1ZVQA

Structure of the q61g mutant of ras in the gdp-bound form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGGEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-Ras-1
publication title Structure of a transient intermediate for GTP hydrolysis by ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zvqA00
1Q0UA 4Q19A 3WYGA 2FFHA 1G3UA 2F9LA 3KX2A 4BEBA 1N6RA 2H16A 3IILA 4G1UC 2D7DA 1J99A 4IRUB 1Q1BA 3ZZ0A 3AF4A 1IJEA 1Q1ZA 3GEHA 3K9NA 1GG2A 2GESA 3P4XA 1NVUQ 1NLZA 1OH7A 1N5JA 4GBMA 3CNLA 3CR8A 2Q3MA 2HV8A 1QBKC 1T6NA 2ZROA 4ARZA 2YOGA 1FNMA 3PUYA 2IS1A 3QKTA 4LBZA 1OFUX 2QTHA 3RS5A 4M9SA 1FUKA 3VU9B 1W7AA 4IVPA 3Q8XB 1LS6A 2DFKB 3MAAC 2YV5A 3LXRA 4D2IA 4Q4AA 4HSEA 1DG3A 4OQLA 4D0GA 4R9UC 1P62B 1XEWY 4E5UA 4M2LA 2RMKA 3I1FA 4PO1A 2FN4A 4Q4HA 3ADDA 4MRVA 2FWRA 3KUCA 1NRJB 4XWKA 2YWGA 3ZVMA 3N70A 1OH8A 2Q6TA 3OEHD 2IYWA 2G88A 3LDAA 5FPKA 3WNBA 2EYUA 3AP3A 5FL7D 1F2TB 4Q4LA 5SZHB 3BORA 4KFUA 5JCPA 1T91A 1ZAKA 5CK5A 2ZITA 4YMSA 4LJAA 2FEMA 4JZKA 5GVRA 5CIWA 2KBFA 2OG2A 3NIBA 4GNKA 1RJ9B 3H86A 3PUVA 2J46A 1DAHA 2EFCB 3R20A 2HXSA 1WP9A 2GRJA 1ZRHA 3RS4A 3O8DA 2JLXA 5B58C 4OQFA 1VECA 1YE8A 4FMCF 2WSMA 4YMVA 3PEVA 4LV8B 3LXXA 3X1XA 2BDTA 2C8VA 3PITA 1CU1A 3RNLA 4YMWA 4HDCA 5FTKA 3UMFA 4DUGD 2NZJA 2HLDA 2IYSA 2I4IA 1NLYA 1S4QA 2ZRPA 2PMDA 1D2NA 3VKHA 4RY2A 3TLXA 1J2JA 4JT4A 4LBWA 2JAQA 3VQTA 2UZIR 2Z43A 1A7JA 1E9FA 1DO0A 3NHAA 1XD2A 3U7HB 1DO2A 1XNJA 1KHTA 421PA 1M34E 4BPBA 2LKCA 4C0SA 2FE4A 1RIFA 1DOAA 1R8SA 2ZRLA 3TIFA 1ZU4A 3C14C 5E7IA 4A0GA 4HAWA 2GAAA 5BWMA 3BWDD 3T06B 4CT5A 1PV4A 1CF4A 1XCPA 3AP1A 4NCJA 1X1RA 3LY5A 4UNPA 3WNCA 4DSTA 4EJSB 3CZQA 3EPJA 1ESMA 2Z4SA 1G8YA 1VIAA 5LD2C 4XD7A 4AG6A 4B3GA 3CIOA 1J8MF 3A4LA 1E9DA 4NONA 1TEVA 2W2XA 4BFUA 4DVGA 2QMEA 4TMTA 4CEIA 3V4RA 5EXPA 4QGAA 4N3NA 2IUTA 3B2EA 3BB3A 2O8DB 5CJ2A 2GBLC 5H1YA 1KZGB 1NMXA 1R4AA 4IDHA 5J4VA 4W5WA 5AJZA 4DJTA 1X8JA 1IM2A 4TSFD 2KSQA 3L82B 2QM8A 4G01B 4RFVA 3RRYA 2VYFA 1CJKC 1KTVA 4EKDA 4DDVA 1JECA 2OAP1 1UBCA 2RB4A 3SN6A 2GA8A 1ODFA 1CRQA 4ZI3A 1OH5A 2ZI3A 1J90A 2ZTSA 2W58A 1NMYA 2JATA 5GADl 1J70A 2NQ2C 4G3XA 1E1RD 1LFDB 2A3RA 3KKQA 3WNDA 2JJ8A 2FPKA 3W3ZB 1P3JA 2QQ0A 2Z4RA 2Z83A 3LVQE 2GKSA 5KNCA 5JEEA 1FQKA 2Q9AA 3OFNA 1E9RA 1TEXA 3THXA 1S8FA 5C2JB 2QBYA 3B85A 1NN0A 1MRSA 2R8RA 4ITRC 3BE4A 3B1XA 3GQBA 1U8ZA 1HV8A 2F3RA 4XWAA 4WBSA 2QQEA 2WKQA 2RGNC 3PEWA 3D31A 5BN4A 4QJ4A 1TPZA 3I61A 3W6OA 4XH9B 3TNFA 4TMVA 3U7GA 1E9BA 3REGA 1ZU5A 1GZSA 2ZE6A 1KNXA 2W6IA 3CZPA 2W0SA 3QXHA 3B13B 1XMIA 5IK2D 1N25A 5CIQA 3BD9A 1I4TD 1EFRA 3DO6A 1QRAA 1Y63A 2J9RA 4Q18A 2R6CA 4DWJA 2ZYUX 1JEEA 2BEKA 3T1OA 1OKKD 3K70D 5AUQA 3ZQ6A 1NMZA 4MKIA 4LGMA 2ZSBA 4QOSA 3ZIAA 5F2EA 3LX5A 3CB4A 3QKUA 2WWGA 4RCZA 4DCTA 5DGXA 1GP2A 2QAJA 2IL1A 2VH5R 5DYIA 2IYZA 4BECA 1Z08A 2P5TB 4Q1FA 1DPFA 1IN7A 2GJAA 2VO1A 3KJHA 1EK0A 4BFVA 5IHPA 1NSTA 3K8YA 4B71A 2J0UB 2F1IA 4IXMA 5E95A 1QHHB 4M22A 3HJNA 1XB2A 2WIAA 3GFPA 3ZGXA 5A0FA 4FD2A 3IGFA 1CBUA 1Z07A 2JDIA 1NG1A 1Z2CA 2ZUBA 1PVOA 4B3DA 3CWZA 3PG5A 4NYJQ 3DKVA 1R8QA 3CH5A 3UXMA 1ZIOA 2IF0A 1II8B 1XFAA 1YRBA 2F6RA 3VFDA 4A8JA 4DT1B 3FHOA 1KO4A 3LW8A 2XX3A 1CTQA 4HYYA 4CIDA 4QBHA 2FPLA 4C9BA 2QM7A 4LJ6A 4QM7A 3T5GA 3LO5A 2WWHA 4YMTA 2GHIA 4HZUB 2CDNA 3K70B 2ZEJA 4P3YA 2XNDD 3UG6A 4BFYA 1E32A 3OHMA 2OAQ1 5KO2A 2IUSA 2CNWD 2FV8A 3LH5A 5AJYA 2Y8EA 1XPUA 3Q85A 4ZKEA 4A2WA 2VIIA 2CE2X 4KLNA 3OEHA 1KIMA 3AKYA 1XMJA 2QMHA 2ZE8A 4PC1A 3AH8A 3GFOA 2C5LA 3M1IA 1Q57A 2B7CA 4RFSA 3BIFA 2IXFA 4D0LB 3UWOA 4GZLA 2GVZC 2GEVA 1OXUA 3K9HA 1IY0A 3JVUA 4Q9LA 4LYAA 4XTCS 2CHGA 1RYHA 3CH4B 3ZVNA 2UKDA 3P1JA 3SBDA 1JNYA 1KDTA 5E4FA 2B6HA 4A0RA 1FTNA 1E2MA 1TF5A 4HDQB 2DFLA 1CP2A 3D7MA 2AFIE 2H8KA 3LBIA 4GP7A 4LSGA 5CYOA 5E7JA 1Q22A 4WXPA 4ZIRA 1JR3A 3W8NA 2ONKA 3GEEA 3BFXA 1NVWQ 4L8GA 4Q1BA 1BOFA 3EPKA 3GLGB 1MO3A 1KI8A 3GJ0A 4R7ZA 4C0HA 2C9YA 2XSZA 4YC7A 2J7KA 4FI3C 1NP6A 1W0KA 2ZR0A 3LFUA 4TT3D 2XXAB 5JHGB 4LBYA 5K8UA 3THWA 2FOLA 3RANA 3BB4A 3K53A 5IT5A 1IQPA 1UKYA 4JS0A 4NMMA 1XX6A 1UFQA 4HUQB 1OH6A 3IDQA 4D26A 1E0KA 4C0LA 3S1AB 1LF5A 2V8OA 4M1YA 4AURA 1A1VA 3OIVA 2OCAA 3G5UA 2A9KA 3NBXX 4O0MA 2ASEA 3RHFA 4PC3A 2X19A 5EZ5A 5JECA 3E5HA 4E03A 5C4GB 2IUUA 5KDLA 1ZNXA 1PLKA 3N2IA 2NTYC 3AUXA 1AZTA 1G21E 2D2FA 2HUPA 2PJRA 1GKYA 3SR0A 3EX7C 1T3LA 2HCBA 3C16C 2GILA 2YJTD 3SE0A 2O8FA 1NJGA 2H18A 3ZZTA 2NO6A 1XXHA 1QHGA 4Q5IA 4OI1A 2WIBA 2XZLA 3X1YA 5EP2A 2PX3A 1DADA 3AUYA 3R8FA 1XF9A 3RSOA 2IYXA 1W4RA 4L5BA 5JRZA 1KMHB 1T0HB 2ZRFA 4JMPA 1BH2A 2VRWA 3QKSA 1UKEA 4K46A 3BH6A 4KYUA 2XZPA 4HAVA 1A82A 6Q21A 2GJSA 4CEHA 2HDNB 3O47A 3AVOA 1O3YA 1E1QD 2ANCA 4IFEA 5FR2A 1CKEA 2E1RA 3U3KA 4ACBA 3U6BA 1OLOA 3B9QA 4TL8A 5HCNA 1P7CA 3KQNA 1FW6A 1T9HA 3TSOA 3SU8A 4DIDA 4YDHB 1D2EA 3EZ7A 4KCGA 2JLWA 2QENA 1KDOA 2YHSA 4EIWA 1L2TA 1N6LA 2QAGC 2ZE7A 1NSFA 4OK3A 1EG7A 2FH5B 2F1HA 4URUR 4JL5A 1ZUNB 1COWA 4PZYA 4V0LA 4JKIA 1GRQA 4YQFA 2VP5A 2C98A 1N0VC 2ZSFA 2CLCX 3P27A 3QPWA 2QP4A 5FTNA 5L3QA 3GLHE 2A5DA 4URVR 3RWOA 3FVQA 3HYTA 4A15A 3R7WB 3EA5A 3W34A 5KNBA 3U2QA 1YR8A 4JSYA 2F3TA 3K0FB 3CPHA 4D81A 3ZDQA 2D62A 5BN3A 4V0OA 3TVTA 4B3XA 4M53A 4HDOB 1VCNA 3CONA 2PZGA 4TQAA 5IK2A 4DCVA 2IYQA 3LX8A 1CXZA 3GJ4A 1T5LA 3NH9A 1AGRA 2EVWX 1OHHD 4UKDA 2CVFA 1YKSA 4NCNA 1JJ7A 3LBNA 3A1VA 3RAPR 1GKIA 4H9GA 1VDZA 2KBEA 2OUKA 4HZUA 1FX0A 1OKKA 4OHXA 3TRFA 2G83A 3A1TA 3UMSA 5EXXA 4V03A 4B75A 5JJLA 1GITA 2JLQA 1KK0A 3NKVA 1JAHA 4TMXA 3R9WA 1E69A 5JWHA 4TLCA 2Z5FA 4HLUC 3W6NA 1UM8A 3CR7A 3D8BA 1R2QA 3PJRA 2KWIA 4GSYA 5FUVA 3AVTA 4NPHA 3MUFA 3KTAB 1KKMA 1JALA 1ZM7A 1OW3B 2R6GA 3RVBA 2ZRBA 1IXZA 2J0SA 4M1TA 4HAUA 3ZQJA 1BMFA 4XSGA 1GL6A 2ZYTX 1P2SA 1U9IC 5SZJA 1P2TA 1ZINA 1YRAA 3RLFA 2EYQA 1LF0A 2QN6A 4CEJA 3QXJA 4LHXA 5G3YA 2G6BA 2ZSAA 4JKYA 2C9OA 1MOZA 1Q44A 4D4JA 4JLMA 4JLJA 1YHNA 1CLUA 1P4SA 1VYTA 3E2IA 4LC0A 3OE7D 3THXB 2GK6A 3UATA 5KYKA 2VA8A 3WMGA 3TE6A 3V00A 3ZD7A 5FL3A 4TYPA 4NYMR 2CK3D 5DN6A 4Q7JB 4IDNA 2GZHA 3QF7A 3ND8A 3I8SA 1G9XA 1SGWA 3OEED 1G3RA 1H8HD 5GJVC 4O25A 3B9PA 2VHCA 3C5HA 2PEZA 4RZXA 3QEJA 4TYNA 3OIWA 1DAIA 5HKKA 1XEFA 2XTNA 3IO3A 3PFIA 2V1UA 3EIQA 1W2HA 2CNWA 3A36A 1HQYE 4Q1DA 2JEOA 4UXIA 2ZJ5A 3PEUA 3PR1A 1TTTA 2QPOA 4JBWA 1V5WA 1S2MA 4HLCA 2GBLA 2OLJA 2DHRA 2RGCA 1OYYA 3AVWA 3I62A 3QG1A 3QG5A 4FCVA 4M9ZA 2P67A 4RKEA 1KSFX 4RD1A 3CPJB 1Z3IX 1AKYA 4RJLA 5KOYA 2V6JA 2IEZA 4PPFA 2FA9A 3FKSD 3PVSA 4NU0A 4PO8A 1RPZA 1S96A 4DIEA 1G16A 1M7GA 2QZ4A 4DDTA 4HLQB 4UQOA 1Z28A 2IYUA 1AN0A 1VCMA 2DR3A 4L9SA 2AK3A 4I99A 1P60A 4P0TA 4AKEA 1H8ED 4NHOA 2HCJB 2YC4C 5DE3A 4M1KA 4AKIA 2H7VA 1HTWA 1AM4D 5KPJA 3F8TA 3SYKA 3A58B 1KI3A 1AKEA 3EA0A 4B76A 1ZC3A 2A5GA 1J8YF 4DLWA 4JVMA 1NNEA 1E79D 2WJJA 1SULA 2P6RA 1QHNA 1KY3A 3AP2A 2JA1A 2V54A 1KNQA 4JLOA 1NVVQ 1Y3AA 2RGNA 2BBWA 4LBVA 2ERXA 1BIFA 4B34A 3NDBB 4KV9A 4EPVA 2UZ3A 1Z5ZA 1GNPA 3B78A 4YLGA 3T5DA 1E2HA 4MKGA 4HEJA 3TVDA 1E4VA 4C0KA 4EJSC 3AVVA 3MWYW 2F43A 4BRUA 3LQQA 5LB2A 2QUZA 2ZREA 1FP7A 1RKBA 3A1SA 1Q1QA 1D8TA 2OSBA 4ZDIA 4QXAA 1II9A 2GCPA 3QE0A 4DLUA 5JJIA 2ZI9A 3MGCA 1S3GA 1PLLA 2WSSA 3BERA 4WVFA 4AYTA 3J81k 3I5XA 4BFWA 5KSZA 3DDCA 2CJWA 2DB3A 2WKRA 1KYIA 5FR1A 3QJYA 4LK2A 1ZM4A 4IEIA 4LJYA 4DCNA 4HUTA 1XDBA 4FCWA 3VR1A 4LYJA 2WWYA 5JJKA 1UKZA 4G0NA 4NZYA 3MCAA 4NCKA 4G5OA 3T1QA 2CHQA 4EPRA 1S1MA 3QENA 4PC7A 2OO7A 3EC1A 4PC2A 3K0AB 1ZVQA 2IYLD 3REFA 3MWKA 4KSBA 5JBQA 4P4SB 4G5GA 3HP1A 2BCGY 1CJTC 2CL6X 1P75A 1IY2A 1UADA 2DYKA 1M7BA 1RVDA 3BOSA 4YDSA 2BIFA 4JIMA 5EUMA 1FNNA 5CYPA 1ZNYA 5EZ6B 4YMUA 1RRPA 4Y0AA 1GTVA 5LB4A 2FSHA 3E1SA 4LHZA 5KTYA 5B30A 2CL7X 2ZSDA 3GEIA 3RS2A 2NIPA 2X1VA 1NJFA 2XOKA 3LQRA 5BW8A 2KJQA 1IY1A 2WOOA 3QI2A 2ZU0C 1NN1A 3L0IB 2HT1A 4F92B 1ZD1A 3CX6A 2P3SA 3IO5A 4NTZA 1ETUA 2GXSA 2LWIA 1GRNA 1Z2AA 4Q9KA 3T12A 4X8MA 4DSUA 2H17A 1IHUA 4LC1A 4LV5B 2RHMA 1MO4A 4WZAE 3SJZA 5CDFE 1VHTA 4D6PA 3THYA 4R98A 4A0FA 3UMRA 2H57A 2O5VA 4ZO4A 2AL7A 2N42A 1R0XA 5G41A 1QF9A 1G4UR 2VP6A 1NY5A 3X1DA 4B43A 4PR0A 4J0QA 1XJQA 2B8TA 2QT1A 1VG9B 3LA6A 4F4JA 2X2EA 3BH7A 1SKYE 1TU3A 2AWOA 4B3BA 1E96A 2QMUA 3KZ1E 1XCMA 3H4MA 1OIXA 4Z51A 4TMZA 2WAXA 3AF3A 2VHQA 4LWZA 2ZU6A 4E22A 1Z83A 5EE0A 3PCRB 4BE7B 4C7OB 5GJCA 1N6KA 4BUJA 4ZCMA 2ZJYA 2BKEA 4TYWA 3QY0A 4RZ2A 5FI0B 1I4LD 5SZKB 1OXSC 4I1VA 4KXFB 2CBZA 3L8YA 3JZAA 4DEYA 1UKVY 3GP8A 1E2LA 1LNZA 2ZAOA 1S0UA 2FX3A 3AF1A 4XWOA 3WMFA 3AKDA 3C15C 2V9PA 3U44B 1VG1A 1IOZA 3QF4A 4Q21A 1Q12A 4EPWA 1KDRA 2A7QA 2E9SA 1RRCA 1G8GA 1OJLA 2PT7A 4UJ3A 1XJ0A 3L0SA 2WICA 3LV8A 3EPLA 3A6PC 5L3SA 3K70C 1UJ2A 4GOKA 3OEEA 3BK7A 4N1AA 4PQRA 4PZLA 2QROA 5DI3A 3AVYA 4B2PA 3R9IA 3DOEA 4YXWD 3ZD6A 2RGGA 3BJIC 3GLHA 2GEDA 1A2BA 4P4TA 5K8IA 1EFUA 1GDDA 3BS4A 5CM9C 1G8FA 4A4DA 1X86B 4I1SA 3B60A 3SS8A 4V0ME 1DELA 2C96A 5TDHA 3O8RA 1MABB 3M6AA 3B5JA 2ZYWX 2BBSA 2FFAA 4KFRA 3AKEA 1R0WA 1BS1A 3HR8A 2W6JD 4IJMA 1U90A 5KDDA 1R5BA 2ZE5A 1JBKA 1C1YA 2OZEA 3K9GA 1HA3A 3EG5A 4Z1MD 2G77B 1R5NA 4C0AC 2BMJA 4PANA 3SC3A 1CR0A 3A4NA 4US1R 3TMKA 3GFTA 5FTLA 2QAGA 1QDEA 2O52A 4JVLA 2PEYA 4QGGA 4HI0E 2IHBA 2AD1A 1CJUC 4BFTA 4HZIA 1NBME 1DTSA 1L4YA 1NI3A 2QRZA 4IFBA 2QSYA 2ZR9A 3B6EA 4IVRA 2HJGA 2JGNA 1B23P 5KUTA 1E79A 1WMSA 5EE3A 1HURA 2FPMA 4U02A 1LW7A 4MRSA 3SHFA 3K0AA 5H8WA 2ZS7A 1HH4A 1Z47A 2WMNB 2OBLA 4QNRA 1CIPA 2ZJ8A 5FTMA 5IRCD 2ZI6A 3VKGA 1KAGA 4LDJA 5DIFA 2C03A 5FOXA 3KDSE 2DPXA 3DPUA 4IDOA 2I1VB 2VSOA 1FMLA 2O8EB 4AKGA 4NCIA 4M9XA 2G9NA 4C0JA 1T8UA 2GXQA 4MA4A 4QBIA 2O0HA 2WJGA 1XD9A 4IDPA 3DKPA 4BLSA 1DG1G 1OIVA 1XEWX 2EQBA 4IW3B 4JLAA 2QE7A 4LV6A 4Q9IA 5CK4A 3GLFE 1W48A 2VPPA 1XEXB 2P65A 3GLGE 4TMWA 2FZ4A 4PQFA 4XSHA 2C77A 2H5EA 4N0DA 2F1JA 1SKYB 1ZNZA 2CEAA 3U3RA 4HLUA 4MRPA 3WRYC 4D4LA 3T34A 1AQUA 4CVNA 4UNQA 4IOLA 1W36D 1VYVA 2R6AA 1W5TA 2V55B 2ZANA 1FUUA 4GT1A 1GL7A 3QVUA 4HAYA 4CRWB 4BFZA 2VQSA 2YINC 4M9QA 4BZXA 4JBYA 1NIJA 1VTKA 1XMSA 4E09A 2VLIA 3K09C 5JWOA 3SI7A 1IN8A 1U9IA 3KJGA 2F7SA 2XNSA 2O8BB 3B1YA 2ZVQX 5HTKA 2D06A 3TQCA 1SVLA 1P72A 2IXEA 4LOAA 2JLUA 3U60B 1I2MA 3FDIA 1AIPA 1JAIA 3Q7PA 1W4CA 3VU9A 1Q1EA 4LI0A 2GJKA 4ASUD 1KGDA 2ZRHA 3IQXA 2ATVA 2ZRIA 2N46A 1D2MA 2E87A 1NBMD 2C95A 3I3SR 1PJRA 3D3QA 2VF8A 4XOIA 2FDCA 2GXUA 3PUWA 1E9CA 4GPTA 4JVSB 2FGJA 1KI9A 1AZSC 1RW4A 1N0WA 4BZPA 1CULC 2NO9A 2QPTA 4R71A 2BM1A 4Z54A 4URWR 2O0KA 4PSVA 4WZ6A 1F2TA 2WWFA 4GP6A 2CCJA 3SJBA 3U44A 3IIMA 4PAMA 2BMFA 521PA 4FXPA 5FPHA 3KXLA 5KHOC 1W36B 1ELOA 3O8BA 4GFDA 3KQUA 4MDEA 3PUZA 1MKYA 3VR2A 2OESA 1RJ9A 1ZC4A 1KJZA 5L3VA 4OQXA 3VMFA 5EXSA 2D74A 1P9NA 1GOTA 1SQ5A 3DM5A 3BFVA 3ND9A 1P2UA 2QTFA 1E0SA 2WBLC 4LUCA 1G5PA 1GWNA 1DAMA 3NG1A 4LPSA 1SXJE 3NBZC 2AKAB 1D9XA 2WHXA 3W3AA 4AYXA 5BYKA 1ZCAA 1FQJA 3AVQA 4IOMA 3KKNA 2JJ1D 4C2UA 4ZCIA 1GIAA 4MQBA 2V7QD 1LS1A 4DB4A 1Z0JA 2X77A 1U0JA 4PPNA 2QY9A 1AJEA 5IDVA 4A9AA 4MKHA 4ESHA 1K5DA 2QNRA 2RGDA 3DZDA 1EFTA 4B3FX 2ZJZA 3DOFA 3CF6R 1N6PA 1DEKA 2VBCA 4W5JA 2MMCA 4I1OA 1E9EA 3GD7A 5FL7A 4JL6A 1NIPA 4L9WA 4W7SA 4EQ6B 2BJWA 1X8KA 3AF0A 5KNDA 4IDQA 5HCIA 4KBFA 3OIUA 1NVXQ 1RRFA 3TAUA 1U2RA 3RRMA 4EJSA 3GPLA 2OT3B 4FMDB 2ZYVX 1KI7A 3HDTA 5K8LA 2X8AA 1BO6A 1ZD9A 3ECCA 4B48A 1W47A 4MYUA 4BLPA 2ZI4A 3ONWA 4JLPA 4DLSA 3F5FA 1X1SA 3LAWA 3OZXA 3QBVA 4A36A 3RRZA 1Z06A 3O8CA 3H0KA 1MH1A 4HB2A 2Z0MA 3GLFB 3UWKA 5JZVA 2O8DA 4MGIR 3RABA 621PA 4IKEA 2IT1A 3DMNA 1F6BA 5FOSA 4DUGA 3AM1A 4IHQA 1QVRA 3EWSA 5FPYA 2LCFA 3G0HA 2HT6A 4RVCA 5BQ5A 4TLDA 3TGPA 2FSGA 2AXPA 1NKTA 2REOA 3IKJA 3L0PA 4PXAA 4C30A 3WYFA 4ACAA 4DDWA 3U5ZB 4CF7A 4X8OA 4K81B 4OJKA 2J87A 3GJ6A 4GOXA 3Q3JB 1OSNA 2GEUA 3EXAA 4CZ2A 3NVAA 3QPVA 3MJHA 5FBRB 2Q3FA 4PPQA 4MDFA 4TL7A 3RDPA 1ZJ6A 2WWWA 4G5SA 2OXCA 4HB4A 1SXJD 1Z6XA 4UNSA 4QL3A 3T15A 4OKSA 1K6MA 1ZUHA 1L8QA 2AX4A 2P6UA 1NY6A 5K8TA 4UNNA 2BBTA 4HATA 2XTMA 1UBEA 2IXGA 4Q66C 1VIYA 5J4YA 3LVRE 4TL6A 2XZOA 3NEJA 1FL9A 3ADCA 1SHZA 3MWLA 1XU4A 5J4HA 3WP0A 2ATXA 4MYCA 3CKLA 4MKFA 4QG7A 3HU3A 2NO1A 3KL4A 2D2EA 4OBEA 4DLZA 1YR6A 3U3OA 2IS2A 2O8BA 2BVNA 2OFXA 5CM8B 4MITA 2IWHA 4URXR 2ORIA 4F93B 1I4DD 1E2GA 4KU4A 3RS7A 3I32A 2HYIC 1T4GA 3IIKA 3KJEA 4NL4H 1SVIA 4TSFA 1YZQA 2JJ2D 3W9YA 3ICQB 4P31A 5FFMA 1EWRA 3F0TA 1TQ2A 5EUQB 3C41J 3C8UA 5JMTA 1IN4A 1G6HA 1N3BA 4RD0A 3TR0A 4URZR 3I4LA 1OB2A 1N5IA 1E1RA 1U8YA 2NPFA 2C2HA 1SXJB 1E9SA 4M8NE 4RCYA 2IYYA 1A2KC 1JJVA 3AV0B 2J0UA 5F98A 1WQ1R 1NN3A 3IHLA 1QHHA 4V0MA 5E7MA 5CB8A 4AI6A 2CLDX 3TW8B 4DLVA 2NMVA 4D0NA 1Z63A 1TUIA 2DWPA 2ZRDA 1XP8A 3TBKA 3ZS9A 1E2EA 1G7SA 2REBA 4PZZA 4R2IA 3M4YA 1Z0FA 1SVKA 1YZUA 3ADKA 3SYLA 2ODWA 1E6CA 5JI3E 2O8CB 3TQFA 2BBOA 4TLEA 4TLAA 4D25A 1II8A 4S35A 2FF7A 4DT1A 4OK6A 1KK2A 4ZCLA 2VHTA 4G5RA 4ON9A 1MR3F 4TLBA 5ANRB 4EFNA 4RZ3A 1GAJA 3QKRB 2AR7A 2ZRGA 2ERYA 1E99A 3R8CA 1G6OA 2IS4A 2QTVB 2GXAA 1IONA 5F9FA 2PZFA 2EWVA 1KAOA 4XVQA 721PA 2PJZA 4OI0A 1F3OA 3CBQA 2QSZA 1ZW6A 3QVVA 2OXRA 4FMDF 3NC1C 3DL0A 3FTQA 5FBLB 2WVJA 3Q5DA 2TMKA 2DCUA 3HR7A 3WMEA 2RH5A 3QQ5A 4US2R 4GMXA 2G0NA 3H2YA 4TMKA 3A37A 1OYWA 3OF5A 3X1ZA 4QJ5A 4PAOA 3LLMA 4ZDKA 4QBGB 3IIJA 3OAAD 1HY3A 2VEDA 3EC2A 1E98A 3L2OB 3BFKA 1Z8FA 2GNOA 4TZ0A 3THOA 1DARA 5FUXA 5E3HA 2ZETA 3FKQA 2ZJBA 4WIAA 3WHKA 2AKYA 4ILEA 4NCHA 1S9HA 2GCNA 1P61B 4FWIB 3VHLB 5JHHB 2OCPA 3IUYA 3VR3A 3AVXA 3UIEA 2HYDA 3P4YA 4RD6A 3DVLA 3GLGA 4DLXA 5FOWA 5FPTA 2JJ1A 2QGZA 4HB0A 5CB6A 3IPYA 3K9LA 2V7QA 4JBXA 2DFNA 1OFHA 2JIZD 2W00A 2ANBA 3K0CA 3AKCA 3NC0C 4F7WA 2R6FA 1TADA 4JT2A 3U3JA 3UK6A 5A5GA 5B64A 1G5RA 4B35A 1G7RA 1HE8B 1M6NA 2XNDA 3LNCA 2CCKA 4JLKA 5L3RA 1J7KA 5DISB 4QGFA 1G4AE 4KHZA 3A1UA 2ONJA 5BN5A 4HUQA 1KI6B 2EW1A 1QHXA 1QG2A 3PQCA 3WYAA 4BZQA 121PA 3S1AA 2AFHE 1IXRC 2BWJA 4EPYA 3NEYA 5JSZB 2KB0A 2OV2A 3BAFA 1HT2E 4NYIQ 1AGPA 1HE1C 3SFVA 2VP2A 4E07A 1P73A 1W4AA 2IYTA 1U8AA 3BC1A 1IN5A 3EARA 4B2LA 2WOJA 3M0EA 2ZSEA 1D6JA 4ARZB 2G1KA 4DSOA 2FNAA 4B32A 1R0YA 1OXTA 3RRNA 3GJ5A 2WMOB 4KVGA 1VHLA 2HLDD 3CWQA 3ICEA 4D80A 2FG5A 1Z6YA 3QEOA 1JXOA 3RC8A 3C5CA 5AK0A 2PX0A 1LV7A 1KMHA 4UXHA 1G5TA 1A4RA 2RHDA 4Q4HB 3U7FB 4TYYA 1GM5A 3SQWA 1OPXA 2FSIA 1BYUA 1E2IA 3ADBA 2JCSA 2BJVA 1G1MA 3FE2A 4TT3A 2GZAA 3TH5A 1UEJA 2BMEA 4TYQA 5AJXA 1N6NA 1OFTA 1Z6TA 4GL2A 5AJVB 1KJWA 4DEXA 2PL3A 4ZV4A 1KY2A 2R6DA 3AF2A 5FUYA 3K09A 5FOTA 4IOJA 1T0JB 2QP3A 4QGHA 4LYFA 4DC9A 4DCUA 1F60A 4XD7D 1ZNWA 3I72A 1NKSA 2J7PD 3KXKA 4Q48A 3U4QB 4QRHA 2VP9A 1V43A 5LBIA 1QZXA 4M21A 4Q4JB 2IC5A 4AY2A 1M74A 2XB4A 1S9DA 4QJ3A 1KO5A 4WA7A 1CEEA 3DM9B 1IJFA 1WE2A 4IEEA 5J4KA 3MFYA 5SZIA 2QU8A 4RSGA 1YU9A 5JS8A 1WB9A 3B82A 3P32A 1KI4A 2DWOA 3GMTA 3KUDA 2GCOB 5FBVB 2FFBA 3R7WA 2VP0A 1Z22A 1LB1B 1XTSA 3Q7QA 4P33A 4TQUS 1G64A 4NYJR 4EPXA 3K0FA 5AR1A 4EPTA 2O8CA 3ZZUA 2Z6VA 5FH9A 2WKPA 2JASA 1X8LA 1XD2B 3ZVRA 2VHUA 3CRVA 1E2NA 1MO6A 1NLFA 1GUAA 2QI9C 2HF8A 1E1QA 4QC2A 1UEIA 4IXNA 2A5YB 4X8HA 3TUZC 1DAEA 2R44A 4A0HA 3B1WA 4BFSA 2ODBA 3QXCA 3NDPA 1ZYUA 3VR5A 2HF9A 5EE9A 3OFND 4PSAA 2MSCB 3FGNA 4ZDWA 4AG5A 2ZRCA 3KQHA 4TN1A 1G291 1TAGA 2ZRNA 2ORWA 1YJ5A 1YZTA 2F9MA 1C4OA 1R6BX 2OBNA 2C78A 4CT4B 3KTAA 4C2TA 2W2TA 5HPYB 4CEIB 2I1QA 3WBKA 2AD5A 4D4KA 2JLYA 1UAAA 3V4FA 5J40A 4DZZA 1RFLA 3B8HA 4RZUA 2OCYC 5FI1B 4EFMA 3FHTA 2W6ID 2ZS9A 4JJKA 4XJXA 2AK2A 3MMPA 5GJBA 2HXYA 3HU1A 2OFOA 3K0SA 4PHFA 4NP6A 3Q72A 4ZI2A 1F5NA 1EFRD 2W83A 4WAUA 3CNOA 4JLNA 1XPOA 4AYWA 4TZ6A 2D7CA 5BXQC 1SVMA 5EXTA 1T3SA 1D5CA 3WP1B 2NO7A 4TL9A 2XGJA 2OBMA 2XITA 1OFIA 1TNDA 4IOKA 1P5ZB 1W49A 4L15A 1OHHA 4H1UA 1CS4C 1AQYA 3W8RA 1JR3E 2R9VA 1E2DA 1DBSA 2GETA 3LLUA 1OE0A 1U99A 1ZP6A 2WZQA 4OI2A 5AUNB 3ASYA 5KSYA 2YZ2A 1XTQA 4M1SA 5IF9A 2QG6A 1GL9B 2QBYB 3KB1A 4Q9JA 5FUWA 3W5JA 1OIWA 3TR5A 1W0JD 1G20E 3CM0A 1U81A 3EZ6A 2GJ9A 1KI2A 4FN5A 1K5GA 2AN9A 5JSZA 1KO7A 1W36C 1OXVA 3VX3A 1HUQA 1N6HA 1VCOA 2GTPA 3T61A 2IYVA 4MRRA 2JDID 2XJ9A 3OAAA 1AS2A 4XVRA 3GLIE 5P21A 4QBFA 1XZQA 3ZH9B 1ZM9A 1WRBA 1ONBA 1QHSA 1RZ3A 2DBYA 4EAQA 3B7GA 2EFGA 1TF7A 4LX0A 2G1JA 1XTKA 2ZJ2A 1CR2A 1N5LA 3SOPA 1G7TA 3OE7A 4BLRA 2IWRA 5DYGA 4UNRA 4F4CA 3Q5EA 1G8HA 3FYHA 2WJIA 2IA5A 1YR7A 3BGWA 2ZI7A 2ZJOA 3CRQA 4HAXA 2QT0A 4OJQA 5DNYB 2NPIA 1XXHE 2CK3A 1N5KA 1UF9A 4NH0A 2A5FA 2PMKA 3IHWA 5TB5A 2JIZA 1H8HA 1QG4A 2OE2A 2CCGA 1R0ZA 2PH1A 2WWIA 4QHYA 3MD0A 4EFLA 1HT1E 2RGEA 4Q7MB 3BBPA 4QHTA 1XD8A 1IN6A 3KXIA 1E94E 4AIIA 4ZPXA 2BCJQ 1GNQA 1VKJA 2G0TA 4Q01A 1CJMA 2B8WA 1Z6GA 2OCBA 3SNHA 3UG7A 1WDTA 2F55A 1M1YE 1XTRA 1US8B 2FJUA 2ODNA 2ZI5A 3IBGA 3OESA 4C0BA 5LPNA 3U4QA 1OB5A 1E2FA 3UKDA 3A1WA 3FHCB 5CITA 4Q4JA 2J0VA 4JLVA 5AJWA 1P9RA 4QM6A 1G3MA 1SHKA 3GJ8A 3SJAA 1KDPA 3FKSA 3SBEA 4AD8A 1YZLA 4A8JB 1JR3D 4LHWA 2VTKA 3E70C 4JL8A 2GCOA 4LY6A 4Q1AA 3SFZA 1CRPA 3TKLA 1EXMA 2XSZD 1KMQA 2EFDB 2C99A 2JLRA 1H65A 1VCIA 2WV9A 1H8EA 1W0KD 5C46F 2FSFA 2Q9BA 4JLBA 2W2VA 1RC8A 2J59A 4M0LA 4H1VA 2PBRA 2QMOA 3K0CC 3V9PA 4RD4A 3HPRA 3IEUA 1ZD8A 2ZJAA 2WAYA 2JLZA 1UBFA 2RKOA 1D9ZA 3KFVA 1F2UB 3ZVLA 2A2ZA 3KKPA 4V0NA 4LJ9A 2B21A 4WW0A 4LJ5A 4Q03A 2K5UA 4TTPA 2RGBA 2ZRJA 4MGZR 5TV2A 3FPAA 1YVDA 3SDZA 2GVDC 2AXNA 4B3CA 4P4SA 2Q0HA 2ZM5A 1XMVA 1XBTA 4Q7LA 1G7CA 5LDDC 1GSIA 4ZKDA 4RFSB 2QPAA 1TL7C 3NBYC 1E2KA 2DFTA 2DY1A 4BRWA 2CHVA 2J7PA 4HAZA 1OV4A 1SKQA 3CW2A 1T5IA 1GRRA 3U61B 1HQCA 4DLTA 3VNVA 2FGKA 5D3MB 3FMFA 1XZPA 2QORA 4GMDA 3AB3A 4PQYA 2JLSA 4ZIRB 1WBDA 3MG9A 1KOFA 3CRMA 4WZBE 2YNMA 3TUJC 1FP6A 2DWQA 3N2EA 2GF9A 2NZ8A 5GVSA 3T1VA 2BMDA 4PO9A 3ZJYA 4NYMQ 4ERNA 1MRNA 2IS6A 3THWB 3AVUA 3OIYA 2YYZA 4I81A 4PPGA 2OILA 4WOPA 1O87A 2OLKA 1W44A 2EU8A 3WXMA 3B1VA 1T3HA 1DAGA 2P2LA 4CDGA 3DMDA 3U7EB 3GLIB 1CJVC 3MRSA 4A1FA 4DBLC 1PLJA 2GF0A 1JPNA 4KBGA 5HZKA 1COWD 4GZMA 5TVKA 1SXJC 3QBTA 1W1WA 2P5SA 2EFHB 1AK2A 4TQ9A 1JQLB 4OHZA 2REXB 1M2OB 3RWMB 3EWAA 1KK1A 4NYIR 4B44A 1Q3TA 2H92A 2O8FB 4OHWA 3BRWD 1ZUIA 4C7OA 1XXHB 4LJ4A 1R10A 2XEXA 5H70A 3EZFA 4P4UA 2GDJA 1R5OA 4RD2A 1JEDA 3GJXC 5FOUA 4L16A 3T1TA 2VSFA 5JI2E 1EX7A 4TTQA 2I3BA 1WXQA 1Q20A 3QKSB 1EWQA 5D3QA 2H1LA 4LHVA 4MYTA 2NOAA 1W5SA 4KI0A 4CEHB 2ODEA 2OHFA 4LZZA 1E0AA 2RAPA 1TMKA 5M04A 3CX7A 1S3SA 4QFMA 2XXAA 4LYHA 4A82A 5CJPA 4ZDJA 1RYFA 2MSDB 3TJZA 5JS7A 5FOVA 3FOZA 1JR6A 1N6IA 4US0R 2CVHA 1SZPA 2IEYA 3JVVA 1NVVR 5J5CA 2XJ4A 4A2QA 2Q21A 2ZPTX 3NHBA 1TQ6A 2NG1A 3ASZA 3Q9LA 1II0A 1U98A 5EE1A 3PENA 2L0XA 2B7BA 1DE0A 2VHJA 1W0JA 2C9CA 5F9HA 4DCSA 4NE2A 1GVNB 1BMFD 1RE0A 1XPRA 3FMPB 5L3QB 1MABA 2YVUA 5TARA 1US8A 3I8XA 5H68A 3EIHA 1P9WA 1U0LA 4DB2A 4KODA 3FMIA 4KSCA 4GI7A 1K8RA 4MUBA 1AS0A 2D4HA 1OF1A 4KJZA 3WHLA 4PHTA 2BV3A 4AC9A 2D3WA 3FFBA 1G19A 2VF7A 3HWSA 1ZIPA 2BC9A 4LHYA 5AUPB 1GNRA 2FMXA 5DN6D 4KFTA 5HZHA 3PUXA 4XTRA 1KSJA 1KZ7B 3TW4A 2PCJA 1WA5A 1Z6AA 2GWHA 1DAFA 3L43A 1XWIA 3EAQA 3DEFA 4GOJA 2G3YA 1FX0B 4B73A 5HKKD 4BLQA 4GRAA 1VG8A 4Q7KA 3WY9A 1JI0A 1Z0DA 2X2FA 1G41A 2BHRA 1F2UA 2RCNA 4PSKA 1E3MA 3FFAA 1XCGB 1HEIA 4B33A 2GK7A 2IYRA 2VP4A 5F3WB 2A30A 4II7A 4YXWA 3QPUA 1TF2A 3ZYCA 8OHMA 4M1OA 4CW7A 4C4PA 4KITB 4F38A 1YR9A 3KQKA 2GJ8A 1EGAA 2IBMA 1JXMA 3A4MA 2IHYA 3MJRA 4B74A 5KU1A 3FWYA 4D82A 2EFEB 2ZR7A 3LRPA 5JFGA 3AVPA 4CEJB 1FPMA 1QHIA 4BASA 3SYNA 2O8EA 4Q1CA 2BKUA 2W6JA 2JLVA 4BQSA 4HB3A 4PFSA 5D3MA 2KI5A 5JWRA 5DLQC 3DZ8A 5CDFA 3WBJA 4MGKR 5KSPA 1FFHA 4B6FA 4DSNA 5EQTA 4C3ZA 4GDFA 3TSZA 3BXZA 5FBQB 1Z0KA 2WJHA 3VHXA 1LTQA 4Z1MA 1EFCA 3VNUA 3C4JA 1XEXA 4KVAA 1N0UA 2J41A 3W6PA 4KYIB 3CRRA 3IBYA 5L8VA 2NGRA 3LBHA 5LD2B 1DS6A 2CMKA 4DHEA 3VKWA 2R65A 4MUAA 4EDHA 3CLVA 2AWNA 2YC2C 1L4UA 1C9KA 4KLZA 2AHOA 2QA5A 1T8TA 3K1JA 3N5CA 3ZS8A 4LJ7A 2HJVA 3SEAA 3QXXA 4KAXA 2B92A 4M1WA 3GLIA 3C7KA 3H84A 3FMOB 4BFXA 1G17A 3W90A 1N6OA 4CGZA 3W5IA 4U00A 1NF3A 5FPSA 4AWXA 4U7DA 1AA9A 4DLYA 2WJYA 3QNUA 3PXGA 1E0JA 5DHFA 5JCZA 2J3EA 2PZEA 1FZQA 5G40A 1KSGA 3B1ZA 1IAQA 2BEJA 5CLLA 3EPHA 3I5YA 1GFIA 2BM0A 5AUOB 5J4LA 2WSSD 4O2RA 5DI9A 1FOEB 2V6IA 2YKGA 4RD3A 4LCBA 3GJ3A 4QKQA 1JQJC 1SVWA 4U5XA 5J47A 2ZS8A 4LPKA 2WPDD 3FB4A 3EZ9A 1ZM3A 1PUJA 5UKDA 5FBWB 1G3QA 1TQDA 5AWFC 4DXAA 3U3MA 4OL0A 2IF2A 3CPEA 2OM2A 4Q9HA 2NO0A 4QHSA 4N0EA 3EASA 5FTJA 3RS3A 1W46A 3QIAA 4DRZA 4O3MA 4R2HA 1YQTA 4AKHA 4F91B 3X1WA 2XB2A 4MGYR 3NXSA 3TK1A 4W5HA 1G8PA 3GCGA 2PCLA 3RC3A 1X6VA 2F43B 5HE8A 2RGAA 3IPXA 3KKMA 1CR1A 4BWYA 4ESVA 2HEIA 4BLOA 5EP1A 1YZNA 2XOKD 1PZNA 4NBSA 2VL7A 4FCTA 4ASUA 1TUEA 1AS3A 4JJZA 1YZKA 2YWFA 4G5QA 1JPJA 4JVNA 1TQ4A 1NBMA 2CJWB 1DAKA 1OXXK 2QP9X 4M4SA 1M7HA 1EX6A 1UBGA 5TMPA 2ZIAA 4OQMA 3SQXA 1E2JA 1MT0A 3U6KA 2YWHA 3VTKA 2Q9CA 2RGXA 4K8OA 4WXRA 4EQ6A 3AGPA 2CE7A 221PA 4UXJA 4OYHA 4Z8YA 2IW3A 1Q3HA 5DHAA 1U94A 3HYRA 1X3SA 3KKOA 4URYR 821PA 2CXXA 1S1CA 4O2LA 5KSOA 4BLTA 4KO8A 5G53C 3MWJA 2QEQA 1Q21A 4PTLA 1SVSA 1FMJA 2IK8A 5DSZA 4XIGS 3GLFA 1L7VC 2PT5A 2YOHA 3BH0A 1E9AA 4RKFA 2V1XA 4P32A 4OI4A 2EWWA 5TY0A 3RSLA 4B2IA 4QNMA 2C04A 3IEVA 1W4BA 5G3ZA 5C4MA 2A78A 5DO9A 3ZLJA 1FTSA 3KQLA 4L4UA 1LY1A 3A8TA 1SVOA 3KB2A 2ORVA 4MH0R 3QXSA 2YWEA 3SHWA 4MRNA 3KJIA 3CNNA 4NKRA 2KE5A 4DLRA 2V3CC 2GZDA 4TTRA 3NH6A 1KJYA 5A4JA 3CF2A 3THYB 2P6NA 2PLRA 2LKDA 3JZMA 5C1BA 1ZM2A 2FZLA 2ZAMA 4FWTA 2J1LA 5KDOA 1E4YA 4POAA 4XVUA 4A6PA 4C0QC 4X8LA 4CYMA 4NDZA 1N2CE 1Z29A 5HE9A 1ZMXA 3G82C 2ZUDA 5BYJA 4A2PA 1KSHA 3PEYA 4A6XA 3AEZA 2MSEB 2XTZA 4HLDA 3VAAA 1WBBA 4Q4AB 4M1MA 5CLQA 4DKXA 1UDXA 4JYBA 4V02A 4JLDA 4B47A 2F1RA 2ECKA 1NG9A 1Z0AA 1GILA 2A5JA 2WM9B 1GKUB 2WWXA 3QOFA 1ZBDA 5EE5B 3VX4A 1XTIA 5HR5A 3KFXA 3CUEF 3VR6A 2P0EA 3AGQA 4A92A 1ZCBA 1MO5A 5ELXA 1UDWA 2R62A 2R2AA 4A8JC 1G3IA 1EFHA 2ZQ5A 2J0QA 3QF4B 5GJWC 4YONB 2XAUA 5C18A 2FEOA 2MMGA 3VR4A 1WCV1 2YOFA 3X2SA 4Z8XA 1EESA 3CX8A 4LJ8A 5L3SB 3R9XA 1SXJA 2ZRAA 2O0JA 3UPUA 1VPLA 2QL6A 4I1UA 3EW9A 4Y0VA 1KK3A 3HU2A 3LWNA 5DH9A 5EP4A 4BEJA 5DI3B 4D4MA 4FW9A 1UPTA 1BKDR 1LVGA 1VMAA 3GLHB 3DHWC 4Q02A 3QUSA 1XTJA 3L0OA 5B2ZA 3TSWA 3BB1A 1IBRA 2WTUA 3NBFA 3CO5A 1W2GA 3EIEA 4MYHA 4TWZA 5JEDA 1JB1A 1I2DA 2FU5C 3IQWA 4F4IA 1VYUA 1U0HC 3LD9A 4JYCA 3AQ4A 5JLJA 4I4LA 4FMCB 1TX4B 3CF0A 1KO1A 3RS0A 5KPDA 3NWJA 2FFQA 3QKRA 1QVAA 2JJ2A 1RRGA 1NL3A 3MLEA 1OT3A 1P6XA 3SJCA 2QE7D 1VG0B 4KFSA 2J5XA 2J45A 2CLSA 3I73A 1XRJA 2OFWA 2W0MA 4OK5A 4ABYA 2Q3HA 1PUIA 3TAHA 3NTUA 4AK9A 2QAGB 4JSTA 3UANA 2ZVPX 1KO8A 2GAOA 2ZUCA 2WPDA 3LW7A 3CRW1 1DVRA 1BYIA 1IXSB 2CL0X 4IVQA 4EUNA 3T35A 2SHKA 4OHVA 1KKLA 5TXGA 3I92A 1TU4A 1E2PA 1WF3A 3P26A 4PC6A 2VSXA 3MSXA 1G18A 1M8PA 2N1BA 4PX9A 2IX3A 3TUIC 1E2QA 3ETLA 4BGDA 3K0EA 3H1TA 5JRJA 4Q1EA 4UJ5A 1R7RA 1ANKA 3GJ7A 2V4ZA 4LRWA 2PLFA 1CR4A 3F3YA 3D6TB 1Z0IA 3PIRA 3L8ZA 4FINA 1P2VA 4PHHA 4B6EA 2ZXUA 3QSYA 5B57C 1B0UA 1XJCA 4W9MC 1ESNA 3EZ2A 2UVQA 3PV0A 2WJVA 4FIDA 4S2EA 3ZIAD 4OQNA 2ZRKA 3RYTC 4Q47A 5EP3A 3P20A 2QRNA 1QHYA 4PAQA 1HYQA 1MV5A 4PHGA 1KI1A 2OEPA 4Q00A 4OHYA 4V0KA 1A5TA 4FMBB 2ZRMA 1F48A 3WRXC 4DDUA 1YZGA 3HPQA 1NN5A 1KI6A 5EJEA 3SZRA 2BOVA 2QGNA
chains in the Genus database with same CATH superfamily
2L19A 1Q0UA 2JFNA 2L18A 2QY6A 2PGLA 4M38A 3WYGA 2GFHA 1G3UA 2F9LA 2QXTA 4B4UA 3IILA 3LGAA 4H7IA 4KIJA 1NBEA 1YDWA 1J99A 2CUZA 4MIOA 5J5VA 1XKXA 1HDIA 4GVLA 2VNHA 3ZZ0A 1PGQA 4KXUA 1IJEA 1Q1ZA 2X40A 3GEHA 5AKYA 1EX1A 2QVLA 5CCEA 2C0QA 2EAUA 1N2EA 3P4XA 4J4HA 1CJCA 1U3GA 1N5JA 2WC1A 3KYJB 3QV2A 4Q3OA 1MB3A 2ZYDA 4Y6PA 3ISTA 4ZPJA 5CDHA 1KFJB 4LXTA 2P30A 1MQAA 2Q3MA 4QVIA 3W3AD 1T6NA 4QOJA 4QELA 2ZROA 3OKPA 3OU2A 4BXOA 1WG8A 3WLRA 5DRTA 4K9OA 1JMYA 3VU9B 4IVPA 3ROXA 3HG7A 4RWEA 1N0IA 3M1LA 2EKQA 3P7MA 3VKFA 2GA9A 3S68A 5IBPA 4OATA 1DG3A 4ZQHA 4D0GA 2YXLA 4KDFA 3ZCPA 2ICAA 1CY1A 2GQ0A 2JHAA 1TRHA 2FN4A 5CW1A 3U39A 1H1TA 4U4AA 2M1ZA 1CSEE 1PX0A 1UBLS 1KBQA 1F0PA 4MRVA 4BMSA 4HTFB 3KUCA 5A5VA 5E8JA 4OBWA 5A9SA 2CF6A 4DC0A 1AZWA 1USUA 3ZVMA 4ZYVA 3OEHD 4XLLA 4CTMA 3LDAA 2NZYA 5FPKA 2CJXA 2EYUA 4OREX 4YIKA 3K31A 1XTBA 1F2TB 1NP7A 2EJVA 3LHFA 4M98A 3FY4A 4UEKA 4DQUA 4EG3A 3BORA 1T91A 3IJRA 5D6NA 2W6ZA 3M2TA 3SZGA 2NNWB 2H4ZA 2ZITA 3F49S 4HBZA 4OMDA 1LLCA 4NSNA 3WSTA 1TQHA 3KV3O 4PINA 5DLPA 3KSRA 3WGVA 1F6DA 1XN1A 2X4LA 4DILA 3AUTA 2OG2A 1LWOA 3WICA 4DDHA 3AHGA 3H86A 2EQ5A 1DAHA 2BFPA 4QASA 2XUDA 1L3BA 3ANTA 3G6WA 1GFWA 3ET5A 4DABA 1YE8A 4HDNB 4PYKA 4S04A 1KYWA 3PEVA 1FU8A 2F62A 3GT4A 4MS3A 1CQZA 3LXXA 2BDTA 4U2DA 2C8VA 3PITA 4B3MB 1GAXA 4YUVA 3EIWA 3VAZA 9ABPA 2ZOSA 2ZBQA 4J0CA 4FT4A 2NZJA 3GIDA 4F04A 3OQOA 3AB7A 3AFIA 3NT5A 3I45A 2CV0A 5I8PA 2J30A 1J2JA 3A1EA 3D4BA 4YJGA 4JT4A 4LBWA 5DHSA 3RU9A 3VQTA 2UZIR 2XQFA 3TF5A 2YIMA 1YRYE 3H5TA 3NHAA 3ETEA 3OETA 3D6UA 3I53A 1XNJA 3IVXA 5SY6A 1RQNA 3AJ9A 4WZZA 3UUGA 2W48A 2LKCA 3TZKA 1OZHA 1RIFA 3ZCVA 4RL6A 4C0SA 1PS9A 5MN4A 5GIPE 3BT7A 3H9JA 3RT7A 3I1JA 3TIFA 1O58A 2XB9A 4A0GA 2Q41A 2CF5A 1A2OA 3DJYA 3I4CA 4HAWA 4UPDA 2V9CA 1WPQA 4MUJA 4GRIA 1PV4A 2C42A 1DQSA 2X4IA 3RHTA 2B1RA 4IMJB 4J1SA 1XCPA 2M6SA 1N8SA 1TFRA 1BW9B 1NW7A 2QVYX 4G8DA 3PWTA 4LRUA 5C8YF 4J2HA 3MWGA 1CUGA 2HPHA 3H9BA 4KP7A 4DSTA 1ESMA 2Z4SA 3NHYA 4EJSB 3EPJA 4AG6A 1Z4KA 2LIVA 1JJIA 1AV7A 4HBGA 4DG8A 3U7JA 4B3GA 4PRLA 3WIDA 2GFIA 3RJZA 2J6CA 1GJRA 4DVGA 2W2XA 4EZBA 4RHFA 1N3LA 5K0SA 2VWQA 5EXPA 3SAJA 3RROA 1LBIA 4NAUA 2D8MA 3SMQA 4DY6A 2UXDB 2H4HA 3HA7A 2O8DB 1RJEA 3H4VA 4UQLA 3CC8A 3WMWA 2GYYA 2WHPA 1RVV1 5KJFA 1Q0LA 2R68A 3UMBA 1CUDA 1R4AA 4IDHA 5J4VA 3ZCXA 1FEZA 5KCMA 1CQIB 3GK3A 1Z8HA 5JS2A 4ZI7A 5I9MA 5A05A 4G01B 3D02A 3ME5A 1SWVA 1F2DA 3EAGA 3RRYA 4IVNA 5AHOA 2XT6A 3H65A 1JECA 3Q4GA 4DM4A 4JI2B 3ZBPA 1OH5A 3GRCA 4G89A 2ZI3A 1T34A 3LL7A 4AIRA 5FV4A 1M2GA 3HCPA 3U3XA 1X7YA 2NQ2C 2Q4DA 1LFDB 1WDWB 4HWTA 3W3ZB 3LVQE 1XMOB 5CR9A 2BPOA 4M86A 5EYPA 4CG2A 3FVWA 4N6NA 1E9RA 1S8FA 2CVQA 4JOCA 1PJ2A 4ZQFA 3ZXXA 4OLFA 1DKQA 1W4LA 2IYOA 1NN0A 1MRSA 4PGAA 5AM3A 3PGXA 1HV8A 3TO5A 2WFLB 2JLAA 4MZDA 4PAWA 1MD9A 3PEWA 5LYYA 1DOZA 1HZZC 4MP8A 1P74A 5CA0B 5AW0A 4JLWA 1WUJS 1J2EA 4S3MA 4ZAZA 3W6OA 2IX9A 3G17A 3M1YA 4XH9B 1UK6A 4MEAA 2DKOA 3LTEA 5CDTA 2ZWAA 2KPOA 4TMVA 3WRVA 1E9BA 4LNUB 2HA4A 1GZSA 4XW2A 1BQ3A 3E9QA 3HV2A 3NDJA 4BO5A 4MARA 4KACA 5IK2D 3MTJA 1K98A 1BQ4A 2HMAA 1GPAA 3AM4A 3ZDZB 4R8LA 4Q18A 4K88A 5AIBA 4YV0A 5JMOA 3H1GA 4HQFA 2FWAA 2O8VA 1JV2B 3I23A 2BHNA 4L75A 2ZB8A 4W99A 1OKKD 1VJTA 4M49A 4UHKA 3PQ5A 4OXYA 3ZQ6A 1FRNA 2ZSBA 5BNZA 3FUVA 3WL7A 1RWWA 3FXAA 2WWGA 1O94D 3QKUA 4URHA 4BVJA 3F78A 1ZMOA 2YZGA 3K9FC 2QAJA 1QP4A 3IEMA 1Z08A 3CCFA 4M8SA 3AONB 1DPFA 2GJAA 4D8WA 5AESA 3MMSA 3PXAA 3KZOA 3TM5A 5CHEA 4F8EA 4UCQA 3AI7A 1H4QA 1Z36A 1LPMA 4C22A 2J0UB 1NNLA 2F1IA 5KOIA 5T8KC 3LIPA 1FTWA 1SD5A 1PF7E 3PYXA 1DRVA 5BPFA 2HCTA 1N7HA 3GFPA 2H8GA 5DYTA 4M0EA 3T9FA 1P4AA 2PUHA 2YV2A 4FD2A 2EJWA 5F12A 4BQFA 3VYTB 2NZ2A 1HSOA 4QU9A 4PTYA 2Q3BA 2C58A 2X5XA 2JDIA 3MILA 1FLAA 2BGNA 4RGQA 2BCEA 3R3UA 1M34B 4F1JA 1DFHA 4FOLA 1DQRA 3CWZA 1OXBB 3GMIA 3PG5A 3DKVA 4G1BA 1HL7A 1QO0A 4R8SA 4ZP1A 2IYNA 2HU7A 4BNWA 1H1LB 4EFKA 1RJDA 2IF0A 2UYYA 2F6RA 4KG7A 4UMEA 3TLCA 4A8JA 4DT1B 3JQBA 1X42A 5TQ0A 2D6FA 2XB8A 1H2YA 1IIBA 1KZ4A 4OQZA 3ABZA 1QS0B 3LT5A 4WDRA 5KYWA 4CLXA 1MFZA 3NC4A 1E1MA 1CTQA 4TN5A 2P27A 5F7ZA 4E33A 2FPLA 4QM7A 2QM7A 3FYSA 3ZU3A 3NRCA 1W9MA 3I0ZA 3T5GA 2WWHA 4XPZA 4MHOA 2GHIA 3G5TA 3RVOA 1B6TA 1Y1PA 4O5AA 3ZZMA 3QYPA 3CZ5A 4DLAA 3UFBA 2IUSA 2CNWD 3LH5A 4QA9A 1TYDE 1SHJA 3L5KA 4F5ZA 2QTCA 4TWAA 1OA1A 1NJ2A 2BF7A 1DIBA 1FJ2A 3Q85A 5JQWA 4IBOA 2QTGA 1THGA 4G5FA 5I7UA 2VIIA 4NMHA 4B7UA 2P9YA 1MDFA 2CE2X 2IIPA 4KLNA 5EZQA 3HJRA 5B1YA 3MHTA 1M1NB 3AKYA 4JYAB 1M1XB 3TZHA 4J0GA 2ZE8A 4PNHA 3VOBA 2HPAA 5C1OA 5IN5A 1Q57A 1DRUA 3M3PA 3U9SA 1ZCZA 3NYQA 1U2SA 4KR6A 4D0LB 1DKNA 2Q3EA 1E5QA 4K3UA 1OXUA 1IY0A 1WP4A 1ZSVA 4LYAA 4Q9LA 4XTCS 5LZ7A 3DB1A 4O4IA 4YBRA 2CHGA 1I30A 4EAAA 1FRQA 5JE8A 4GZ6A 5CDUA 2GPBA 3TQSA 4ZMSA 1JNYA 2QRJA 3PNQA 4PLFA 1QQ6A 4HDQB 2Z5VA 4MS4A 4DC1A 3D7MA 4GP7A 4LSGA 8ADHA 1FLNA 1KS9A 1Q22A 2FKNA 3RTDA 1KAHA 1LWNA 1H5NA 1I13A 1JR3A 2DLNA 5ALTA 2ONKA 5KX5F 3BFXA 1BOFA 2INGX 5I6DA 2IU4A 1Z5VA 1BSVA 3B7PA 4KN5A 2SNIE 4C0HA 2C9YA 4RA9A 4KEAA 4CCYB 3A6JA 3JQ8A 2ZUTA 3UC5A 3VYSB 3H1BA 3F2IA 1UCFA 2PA3A 5KEIA 4KTTE 1V95A 4LBYA 5K8UA 1T4DA 2ENWA 3ROFA 3BB4A 2XCOA 3ITKA 3K53A 5IT5A 1Z3CA 2H0QA 3EVGA 3IH5A 5BN5B 1Y7HA 4HUQB 5IJWA 2EKZA 1DL5A 4D26A 1NHWA 1OBOA 3S1AB 4CIYA 1DKRA 2GEKA 2OCAA 3X44A 3IYLW 1GTMA 1GUFA 1PFGA 3E5HA 2P1DA 5C4GB 3W2EA 5ALZA 2O6LA 4CIAA 5KDLA 1L8LA 3N2IA 2NTYC 2BFCA 4JBIA 2HUPA 1YS4A 1J06A 5CH5A 3E2PA 3W5HA 2PGXA 1SCIA 2PZMA 2HCBA 4MW5A 2F17A 2YJTD 4XUEA 1X7HA 2J9GA 2I5PO 3TLGB 4CQLB 1A8IA 3MC1A 4EKGA 4F2GA 4E7PA 4TOIA 4Q5IA 4I55F 1HMYA 1P0FA 1J09A 1U0TA 1VKRA 1C1DA 1CW2B 4CUKA 2BFFB 1PVDA 1WPRA 1JQEA 2FSSA 3CG4A 2RFLA 3JD1A 5AMXA 1GZ3A 1T35A 3ZDEA 1SXGA 4KIGA 5EPEA 2X41A 2EZTA 1KMHB 2H54A 1NW5A 1ZXXA 2ZRFA 2VRWA 4HDSB 4HPXB 3FSJX 3QKSA 4NZPA 1UKEA 3SQNA 1Z38A 4N6GA 1JVNA 4EHKA 1MA0A 1W59A 2V9ZA 3QVGA 5K0TA 2HSZA 3AVOA 1O3YA 1E1QD 3DV0A 3E48A 3MRVA 2WF7A 5BUCA 3EQ7A 4MR7B 1NLMA 4RTRA 4TL8A 1KRXA 1SU4A 1QV9A 5EHNA 3TSOA 3O3NB 3SU8A 2OORC 3RODA 4F21A 4YDHB 4NFSA 1D2EA 1F8UA 3L7YA 3VR5D 2E49A 3EZ7A 3H7IA 1HNWB 1JFLA 2ISCA 1XWWA 3PYMA 2X2PA 1UBRS 5DXAA 2OA0A 1OLSB 4FBLA 2C29D 4Z3KA 3N7AA 4E4TA 2Y6UA 5C80A 4GYJA 2ZE7A 2YWCA 3DTYA 3Q9UA 1EG7A 2GS9A 3L4SO 2FH5B 3HDQA 3EC7A 4NICA 4G0QA 4OQYA 5ITVA 5K45A 3RSGA 4EHHA 2GVNA 1AKWA 3RVSA 1GRQA 3UPTA 2NVBA 3ZHUA 1RBQA 3W6ZA 4X6YA 2AVDA 2C98A 4CKYA 1N0VC 2ZIFA 4MLPA 2ZSFA 3R7SA 3QPWA 5BV2P 4B6OA 2FLWA 4IIJF 4MEBA 4UHBA 5L3QA 1CUVA 2RHTA 4TTAA 4PBTA 2PVPA 2HHCA 3HYTA 1PJZA 1V5IA 2DT8A 2Y66A 4IHKA 1YR8A 1OFUA 2AOWA 3EVCA 2BKVA 1IBCA 2PQ2A 4IZHA 4JSYA 3DFIA 2QN8A 3K0FB 4TYMA 3CUVA 5FPQA 4AWAA 3MCZA 1GTL1 4QGBA 5BN3A 3MTEA 4IEFB 4R3NA 1P2BA 4DGQA 3CA8A 2D0PB 4TQAA 1JVBA 2QTTA 5JDIC 3GLSA 3GRAA 1Q1GA 1LDNA 2DOKA 3ND7A 4C5AA 5HZMA 2JG3A 3KV1A 3VPDA 5BQXA 5CA1A 2G09A 3NH9A 1UFOA 1JHAA 4Z4QA 5EIXA 4UKDA 1YKSA 1KDVA 4MP3A 2FVXA 3A1VA 2YICA 4L22A 1FMCA 4RY9A 4HZUA 3LYLA 1FX0A 1D04A 3TRFA 4EF4A 2G83A 3UMSA 2Q62A 5EXXA 4TGLA 3G49A 4C07A 2PYDA 1AURA 3DZFA 2H4JA 1RYBA 3GRPA 4YJKA 2CLOB 4TLCA 4GLJA 3W6NA 1UM8A 3AU9A 2DX7A 3GROA 1N3YA 3KVYA 5FUVA 2WU0A 4K9SA 3MUFA 4WZBA 1YS6A 3WB1A 5JOQA 3H0CA 4PR0A 1GL6A 3HZZA 3QEMB 4WACA 1P2SA 1ZGGA 5SYMA 3E0XA 4ZHQB 3MUEA 4WXEA 2EYQA 3QXJA 4LHXA 3WRWA 1OXKB 2PXXA 4OG2A 4QYWA 2VTBA 1BX1A 1Q44A 4RH3A 2EW2A 4JLMA 1OI3A 1YHNA 3NI2A 1O6FA 4FGZA 4BN0A 4E6PA 1SXQA 3OE7D 3V8VA 3UATA 3WB9A 2R1ZA 2VYNA 2Y71A 1VI2A 1U1IA 1Q91A 1WKVA 3KPJA 3ZD7A 3HWWA 5ENDA 1Y7IA 3P2IA 3OA0A 5BURA 1CDEA 2C88A 3ND8A 4FN4A 5CCXA 2CWDA 2PUDA 3LWDA 2FP4A 3D4NA 5ERYA 5GJVC 4O25A 3WYDA 1KPHA 1TD9A 3O4GA 4KMRA 1MXHA 2VBGA 1QCZA 3HA2A 3PFIA 2I2DA 5A4AA 1PU2A 2V1UA 4CLOA 3DHEA 3RBAA 2JI4A 5E9JA 5L40A 1HDCA 4NPAA 3PR1A 3GGDA 1M6VA 5GONB 1RQGA 1CJSA 9GPBA 5IDQA 1V5WA 4KXWA 5LCXA 3GFRA 4HLCA 4YJHA 1VRWA 4QYIA 4RM3A 2P67A 1Z45A 2C5FA 2CKMA 2EG5A 3IX7A 2BEVB 4PIPA 4R1QA 2PANA 4RD1A 3UM9A 5T6MA 5FXMA 4LF4B 3BWYA 1MORA 4NRDA 3FKSD 4Y1RB 4PO8A 1BS9A 2DP4E 2HMSA 3N6RA 3NAQA 1G16A 1TVKB 2XQIA 3PNKA 4U7PB 5DDIP 2NVUB 3SR4A 3TSCA 1KA9H 2POCA 2XMPA 2NZVG 2H00A 3OIGA 2EEPA 4HZGA 2IYUA 5B2EA 1T43A 3G9QA 5CD1A 3F97A 4QUBA 3CJTA 1H8ED 1WPXA 4NHOA 3T99A 5DTIA 2A9VA 2PE5A 4AKIA 3E61A 3GVCA 4FE3A 5DYNA 3SYKA 2ZJ1A 5KCZA 5JSFA 1MTOA 3PDHA 1JYSA 3EA0A 5CBKA 3JQFA 4DLWA 5EVJA 4JI7B 2C61A 1EA7A 4JVMA 4ZVKA 1MC1A 1E79D 1M8GA 1ZOSA 3LT0A 4OQQA 2P6RA 5H0IA 1XOIA 2AX3A 3NWBA 1HDEA 3AP2A 2JA1A 1JA9A 1PAUA 1QTQA 3DBOB 2RGNA 2XAAA 3M6LA 4CIBA 3LHDA 3A2MA 1P1CA 3C6MA 1DFIA 3FOFC 4GEKA 3Q0TA 3KEMA 3H8VA 1FRVA 4QRDA 1TZBA 3LUDA 2JC3A 1CRLA 1H2HA 1E2HA 2KLBA 4HEJA 4GMFA 4P3PA 1DC8A 5TT1A 2NAPA 4C0KA 2XRMA 1TTHA 3BE5A 4M0CA 2WY2D 4C4TA 2UZAA 4CQMB 3B89A 2XWJI 2BMVA 3G5AA 4IX1A 2BFWA 2QUZA 3PLNA 2ZJ3A 2V8BA 4I50A 5LB2A 1Q1QA 1M5TA 1ZOLA 4X6LA 2CNOA 4KUHA 4ALLA 3GAFA 2ONZA 2F1OA 2ZGVA 4EYGA 4DSZA 4YEDA 5B2FA 5JJIA 2I6FA 3MGCA 1S3GA 4L57A 3RFXA 2YNMD 1LX7A 3BERA 4MW7A 3P2OA 4XFJA 4ZWNA 2GRAA 3T7IA 4CM8A 5MDHA 3J81k 2VUSA 4BFWA 5KSZA 3I5XA 2WB2A 4OQ4A 3HVRA 5FR1A 4G1FA 2FPIA 4LK2A 1ZM4A 3QHPA 3KO8A 4PQGA 4HUTA 1XDBA 4AZ3A 4WTOA 1QLJA 1QIDA 2NSDA 1C3XA 5KINB 4OIFA 3MCAA 3NYIA 4NCKA 3QUTA 4X7RA 2COEA 2CHQA 2VSYA 2FN3A 4PC7A 2P9CA 2ZUWA 3K9CA 5DGCA 2OO7A 1IL0A 4Q05A 1ZVQA 1WNFA 5K3FB 3MWKA 2HOQA 3MT0A 3HP1A 1G8AA 3LT4A 4G5GA 2BCGY 2R47A 3SQDA 1NW9B 2ONYA 2VJQA 3E7PA 3N28A 3NUGA 2DYKA 3BOSA 4WHMA 1RVDA 4BNHA 3KJFA 5EZ6B 3SK0A 5CG1A 3PDIA 1UOOA 3ORRA 4FZVA 4OYRA 1AKRA 4RGVA 5EZYA 5DHPA 4Y0AA 3HFSA 3U0VA 1A9PA 3F4KA 4D6XA 4YROA 1MC8A 3L0DA 3S55A 5JSZB 1N9KA 2V7UA 4M7OA 3KR9A 2DPLA 5JSQA 2O5CA 3STUA 3WVNA 2XOKA 3ZI0A 5DK4A 3LKZA 3LQRA 4BBZA 2MSNA 3G0OA 1A9SA 4BN5A 2KJQA 4KV7A 3VC2A 2OL4A 2QD3A 4I6GA 4PZCA 3D8UA 2C5EA 5DCLA 5JXJA 1PKXA 5B1IA 3U40A 4ENVA 3U3DA 1YI8A 1ZD1A 2HT1A 2P3SA 2I2WA 4H35A 3ZHSA 4EF5A 4EHLA 1FSZA 3EUEA 3T12A 4Q9KA 1EJ6A 4X8MA 4JB0A 1T0IA 1OFVA 2P9GA 1YGPA 4MV5A 1JIKA 4BVHA 3QK7A 1I7SB 5JH7B 1CUJA 2FZGA 5ECDA 4WZAE 3GJYA 3ZHRA 3R6LA 4IKPA 4D6PA 3THYA 4R98A 2IVZA 3A6ZA 1SQ6A 4S05A 3CUKA 2ZT5A 1PQYA 4N3CA 4ZO4A 3L1JA 2VHEA 2AL7A 1E3IA 2F90A 1R0XA 4LSMA 2X5JO 2XKAA 1T5DX 5G41A 2YW9A 4EO9A 1H9CA 4M54A 3X1DA 4EARA 5BR8B 3QMMA 4X9XA 5JS6A 5H59A 2CLLB 4EKIA 5FUQA 1J0XO 2QVXX 3BH7A 3P5SA 5JSKA 3DT6A 4AJNA 3RJMA 4B3BA 1LQ2A 2DHQA 5AKEA 5GWXA 1VGVA 2OBYA 4Z51A 3ED1A 5I8ZA 4LWZA 1W19A 3CEJA 4L2IA 4JLUA 5EE0A 2VUTA 2PZBA 4CETA 2WJWA 2Z2YA 2Q1XA 3P9KA 4LNHA 1JEQB 1M9NA 2BKEA 1QC5A 1CD5A 1I4LD 5E6UB 3ZJTA 2MSKA 1V45E 4KXFB 1SO8A 5H7XA 3OZRA 1K9VF 3JZAA 1ZSNA 2WYVA 1N77A 1E2LA 2Q0QA 2FX3A 2GCEA 3AF1A 5KJCA 5LMNB 1QRSA 3WMFA 2OGWA 3AKDA 3CXRA 2Y76A 1MQ8B 4DS3A 2VJLA 2ZBEA 3A2LA 1WUIS 4DYHA 3T7RA 4Z2YA 2BE9A 1IOZA 3QF4A 3TZLA 4EPWA 2A7QA 2E9SA 4B9AA 1OJLA 3GCXA 2PT7A 1GGJA 3LGXA 4KXVA 1ULSA 2WKSA 3D8HA 2WICA 3L0SA 3A6PC 4M0KA 3K70C 2J6HA 1RQXA 1LC3A 3RC1A 4E1VA 2NX2A 3OEEA 4HMQA 1J5PA 1U3FA 3NIFB 5DI3A 4X1IB 3DOEA 3IBSA 3A2NA 4XDGA 1ZK1A 3ZQUA 4QYSA 4XWTA 1MHPA 1YB7A 3H9EO 1H4TA 4O2AF 1GDDA 1M2HA 1VYHA 5CM9C 1G8FA 3NZEA 1I32A 2CLKB 2QZSA 2JVIA 3F5MA 2NXNA 3LSTA 4GBED 4FDAA 1U0NA 2C96A 2I3GA 1RXYA 2WYHA 3NU1A 4UTZA 1V2HE 2CT8A 1L9KA 3M6AA 3N86A 3ZG6A 4AZSA 5I5GA 2FFAA 1YRQA 1UOPA 1R0WA 1V6AA 1Y82A 3AKEA 1I1NA 1ULUA 2RHOA 3JRNA 4IJMA 1U90A 3N0WA 5KDDA 3C3KA 1OGYA 1IPHA 1TUBA 2FUCA 2DUJA 3NQ41 3F96A 1G98A 1QMGA 2P8SA 1T26A 1V9LA 1MHTA 1N7IA 5EMJA 3IT3A 1DFGA 1NXWA 2XKJE 5JAIA 2OHHA 3MLAA 5LZ5A 1JIVA 2G77B 1H42A 1ZUD1 4QQRA 1XQ6A 4PANA 3Q3HA 5D8DA 1N2ZA 4MW2A 3A4NA 2OCLA 4NNJA 1QANA 3I9V6 1G2IA 4DE5A 1YXMA 1RJGA 1DQPA 2L17A 2GHQA 2JZOA 2O52A 3AHJA 3JARB 3UF0A 3G7NA 4QOIA 4Q3DA 4Q82A 4HI0E 2IHBA 3BQMB 2PTHA 4BFTA 1Y6GA 4AY3A 1DJOA 4RABA 4G0UA 2ZYHA 3VBEA 4JB8A 2QSYA 3OA2A 4O08A 3V7UA 2X9GA 2HJGA 2JGNA 4BP3A 5BV7A 3CLTC 3AY7A 1XQ9A 4BIIA 3SX4A 4U02A 1KC1A 1WHTA 4Q3CA 2Q27A 1F5SA 1W85B 2DBQA 3K0AA 8ABPA 3L4KA 5C8YA 5IEBA 3RF6A 2WJ4A 2PMBA 1SUWA 3OQIA 4PU0A 3S2SA 3CJRA 1PJBA 4IUDS 1W88B 3NDIA 2GHTA 1I1OA 1QHEA 1Z2EA 2C9ZA 3I9MA 2SCUB 1FLVA 1PEYA 4HPJB 1RYZA 5C1DA 2BGKA 3IVAA 5F73A 5FOXA 4LW8A 1Q84A 1YK0A 2B6NA 1EFDN 1F8GA 3D5QA 3OU6A 3CUYA 3WGQA 2O8EB 5AJHA 2H85A 4C0JA 3R3JA 3BGVA 4KO2S 1XZ8A 2AJ8A 5ALJA 3OM0A 1DWOA 1OA0A 1BEEA 4QBIA 4UU1A 2O0HA 1VLVA 3WYEA 3AR2A 4HDRA 1CY6A 1DG1G 1XEWX 1ZGBA 3D6JA 3CBGA 4KLAA 2WLSA 4LCJA 4WY8A 1CF4A 1L5HB 2VHWA 2VHYA 2E5LB 4YUYA 5EPUA 1O6BA 2C2WA 4ER0A 1BRMA 2YVKA 5LLSA 2C77A 4KNYA 3T3GA 3UFXB 1EE9A 2CEAA 2R87A 5K1ZA 4OXNA 3KOUA 1X1QA 4D4LA 4P83A 1Y9EA 1AQUA 5ALEA 4I46A 4IOLA 1VYVA 4MUGA 3WK9A 2R6AA 2V55B 3SSMA 1MQ9A 1PX2A 1GL7A 2JBAA 3BMQA 1JSCA 3KIPA 1E3WA 5I9SA 4M9QA 1W8IA 1V4NA 1JDBB 4GD3Q 3UUFA 5HBGA 2KX7A 4E09A 1EBUA 3KJGA 4GP9A 4N0PA 3EK2A 2ZVQX 3ZCQA 4YWHA 3E4CA 3TQCA 3HDVA 3E82A 4LE0A 5ES3A 4DCJA 1EBFA 3W5CA 2Y4OA 3KEQA 1CF2O 1W4CA 4RIEA 5JLAA 1E6WA 4F4DA 1L7QA 4UBIA 1BE8A 3PIIA 3AR6A 4N8SA 1Q6ZA 2GJKA 2I9PA 1KGDA 3QX9A 1OBVA 2QU7A 3L7LA 4M9RA 2ATVA 2XI4A 3FIJA 4ENPA 4BJ6A 1NZFA 2O07A 3D3QA 4KAAA 1KY5A 2I2CA 2RARA 4H7EA 3THRA 4PLVA 3LRTA 1V6CA 2A0WA 2ZZMA 1B7GO 3U9LA 2ZIUB 2XVXA 3CGGA 1RW4A 1HEUA 1YC5A 1CULC 2P75A 3SBXA 2OM6A 3H7AA 2BM1A 3BK2A 1L4LA 2L82A 2QIPA 1EFVA 2GH1A 4YRTA 3CXUA 4FXPA 2JB9A 3O1HB 3SVZA 3QM1A 1ELOA 4GFDA 3LF1A 4WOCA 4J0EA 3C8ZA 4ND6A 3S29A 4HAOA 4YACA 3WL4A 1GLNA 3M5PA 4BX8A 4AICA 5JISA 2YX1A 1KJZA 1QNLA 5L3VA 3AOEA 2FEWB 2D74A 3QSGA 1P9NA 3ILXA 1ADCA 3K2IA 5EVCA 3VMFA 1SQ5A 2ZT6A 3EVDA 3FRHA 3ND9A 2QTFA 1E0SA 5KQLA 1GWNA 1DAMA 1EJ0A 3WIUA 1V41E 3EA4A 3PFNA 4JUFA 3W3AA 1KQFA 1V8BA 1Y1SA 2NWQA 1IBSA 4NR0A 5F1YA 5J58A 2X0KA 3U7RA 5KKCA 3EUAA 1PJTA 4WLOA 5COBA 4C2UA 3V7FA 1MNQA 5G4KA 1VL6A 4DAOA 1GYPA 3QEKA 4MI9A 1QGUA 1SNYA 1FSFA 1CZRA 2Y05A 4MGEA 1Z0JA 4DTIA 1N5OX 1G5FA 2QY9A 1C1XB 4UFPA 2PM8A 1E8MA 2YFHA 1M33A 2FOXA 5E6SA 4R7TA 4I9UA 1NLUA 3R7LA 4G9BA 4B3FX 4RDXA 5JNUA 5BSKA 4N3GA 3CF6R 3D4LA 1NXQA 4GAEA 2VBCA 1V4BA 4IG9A 1Y8QB 4DL9A 2ZAIA 1J33A 3HR4A 1R00A 4Z9AA 2VYVD 3L6DA 3OKFA 3MOSA 4K0RA 4ENUA 1N1GA 2QV7A 2VQ3A 3NHPA 3NT2A 2VBIA 1RRFA 4H0FA 4FWBA 3TAUA 4C14A 1U2RA 1VHDA 2IJGX 3RRMA 2YJ3A 4RLHA 4UARA 3GPLA 2OQRA 4EWLA 4FE7A 4BU0A 1YQXA 3W05A 1U1DA 1S8OA 1W93A 3OM1A 4N03A 3DOCA 1W47A 3ONWA 4JLPA 2MIIA 3F5FA 4GOOD 2BR3A 5CVJA 2IZ6A 3PUKA 3O8CA 1MH1A 5ALRA 5KJEA 5G1OA 3UWKA 3AM5A 4MGIR 4PYQA 1HO3A 4FUTA 3M49A 4IDDA 2PWAA 4B85A 5JVDF 3IP7A 1L7DA 2FZWA 5CT5A 4YECA 4X66B 1QVRA 3OEYA 2IOYA 2LCFA 4AZTA 3DTVA 1UBKS 2VK4A 3G0HA 4RVCA 3DW3X 2QJWA 3IKJA 2AXPA 2REOA 1B73A 2YW2A 3ENVA 4PXAA 4ACAA 1J1IA 1XRSB 1T1RA 4WZAA 5B3JA 4DDWA 3VNQA 3L93A 1MGOA 4OJKA 4R68A 3UAOA 4GOXA 1E3SA 1L4EA 3M70A 5KYUB 2GEUA 3QVKA 5KX5A 1W1UA 3NVAA 4TT8A 3QPVA 3PFBA 4LMPA 2VJBA 1U3WA 2WUDA 1YCDA 4WSOA 5PGMA 4TL7A 1LXCA 1ZJ6A 3U19A 3GJRA 3ANSA 4ZVNA 4X85A 1WB4A 1Z6XA 2X5KO 4UNSA 4QL3A 3NJ8A 4X91A 3T15A 1SN7A 3V8EA 4MVXA 2IOFA 2PK3A 1K6MA 1AGYA 4LOLA 1Z8DA 7MHTA 2ZUEA 1BVHA 1NY6A 3RVLA 3OP1A 4IQGA 3KD3A 4CL3A 3TPCA 5A7FA 1VJGA 1U5BB 4BGEA 4TL6A 5FHQA 2XZOA 3ADCA 4NBLA 3QNMA 1XU4A 1A04A 3E1GA 1PQUA 4MQFB 3ZI7A 2NO1A 3SEFA 2D2EA 4GMKA 4RJTA 3WIVA 1WVGA 1YR3A 4F0JA 3QPBA 1LDGA 1BGVA 2BVNA 3RFFA 1GPMA 1UMCA 2RCYA 2VNSA 3QP9A 3HABA 1K6EA 4QLOA 1VZ3A 4ILKA 3QLUA 2RH4A 4CKZA 1T2FA 4F93B 1E2GA 1RXCA 5HK8A 1T4GA 1N7JA 3IIKA 2NUAA 4D74A 2AA3A 4X64B 4D4HA 4OH7A 3MD9A 5L7WA 4R1OA 4BMYA 1R9MA 1HETA 5CDSA 3HTXA 2VYCA 3W77A 4P31A 3HB4X 5FFMA 4V39A 3F0TA 5EUQB 1TQ2A 1EHYA 2QWXA 4I55A 5AQEA 1O0BA 4Z1OA 2YY5A 2WPNA 2X9LA 2HBRA 5ESWA 4AXBA 1YA6A 1J9GA 2G7ZA 1QYDA 1JXQA 1L5YA 1V7CA 1F1BA 3S8YA 1SUBA 4TXLA 2EG9A 2IHZA 2Q9UA 1PL6A 3NIGB 1FX1A 2KHZA 3JQAD 3CZCA 3HCCA 4M8NE 1PHPA 4ARUA 1UBHS 2GTHA 3WKBA 1NDQA 3LT1A 4G8CA 4UULA 5ALFA 4CTOA 1JVSA 2IYYA 2I29A 1TECE 4NOLA 4WXHA 2WHEA 1I1QB 2A6PA 1SA0A 4LXYA 3UHPA 1QHHA 3VU0A 2FPRA 2VXYA 3DMFA 2HQRA 3EEBA 4BQOA 3MUNA 3O3MB 3HKDA 1IZYA 4DLVA 1HF3A 3NP7A 2C2GA 3V7NA 3T7TA 2ZRDA 3FJOA 4C4XA 4R8KA 1G7SA 4R2IA 4CM4A 1OVMA 1SVKA 3ADKA 3GRKA 3IPLA 3LP6A 3SYLA 1JDVA 1QYXA 2HRBA 2YTZA 1ID8A 4BO1A 5JI3E 5HQ3B 2HZ7A 1EVYA 1KJQA 2CYAA 3TLAA 4OHOA 3TQFA 5B1DA 2JH8A 5EIBC 1II8A 2DHDA 3D7RA 4S35A 2HRRA 2FF7A 3A31A 3TLEA 5HIKA 4IIJA 4KL8S 4R69A 5AM0A 1PGPA 2P2ZA 4CQJA 3QKRB 4QXRA 1O5TA 1WPGA 1WUYA 1JG2A 1U9ZA 1X9GA 3BJEA 2R7NA 2JHPA 4YT4A 2GXAA 1IONA 4ZVLA 1QG0A 3R5TA 4I36A 4MZXA 3BIOA 3VR4H 5D00A 4HN2A 4PLZA 4D99A 3HWX1 2BFOA 5KQMA 3K0SA 4HYTA 1U8XX 3DL0A 4RHCA 2PSEA 2TMKA 3PE6A 2DCUA 4DNFA 1Y4AE 4KMOA 3Q10A 4GMXA 3M4XA 1CP3A 4GZ3A 4TMKA 1BE1A 4QGSA 5BWBA 4QJ5A 2FUKA 3C70A 4PBRA 1Y6JA 3EXHB 2AC4A 2O2XA 3VM6A 1K6JA 1Z2OX 5LYJB 4MUYA 3IIJA 4M83A 4O1MA 5EXDA 1E98A 2PS0A 4INJA 1DJMA 4BKOA 2HTFA 1Z8FA 2GNOA 2OGUA 2VSQA 3OT4A 3R0VA 3NUQA 4MV1A 1FVHA 3TBFA 3THOA 2VQEB 5E6SB 3BILA 3C48A 1YTLA 1D5WA 2JIDA 4PLTA 1T2VA 3SM9A 5IJ9A 4JI0B 1SIBE 3KHUA 4F12A 1E62A 5JHHB 2AC7A 5KC8A 3IUYA 1ZVMA 2ZYAA 4C4YA 3UHAA 4AXXA 2HYDA 3S8EA 3P4YA 4DQLA 3U56A 2FB9A 3FR8A 4RD6A 1XLVA 1BX0A 2IHUA 4R84A 3BJMA 2JJ1A 3IUNA 5JNRA 1P45A 4HB0A 2XDWA 5CB6A 2P7IA 4CLRA 2XXAA 2W37A 4F7WA 5A71A 4EL0A 2HH9A 4JT2A 1U02A 1U0FA 5K3CA 4AWBA 1HE8B 1ZN7A 4AY5A 4N65A 5KYYA 4NEHB 2DFVA 2N0SA 5LQSA 2CCKA 4JLKA 4KWEA 4KAFA 2XOXA 5EHXA 3OM8A 2DM6A 2PLNA 3DCIA 3PQCA 3WYAA 3SM3A 1SEPA 3O95A 2AFHE 1U31A 2JFOA 1M5UA 1SU7A 1Y3HA 2KB0A 3NEYA 4OQDA 4O63O 3TD6A 1QO7A 2JVKA 3DBHA 4AL4A 3FOEC 2PFGA 1HOXA 3G9XA 4RGYA 4CXMA 5KSWB 1AVTA 2OCXA 2DUMA 1MB9A 4KOAA 1P73A 3MT9A 4X20B 3V4ZA 3Q8LA 1I5RA 4I9NA 3PNPA 1OFGA 3FYUC 2WOJA 3D8SA 2XBLA 3NHFA 3PC8C 4IIEA 4WADA 5I3ZA 1NAIA 1D6JA 1QTNA 2FNAA 4YJ3F 3ZWOA 1OXTA 4F9EA 2WMOB 3BSSA 3PE4A 1W5BA 1YMUA 1VHLA 5LMUB 1KP9A 1L6RA 1QG6A 1RMQA 1T9GS 2IDMA 1FNDA 3GOQA 4JIGA 5DX0A 4D80A 4EP1A 3E7DA 2PKQP 1ZCFA 3JWPA 3RC8A 1Z33A 3KQMA 1G8MA 4JP1A 1LV7A 4EA8A 1JE1A 2RHDA 3CY6A 3DWIA 4Q4HB 4IL5A 1UM9B 3MINA 3ROMA 3UB2A 1DXHA 3V9PA 1E2IA 4L4YA 2GD1O 2IPXA