFA 1SKQA 1IM8A 4PO1A 3I9V6 3FYHA 3L7NA 4XR9A 4QUEA 4KVFA 1UAYA 4L57A 3BZWA 4FOPA 4MUGA 1EEHA 4MIOA 4CN8A 4TS1A 2MYUA 3OHPA 4LTNA 4G09A 5K7SA 1ZIDA 3FAZA 3OZTA 3BSWA 1WPGA 5HCUA 1R8QA 2DAPA 1QQ6A 2H29A 3AFHA 1VSQA 2RG1A 3GO4A 3GR6A 5EZQA 2R6FA 2FLVA 3R3UA 4JB8A 2ERYA 2H48A 4D6XA 3KWLA 1MR3F 5COQA 3SM3A 3C1AA 3OT4A 1WUIS 2IZZA 5FNVA 2V7QD 1JR3E 2RH4A 3E8SA 3ZWMA 2FZ4A 1L5OA 2GZHA 3SS7X 3RWBA 3PC4A 2Q28A 4BO1A 4X20B 5J4LA 1U9JA 1WXWA 2UV8A 3GZ4A 2WB4A 3OZ7A 5DM60 3H65A 5AESA 3TTXA 3QUTA 2IZ5A 5EHXA 1OIVA 1FPQA 5AVOA 4J0EA 4W5RA 2GJ8A 1L7DA 3IP3A 4YCAA 4US2R 1ZFNA 3VHRA 1OF1A 3FE2A 3QU2A 3T3EA 5B7GA 5LLDA 1LDMA 3VQTA 2LBPA 5E2IA 2XUFA 3V4SA 2PY6A 2Z9DA 2V6GA 2PL5A 3HCNA 2NO0A 1LBTA 4OHBA 1ZXXA 2CNDA 4Y0NA 4TPKA 3T7EA 1R74A 4TZTA 2O8FB 5FNZA 4P98A 4G67A 4EYEA 4Z4HA 2Q4RA 2VJMB 4ZEMA 3BFKA 1J8MF 1PFUA 5CAEB 3DDNA 2NTYC 4E4TA 3N0VA 2P69A 4LXIA 3WKDA 2OCDA 1FVFA 1XPUA 4F6RA 4FYIA 1YS9A 2EX1A 3FVRA 1X6VA 5IANA 2QAJA 3CUSA 3O4VA 3J81k 2X9QA 4WACA 2BGLA 3TVDA 2ZTLA 2H5EA 1FNCA 1DKOA 1Z9BA 2NU8B 3CLHA 4NCHA 2Q29A 4NCXA 1T3ZA 1AO0A 5COBA 1RKBA 4Q9LA 1GPYA 3L5OA 4F4IA 5K03A 3TW6A 4R16A 4E3ZA 3X1ZA 3RSQA 2YRXA 3WP0A 3X2EA 3A7EA 4RCVA 4BAZA 1KR2A 1TC1A 3WHKA 2YV3A 2R1VA 1W6RA 4RMJA 1KO5A 4J6EA 4CLEA 4RKRA 3QHQA 4YDQA 2GFHA 1RD4A 1JEAA 3RJ9A 2YWGA 5JAPA 1G5QA 5IKPA 1J39A 3RC7A 3LF1A 4Y6GB 1VDZA 5FTMA 4CKEA 2F7SA 5IZCC 2WD7A 1TJ4A 1RXIA 5L9AA 2BGJA 1O0BA 5I7HA 1T8PA 2AWOA 1OFTA 4BVJA 1G6KA 5TB5A 2ZYDA 2NIPA 3ZCSA 2WJYA 1U7OA 3BXOA 3BA6A 2KW5A 4UVDA 5JJLA 1QYWA 2E1PA 4C20A 2N1MA 4LXXA 1E1YA 2DBZA 2W6NA 4NFSA 5TPWB 1SIWA 4TGLA 5JDIA 3NDJA 2D1SA 5AM3A 2Q49A 5JD4A 1YZHA 1P75A 3OZXA 1F8GA 1IPHA 1FK8A 2IELA 2NZ8A 5FFMA 1OFHA 2OHIA 3PFWO 2V45A 1CQJB 1B7GO 4JYMA 4TL9A 4W5JA 4YRQA 1SO8A 4A8JC 5H4GA 1NVVR 1L4YA 5F51A 2FN3A 4HKTA 1PO7A 4E94A 4RV4A 4YUXA 1KZ7B 1USIA 2HRBA 1SC6A 2OHXA 2JG3A 3OEWA 4PGFA 2BF4A 2D2XA 4J3FA 1N2SA 2VTVA 3UN1A 4AQDA 3P2EA 3OJXA 3RAJA 1SG0A 5J4HA 4E4RA 1V16A 2B9EA 3RTCA 1KHHA 1UJBA 3N2YA 4D4GA 3MWEA 4KCGA 1HLFA 2IE0A 1FVXA 2QVGA 2WZDA 3NGLA 4RSGA 3D8RA 2OHJA 2LIPA 4I8IA 3KDSE 3WLKX 4IAOA 4CEJA 1AC5A 2OV8A 3JQDA 4B8ZA 4DMLA 2VS1A 3KJEA 1B76A 2C8JA 4G1MB 4UCXA 4KDRA 1ODCA 2GWHA 3NHUA 4EYSA 1NZFA 4Q66C 3OF2A 4DUPA 2XYGA 1VMEA 3G9QA 2Q5EA 1JGTA 2YXBA 1JFTA 1V2HE 3U9SA 1ZGBA 4GC9A 4CMEC 1BFUA 4B33A 4E70A 4F6LA 2OBBA 3QMVA 1XTUA 3NHAA 3JQ7B 3DEIA 3PFBA 3KYCA 4U7JA 4KX3A 1