1ZW0A

Crystal structure of the yersinia type iii secretion protein ysce
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHYVAGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type III secretion protein
publication title Crystal structure of the Yersinia type III secretion protein YscE
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone
total genus 27
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zw0A00
1BDCA 1DEEG 2B87A 2LXBA 2P58A 4NPEA 5C39A 1EDLA 4HKZH 3RGUA 1FC2C 2KI7B 1ZW0A 2LR2A 2B88A 3ZDMA 4ASWA 3S1KA 2KZIA 3PH0A 2M0BA 2JWDA 5CBOA 5DJTB 1MFTA 1U7MA 4HB1A 2R44A 4ASVA 2B87B 1Q2NA 1EC5A 5EFWB 2M5AB 1S3JA 2B89A 2M5AA 5CBNA 1NVOA 1EDKA 2WMMA 3QWOC 3FXDA 4K35A 4IOIH 3MZWB 2QVAA 1EDIA 2I8DA 1H0TB 4KJMA 1H0TA 1OVRA 1EDJA 4GOFA 4MN4C 1ZXGA 4GODA 2OTKE 2LXCB 4WWIA 1OVUA 2KS1B 1Y47A 5K5GB 2KIKA 5DJUB 4CPGA 4GOEA 1OVVA 4ZMDA 1BDDA 2Q1KA 3MHVA 3FXEA 4JBZA 1LT1A 2QRXA 2RKLA 1LP1B 2ZAEB 2UWJE 1JMBA 1LP1A 2HR3A 2KUBA 4NPDA 4HJGH 1JM0A 4BXLA 1SS1A 1X0TA 4EYYQ 4K3AA 2SPZA 2K3RA 2KZJA 4ZNCA 1U7JA 4NPFX
chains in the Genus database with same CATH superfamily
3RK3D 1NWQA 1LNQA 1VQMP 1NTKJ 5CCGD 4NPEA 2KK7A 3H1HE 3HE4B 2QJYB 2IFMA 3CCLP 3L75D 4DOJA 1NTMJ 2KLUA 2B87B 3JCUH 3VP9A 1J1DB 3AE1C 1LTSC 3TYYA 4I2LC 3MGNA 5CBNA 3VOPA 1NTZK 2KS1A 3CWBJ 1FBMA 1MV8A 1H89A 2POHA 2KSJA 2QVAA 2W8ZA 3I5CA 2PAJA 1YQ3C 4KJMA 3Q5RA 2N1TC 3MD0A 4GOFA 1IFMA 3B4SA 3BRTB 3HTKB 2AEJA 3BVHA 3M9QA 2N1TA 4N78E 2R32A 5H2FH 2YO3A 1NHLA 5AVRB 3L71E 5E79H 4OGQB 2QRXA 1S9KD 3AE5C 1W2BO 1KILC 2R3CA 1JMBA 1BE3G 3HD7B 1TU3F 2FYNB 3L75J 2N1TD 2PRRA 2FKWB 2Z5IA 2B9BA 3CCRP 3II6A 1KILA 2ZYAA 2OTLP 2KZJA 3BCCJ 2Q5UA 4NPFX 3SFEC 2ZFCA 3L70G 1BDCA 1SQXJ 1YJNP 1A02J 4IL6E 1NU1E 2IYOA 4HKZH 3GHGB 2WTYA 1YITP 3CX5E 1SFCD 4WY4C 3CCVP 1LT9B 2B88A 2JWAA 1VQ5P 1KILD 2C9NY 4YTPC 3FGAD 1NGMB 1BGYE 1RH5B 2WSSH 4WY4A 3Q3DA 4HB1A 2GUSA 1SQBJ 4Y28J 1KB9H 3B5NB 3RK2C 3B71A 3G3ZA 3IR9A 1ZN5A 1Q82Q 3K5BA 4WY4D 5KTBA 1N2DC 2PP6A 1PGJA 1AJYA 1JY3N 1CI6B 3PHLA 2YNYA 4WB4A 1JY2N 1FZFA 1JNMA 3RK2D 5KAIH 1PL5A 1HWTC 3VMYA 3M9BA 1MKMA 4I7ZC 3L71G 4UB6H 3TF5A 5KJ7C 2JKVA 2JDIH 3C1LA 4TT3H 5AVXB 1J1EB 4NPDA 1JM0A 1HGZA 2DW3A 1SQVE 1X0TA 1ZR4A 2K3RA 3E1IA 5AW3B 1KQSO 3U1AA 4I6MC 1K73Q 2RN0A 1BCCJ 5AVYB 1NU1G 3L74E 5KJ7D 4ASWA 4H44B 1NU1K 4Y99C 2WSFH 1BGYG 1HJ0A 1RQVA 2E76B 2O01J 2H7HA 1N86A 3H25A 1L0NE 4DT0A 2M5AA 3M0DC 2WMMA 1T3UA 1N73C 4AYCA 2H8PD 3A0HE 1YJ9P 5BVZA 3M0DA 1S5LH 1N73A 4O9BA 4LGDE 2C0WA 1GU5A 4YXWH 1CZQA 2JP3A 1SFCB 3CD6P 2LXCB 1S5LX 3PP5A 5CMZA 2QJKC 4H0LC 1EZVI 2FYUE 1FZBA 1IK7A 2W6BA 3JSVC 2A45H 4D6TD 2WPRA 4GT1A 3BATA 1KYOE 1JCDA 4YXDC 4ZKPA 3CCQP 2WSEH 5AW0B 1PPJE 3GLMA 1PFIA 2ZT9C 3T97B 4RO0A 3V2NA 2OYHC 3F89A 2Y9YA 1SQVK 2LXBA 4H0LD 1PP9E 2OYHA 1H88A 4L75A 3TDKA 2HPCA 1AV1A 3F5HA 3CXHD 3CCSP 2E75B 2LR2A 3L74G 2KYVA 4M3LA 4R4LA 3PH0A 5AW8B 1IZNB 2ZXXA 4Z1MH 3TGUE 2ZT9D 2HYNA 5B66H 2B89A 4LLHA 1VQLP 3HUSC 1L0NG 2E74C 3TNUB 2YMKA 3EFGA 1WT6A 1KD1Q 3MUDC 1L0NK 3HUSA 3MZWB 3AE3C 3AE4C 4HH2A 2A06E 2YKOA 4EI2A 5APWA 3L4FA 5APTA 4PJ0H 4D6TG 1MZ9A 1OVUA 5KLVJ 2KIKA 2E74D 2K37A 2HODB 4C7NA 1GU4A 2P2UA 2FYUG 5AW9B 2W6JH 2QA4P 2FYUK 2IBZI 5B5EE 1IO4A 2AXTH 1HUCA 3W67A 3CCJP 1YIJP 1PPJG 3ITKA 4K3AA 1VF5C 1JY3O 1GW4A 4H13B 3KYQA 1G1JA 1DD3A 3BASA 2B87A 2YIUB 5TJHA 2P58A 4GKGA 1PV3A 1PP9G 1JY2O 3H1IJ 2ZYDA 3L72D 1QVFO 3SWKA 3CL3D 1EC5A 5EFWB 1SQPE 2IDBA 1G1IA 1S3JA 1VF5D 3H1JE 1USEA 3GW6A 1ZLLA 3L35A 3MP7B 1AFOA 1SQQE 1VQ6P 1GL2B 3Q5SA 1NTZE 3V2PA 3B8EB 2A06G 1FZGA 3H32B 3H1KJ 1Q90D 5AVSB 5BU5A 4PD4D 3D70A 2WPSA 2N9BA 1GK4A 3GMAA 1NTKE 4XE5B 3L73J 3N7NA 2G8YA 4PV1B 1FJPA 1ZV8A 3FXEA 4JBZA 4ZKUA 3KZIH 1GW3A 1QEXA 3EWKA 3GG2A 1OIPA 2M3BA 3S4RA 1JTHA 4AQRD 2JJLA 1KQLA 2WPQA 3P8MC 2W90A 5C39A 4EOTA 2IZ0A 1FC2C 3ZDMA 2FYZA 2NPSB 2KZIA 1RF1B 2BCCJ 2L5GB 1Y8AA 1BE3D 2WSFJ 2R44A 2IYPA 1SQPG 1N7LA 3H1JG 1NAYA 1K8AQ 1SQPK 3V5BA 1P84D 3L70D 3Q1MA 1KORA 4XA4A 1SQQK 2WT7A 3CPWO 1M90Q 3H1HD 1NTZG 1H0TB 4GIFA 5AVQB 3G4SP 2R3SA 1JEKA 2FXOA 1NJIQ 1EZVE 3IFMA 4KT0J 1YI2P 3BCCE 4B86A 2J5UA 2OYIB 2QM8A 2W27A 1SQXE 1NTKG 2Y0DA 4OH8B 4JQ0D 1MUUA 1N7SC 1OXZA 2FXMA 1NTKK 2KUBA 1N7SA 2RMZA 5TISH 1R8EA 2WSEJ 1SQBE 3CXHH 3RL0C 1NTMK 1DEEG 3L70J 1GTWA 2IFNA 1N7SD 2C0XA 4N78D 1M1JB 3L36A 3BRVB 1IFJA 1E79H 3L71D 5GTIE 3NMDA 2QJPB 3VMXA 1L0LE 3RL0D 3KQGA 1K9MQ 1ZP0C 2R5BA 3QWOC 5GTHE 3FXDA 3H1HG 1SVFA 5KAFE 4UB8E 2KOGA 1NU1D 1E5WA 4C46A 3CX5D 2OQQA 2YO2A 3AEGC 1BGYD 1EZVG 2K88A 1Y47A 2BASA 1W2EA 1A02F 4CPGA 1OVVA 2KSEA 3NFQA 1BCCE 3O8ZA 2IBZE 3RK3B 1PGPA 1GDTA 1LWUC 1SQXK 1LP1B 2IZ1A 1QL2A 3VMAA 2Q6QA 3L71J 5AVWB 2G3AA 4JYCA 2H89C 2CPSA 1LWUA 2NRGA 1RE4C 1SQBG 3HE5A 4QMAA 3WU2H 1G2CA 1SQBK 2K9JA 2P10A 1RE4A 1IFNA 1EDLA 1IJDB 4I1LA 4DJGA 2IPPA 1VQOP 3SWYA 3A0BH 2Z5HA 1S72P 1HH0A 2KNCA 4U3FE 3AE2C 3WMM0 1L0LG 1SQVD 1LTTC 3R4YA 4WBAA 2P67A 1L0LK 1AA0A 3CMEP 1YYCA 3PLNA 4IFFA 4PD4H 1VPCA 5KLIC 1M57D 3M9HA 2A45I 3L74D 3G6EP 1EDJA 1URQC 3ABVC 4GODA 1L4AC 2N1TB 3OJAB 3EFFK 2M8RA 1JUNA 2E5YA 1URQA 3AEFC 2WVRA 1L4AA 4RKUJ 3CI9A 1L0ND 2IBZG 1YTZI 2RKLA 3M06A 2ZAEB 2Q9IA 1H8AA 1USDA 1LTJC 2PFXA 2HR3A 1YQ4C 2Z4EA 5KKZC 3SWFA 1PZQA 1Y9BA 1KILB 4OWFA 1URQD 1LTJA 1T6AA 1L4AD 3JCUE 2QG4A 3LIEA 2Q1KA 1FJKA 1BSNA 4YPCA 3VMZA 3IN6A 1U57A 3KDPB 4BRYA 2K1AA 5AW5B 1RE3A 2FYUD 3M0AA 3AE6C 2D2CC 2BEQD 1SQVG 4WY4B 3I55P 3L74J 4JYBA 1KYOD 5AW6B 1P84H 1Q2NA 3TK1A 1PPJD 4U3FG 1OW6A 5KLVE 2FFDC 5H2FE 1L0NJ 1BSHA 1RHZB 3RK2B 2FFDA 1PP9D 1LJ2A 5E79E 3AE8C 2D2CD 2H88C 1VQ4P 2XNXA 1RF0C 4MN4C 4XFJA 2PGDA 3P8CE 1YHQP 1VQPP 3TGUD 5DJUB 1QGKB 2YKPA 5APVA 4D6TJ 4DCKA 1HGVA 1RF0A 4ZMDA 3H1IE 1LGHB 3G9RA 1LT1A 2FYUJ 5APUA 2WPVB 3IF4A 1ZRTE 4I7ZB 3OW2O 2C9LY 1FZCC 3RBZA 4BXLA 1Q86Q 1SS1A 2A06D 1KZUB 1FZCA 3C8VA 2O3JA 1DIPA 4LC1A 1KB9E 2ITAA 2E43A 4L73A 3AEAC 1VQ7P 1X22A 2Q3IA 2QJYC 4N6JA 1PP9J 3CCEP 3MIWA 3HE4A 3H1LE 2YXRB 2K9YA 1J1DC 5DJTB 3H1KE 2QEXP 4N3YB 4Y99B 1T3JA 1KQGB 1JCCA 3FWLA 2M5AB 2ZVOB 1NVOA 5KLVG 3L73E 4IL6H 1T8ZA 1FZEA 2AEFA 3CX5H 1S4XA 5KAIE 2MJZA 1DD4A 5KLVK 1N73B 1QVGO 1QL1A 4UB6E 2Y9ZA 3TGUG 2QM7A 1ZOYC 3WUTA 1KFNA 3HTKA 2YXQB 2JR8A 1FAVA 1SQPD 4OGQC 1FOSF 3VN0A 2QJKB 1L2PA 3H1JD 2MKVA 4H0LB 3HD7C 2FYNC 2JEEA 2WSCH 1SQQD 2ZYGA 2J58A 2BCCE 3HD7A 5BU8B 1NH4A 2KXPB 1VQ9P 2RH0A 1NTZD 3E1RA 1GMJA 3KHUA 1T2KC 2ZT9B 5CJ0A 3GHGC 2V7QJ 3L72J 1DH3A 2OYHB 4OGQD 1LT9C 3U59A 1PGOA 3HD7D 1NTKD 1FDIA 2W6AA 3GHGA 1S5LE 1NTME 4IFDK 1LT9A 3H1LG 3O6QB 1KMIZ 1DEBA 3B5NC 1T2KD 2Q7CA 3CWBE 3W68A 3B5NA 1CW5A 3L73G 1NYHA 1OFCX 3HUSB 2E74B 2XDJA 4EIJA 1KC8Q 2O1JA 1RY3A 2FXPA 1EDIA 1KFMA 3VYIA 5CCGA 1GK6A 3RK3E 3B5ND 1NTZJ 1CI6A 2OARA 4WWIA 2QE7H 3LW5H 1FU1A 2P1JA 4C7NB 1SQQG 3A0HH 5AVVB 1BDDA 1JMMA 2WZ7A 3AEBC 4JPZB 2KP8A 1EXJA 3CXHI 1ZR2A 1J1EC 3L75E 3FX0A 2IX7C 2OYOA 4IFMA 1SLQA 2BCCG 1Z56A 1EQ7A 3CLQA 3KPEA 5B66E 1IFPA 4JF7A 1EZVD 1VF5B 3BCCD 4DZOA 4H44C 1KYOH 1JOCA 3WUVA 1SQXD 1ZW0A 3AEEC 1JY3P 1XTGB 1VQKP 1BE3J 4RJTA 3AE9C 1NTMG 2M0BA 2E76C 1JY2P 1U7MA 4ASVA 2HLOA 3U1CA 4PJ0E 1SQBD 3CWBG 1S9KE 2HFED 4K35A 1KB9I 1ZMEC 4IOIH 4H44D 3H1HJ 3AECC 1R5SA 4BWNA 4L76A 2A45G 3E7KA 1AQTA 1SFCC 2E76D 3A2AA 2AXTE 2O01N 3V2RA 1SP4A 2AXCA 4W7YA 1SFCA 5AVZB 5K5GB 3QH9A 1L0LD 1KILE 3MHVA 1IC2A 3AE7C 3SFDC 2I1JA 1Q81Q 1QX8A 3L75G 1RQUA 3EQ2A 4HJGH 1M1KQ 1JTHB 3BCCG 2XZRA 3T97A 1SQXG 1U7JA 3L37A 2XNDH 1UIIA 2LKMA 2E75C 2GA1A 3G71P 2L91A 4U7JA 4KHXA 4EDFA 5B5EH 1IFIA 1BCCD 2IBZD 2XKMA 2JWDA 5CBOA 1MFTA 2V7QH 4PD4I 2XV5A 3Q2YA 2N9YB 3NTNA 4WVZA 1OMIA 3PRJA 3TNUA 1L0LJ 1OW7A 2E75D 3PTZA 1NU1J 2Y0CA 2R5DA 2WT7B 3P7KA 1HBWA 1NO4A 3KZIE 1BGYJ 1VL2A 1S2EA 2I1KA 2HG5D 1LTGC 5APYA 2KS1B 5KJ7A 4GOEA 4U3FD 2HODA 3VTPC 2V4HA 1N7SB 1FDMA 2CPBA 2WSCJ 4GDOA 4H13C 4EYYQ 2YIUC 2WWWA 1IFDA 5APXA 4A7PA 4ZNCA 1MFZA 3NXSA 1BCCG 2BEZF 2J59M 1P84I 3JC22 3RL0B 5AVTB 2WQYC 2VRSA 1K04A 2KI7B 2P7JA 3S9OA 1AQ5A 1Q7YQ 1FS0E 3V2QA 2GUVA 1QLED 3S1KA 2FBWC 3CC2P 1J2JB 4H13D 1SQVJ 1VQNP 4C7RA 1RE3C 3MTUE 5L8RJ 1K05A 4D6TE 2E5TA 2GM4A 1FE6A 2ZXEB 4U3FJ 5AW7B 5CHXA 1GL2C 3LIDA 1LTBC 2JO1A 3A7OA 1KTMA 1IK9A 1GL2A 1S1CX 1YTZT 2I8DA 3D6ZA 1HF9A 1OVRA 2NZ2A 3H32A 4AUWA 5TISE 1ZXGA 1KN7A 4PV1C 3GF3A 3CXHE 1VDFA 1LTIC 3LW5J 3WUUA 2WITA 1GL2D 5KLVD 5AW1B 2UWJE 3D6YA 1NOHA 1WRGA 1LWUB 1JO5A 1FDOA 1VQ8P 3HE5B 4W80A 1OWAA 1N8RQ 2SPZA 3O6QA 2ZVNB 4PV1D 1G2CB 1FOSE 2K9JB 1UIXA 3CC4P 3CMAP 3P8CD 1X8YA 3RGUA 1OW8A 3USSA 1CSBA 2NPSC 1PIXA 1RF1C 3H1ID 3I56P 3CX5I 2NPSA 3CCUP 2KNCB 1RF1A 3UIAA 1KV4A 2OGUA 1ZRTD 3MUDA 2AEMA 3H6PA 1X9VA 5AVUB 1GZLA 2O1KA 5CCHC 1OX3A 5APQA 4OVNF 3HRNA 2NPSD 2CK3H 2Y0EA 1KB9D 1X79B 5CCHA 3AEDC 1YBKA 5GTIH 3TSIA 2W83C 1GD2E 1M56D 1H0TA 1W5CE 3TGUJ 5KLIB 3H1LD 2OYIC 2XU6A 2KB7P 1AVYA 5GTHH 3H1KD 1URQB 3L72E 3C9IA 2OYIA 5CCHD 2ZJSE 3WU2E 1L4AB 1M8OB 5KAFH 1NAFA 4UB8H 1DX7A 3L73D 3N4XA 3OA7A 4IL6X 1JB0J 1EXIA 2FY8A 3PJSK 3V4WA 1OZHA 1R5LA 1NKZB 5APSA 3A0BE 5AW4B 1LTJB 1LTAC 5KKZB 3M91A 3A5TA 3H1IG 1KQFB 1M1JC 2OTJP 4BRYB 1M7LA 3CCMP 5AW2B 3FWNA 3SSUA 1AVOA 1XTCC 2QJPC 1M1JA 3V6IA 1NKNA 4PD4E 2Q3EA 1HJBA 1WMKA 2O01H 2D2CB 3H1LJ 1YJWP 3P32A 4HYTB 5CJ4A 2BCCD 4RESB 2HPCB 1EDKA 4R4MA 1PGQA 4W7ZA 3RL0g 2FFDB 1HVVA 1HTLC 2M3EA 3H1KG 3KXDA 3OAKA 4TLFA 3R2PA 3RBXA 3IAOA 1NTMD 2KLVA 3GF7A 1D7MA 1FZAA 1SQPJ 2OTKE 2E42A 2H43A 3H1JJ 3RK3C 2QSIA 4L74A 3L72G 5CCGC 3V4QA 2YKQA 3VP8A 1SQQJ 3CWBD 3CC7P 2QIWA 2YMYA 5M1BA 1BE3E 1LP1A 3Q5PA 3A3YB 1KYOI 3D71A 1P84E 1FZCB 3L70E
chains in the Genus database with same CATH topology
1BDCA 1DEEG 2B87A 2LXBA 2P58A 4NPEA 5C39A 1EDLA 4HKZH 3RGUA 1FC2C 2KI7B 1ZW0A 2LR2A 2B88A 3ZDMA 4ASWA 3S1KA 2KZIA 3PH0A 2M0BA 2JWDA 5CBOA 5DJTB 1MFTA 1U7MA 4HB1A 2R44A 4ASVA 2B87B 1Q2NA 1EC5A 5EFWB 2M5AB 1S3JA 2B89A 2M5AA 5CBNA 1NVOA 1EDKA 2WMMA 3QWOC 3FXDA 4K35A 4IOIH 3MZWB 2QVAA 1EDIA 2I8DA 1H0TB 4KJMA 1H0TA 1OVRA 1EDJA 4GOFA 4MN4C 1ZXGA 4GODA 2OTKE 2LXCB 4WWIA 1OVUA 2KS1B 1Y47A 5K5GB 2KIKA 5DJUB 4CPGA 4GOEA 1OVVA 4ZMDA 1BDDA 2Q1KA 3MHVA 3FXEA 4JBZA 1LT1A 2QRXA 2RKLA 1LP1B 2ZAEB 2UWJE 1JMBA 1LP1A 2HR3A 2KUBA 4NPDA 4HJGH 1JM0A 4BXLA 1SS1A 1X0TA 4EYYQ 4K3AA 2SPZA 2K3RA 2KZJA 4ZNCA 1U7JA 4NPFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDC A;  1DEE G;  2B87 A;  2LXB A;  2P58 A;  4NPE A;  5C39 A;  1EDL A;  4HKZ H;  3RGU A;  1FC2 C;  2KI7 B;  1ZW0 A;  2LR2 A;  2B88 A;  3ZDM A;  4ASW A;  3S1K A;  2KZI A;  3PH0 A;  2M0B A;  2JWD A;  5CBO A;  5DJT B;  1MFT A;  1U7M A;  4HB1 A;  2R44 A;  4ASV A;  2B87 B;  1Q2N A;  1EC5 A;  5EFW B;  2M5A B;  1S3J A;  2B89 A;  2M5A A;  5CBN A;  1NVO A;  1EDK A;  2WMM A;  3QWO C;  3FXD A;  4K35 A;  4IOI H;  3MZW B;  2QVA A;  1EDI A;  2I8D A;  1H0T B;  4KJM A;  1H0T A;  1OVR A;  1EDJ A;  4GOF A;  4MN4 C;  1ZXG A;  4GOD A;  2OTK E;  2LXC B;  4WWI A;  1OVU A;  2KS1 B;  1Y47 A;  5K5G B;  2KIK A;  5DJU B;  4CPG A;  4GOE A;  1OVV A;  4ZMD A;  1BDD A;  2Q1K A;  3MHV A;  3FXE A;  4JBZ A;  1LT1 A;  2QRX A;  2RKL A;  1LP1 B;  2ZAE B;  2UWJ E;  1JMB A;  1LP1 A;  2HR3 A;  2KUB A;  4NPD A;  4HJG H;  1JM0 A;  4BXL A;  1SS1 A;  1X0T A;  4EYY Q;  4K3A A;  2SPZ A;  2K3R A;  2KZJ A;  4ZNC A;  1U7J A;  4NPF X; 
#chains in the Genus database with same CATH topology
 3RK3 D;  1NWQ A;  1LNQ A;  1VQM P;  1NTK J;  5CCG D;  4NPE A;  2KK7 A;  3H1H E;  3HE4 B;  2QJY B;  2IFM A;  3CCL P;  3L75 D;  4DOJ A;  1NTM J;  2KLU A;  2B87 B;  3JCU H;  3VP9 A;  1J1D B;  3AE1 C;  1LTS C;  3TYY A;  4I2L C;  3MGN A;  5CBN A;  3VOP A;  1NTZ K;  2KS1 A;  3CWB J;  1FBM A;  1MV8 A;  1H89 A;  2POH A;  2KSJ A;  2QVA A;  2W8Z A;  3I5C A;  2PAJ A;  1YQ3 C;  4KJM A;  3Q5R A;  2N1T C;  3MD0 A;  4GOF A;  1IFM A;  3B4S A;  3BRT B;  3HTK B;  2AEJ A;  3BVH A;  3M9Q A;  2N1T A;  4N78 E;  2R32 A;  5H2F H;  2YO3 A;  1NHL A;  5AVR B;  3L71 E;  5E79 H;  4OGQ B;  2QRX A;  1S9K D;  3AE5 C;  1W2B O;  1KIL C;  2R3C A;  1JMB A;  1BE3 G;  3HD7 B;  1TU3 F;  2FYN B;  3L75 J;  2N1T D;  2PRR A;  2FKW B;  2Z5I A;  2B9B A;  3CCR P;  3II6 A;  1KIL A;  2ZYA A;  2OTL P;  2KZJ A;  3BCC J;  2Q5U A;  4NPF X;  3SFE C;  2ZFC A;  3L70 G;  1BDC A;  1SQX J;  1YJN P;  1A02 J;  4IL6 E;  1NU1 E;  2IYO A;  4HKZ H;  3GHG B;  2WTY A;  1YIT P;  3CX5 E;  1SFC D;  4WY4 C;  3CCV P;  1LT9 B;  2B88 A;  2JWA A;  1VQ5 P;  1KIL D;  2C9N Y;  4YTP C;  3FGA D;  1NGM B;  1BGY E;  1RH5 B;  2WSS H;  4WY4 A;  3Q3D A;  4HB1 A;  2GUS A;  1SQB J;  4Y28 J;  1KB9 H;  3B5N B;  3RK2 C;  3B71 A;  3G3Z A;  3IR9 A;  1ZN5 A;  1Q82 Q;  3K5B A;  4WY4 D;  5KTB A;  1N2D C;  2PP6 A;  1PGJ A;  1AJY A;  1JY3 N;  1CI6 B;  3PHL A;  2YNY A;  4WB4 A;  1JY2 N;  1FZF A;  1JNM A;  3RK2 D;  5KAI H;  1PL5 A;  1HWT C;  3VMY A;  3M9B A;  1MKM A;  4I7Z C;  3L71 G;  4UB6 H;  3TF5 A;  5KJ7 C;  2JKV A;  2JDI H;  3C1L A;  4TT3 H;  5AVX B;  1J1E B;  4NPD A;  1JM0 A;  1HGZ A;  2DW3 A;  1SQV E;  1X0T A;  1ZR4 A;  2K3R A;  3E1I A;  5AW3 B;  1KQS O;  3U1A A;  4I6M C;  1K73 Q;  2RN0 A;  1BCC J;  5AVY B;  1NU1 G;  3L74 E;  5KJ7 D;  4ASW A;  4H44 B;  1NU1 K;  4Y99 C;  2WSF H;  1BGY G;  1HJ0 A;  1RQV A;  2E76 B;  2O01 J;  2H7H A;  1N86 A;  3H25 A;  1L0N E;  4DT0 A;  2M5A A;  3M0D C;  2WMM A;  1T3U A;  1N73 C;  4AYC A;  2H8P D;  3A0H E;  1YJ9 P;  5BVZ A;  3M0D A;  1S5L H;  1N73 A;  4O9B A;  4LGD E;  2C0W A;  1GU5 A;  4YXW H;  1CZQ A;  2JP3 A;  1SFC B;  3CD6 P;  2LXC B;  1S5L X;  3PP5 A;  5CMZ A;  2QJK C;  4H0L C;  1EZV I;  2FYU E;  1FZB A;  1IK7 A;  2W6B A;  3JSV C;  2A45 H;  4D6T D;  2WPR A;  4GT1 A;  3BAT A;  1KYO E;  1JCD A;  4YXD C;  4ZKP A;  3CCQ P;  2WSE H;  5AW0 B;  1PPJ E;  3GLM A;  1PFI A;  2ZT9 C;  3T97 B;  4RO0 A;  3V2N A;  2OYH C;  3F89 A;  2Y9Y A;  1SQV K;  2LXB A;  4H0L D;  1PP9 E;  2OYH A;  1H88 A;  4L75 A;  3TDK A;  2HPC A;  1AV1 A;  3F5H A;  3CXH D;  3CCS P;  2E75 B;  2LR2 A;  3L74 G;  2KYV A;  4M3L A;  4R4L A;  3PH0 A;  5AW8 B;  1IZN B;  2ZXX A;  4Z1M H;  3TGU E;  2ZT9 D;  2HYN A;  5B66 H;  2B89 A;  4LLH A;  1VQL P;  3HUS C;  1L0N G;  2E74 C;  3TNU B;  2YMK A;  3EFG A;  1WT6 A;  1KD1 Q;  3MUD C;  1L0N K;  3HUS A;  3MZW B;  3AE3 C;  3AE4 C;  4HH2 A;  2A06 E;  2YKO A;  4EI2 A;  5APW A;  3L4F A;  5APT A;  4PJ0 H;  4D6T G;  1MZ9 A;  1OVU A;  5KLV J;  2KIK A;  2E74 D;  2K37 A;  2HOD B;  4C7N A;  1GU4 A;  2P2U A;  2FYU G;  5AW9 B;  2W6J H;  2QA4 P;  2FYU K;  2IBZ I;  5B5E E;  1IO4 A;  2AXT H;  1HUC A;  3W67 A;  3CCJ P;  1YIJ P;  1PPJ G;  3ITK A;  4K3A A;  1VF5 C;  1JY3 O;  1GW4 A;  4H13 B;  3KYQ A;  1G1J A;  1DD3 A;  3BAS A;  2B87 A;  2YIU B;  5TJH A;  2P58 A;  4GKG A;  1PV3 A;  1PP9 G;  1JY2 O;  3H1I J;  2ZYD A;  3L72 D;  1QVF O;  3SWK A;  3CL3 D;  1EC5 A;  5EFW B;  1SQP E;  2IDB A;  1G1I A;  1S3J A;  1VF5 D;  3H1J E;  1USE A;  3GW6 A;  1ZLL A;  3L35 A;  3MP7 B;  1AFO A;  1SQQ E;  1VQ6 P;  1GL2 B;  3Q5S A;  1NTZ E;  3V2P A;  3B8E B;  2A06 G;  1FZG A;  3H32 B;  3H1K J;  1Q90 D;  5AVS B;  5BU5 A;  4PD4 D;  3D70 A;  2WPS A;  2N9B A;  1GK4 A;  3GMA A;  1NTK E;  4XE5 B;  3L73 J;  3N7N A;  2G8Y A;  4PV1 B;  1FJP A;  1ZV8 A;  3FXE A;  4JBZ A;  4ZKU A;  3KZI H;  1GW3 A;  1QEX A;  3EWK A;  3GG2 A;  1OIP A;  2M3B A;  3S4R A;  1JTH A;  4AQR D;  2JJL A;  1KQL A;  2WPQ A;  3P8M C;  2W90 A;  5C39 A;  4EOT A;  2IZ0 A;  1FC2 C;  3ZDM A;  2FYZ A;  2NPS B;  2KZI A;  1RF1 B;  2BCC J;  2L5G B;  1Y8A A;  1BE3 D;  2WSF J;  2R44 A;  2IYP A;  1SQP G;  1N7L A;  3H1J G;  1NAY A;  1K8A Q;  1SQP K;  3V5B A;  1P84 D;  3L70 D;  3Q1M A;  1KOR A;  4XA4 A;  1SQQ K;  2WT7 A;  3CPW O;  1M90 Q;  3H1H D;  1NTZ G;  1H0T B;  4GIF A;  5AVQ B;  3G4S P;  2R3S A;  1JEK A;  2FXO A;  1NJI Q;  1EZV E;  3IFM A;  4KT0 J;  1YI2 P;  3BCC E;  4B86 A;  2J5U A;  2OYI B;  2QM8 A;  2W27 A;  1SQX E;  1NTK G;  2Y0D A;  4OH8 B;  4JQ0 D;  1MUU A;  1N7S C;  1OXZ A;  2FXM A;  1NTK K;  2KUB A;  1N7S A;  2RMZ A;  5TIS H;  1R8E A;  2WSE J;  1SQB E;  3CXH H;  3RL0 C;  1NTM K;  1DEE G;  3L70 J;  1GTW A;  2IFN A;  1N7S D;  2C0X A;  4N78 D;  1M1J B;  3L36 A;  3BRV B;  1IFJ A;  1E79 H;  3L71 D;  5GTI E;  3NMD A;  2QJP B;  3VMX A;  1L0L E;  3RL0 D;  3KQG A;  1K9M Q;  1ZP0 C;  2R5B A;  3QWO C;  5GTH E;  3FXD A;  3H1H G;  1SVF A;  5KAF E;  4UB8 E;  2KOG A;  1NU1 D;  1E5W A;  4C46 A;  3CX5 D;  2OQQ A;  2YO2 A;  3AEG C;  1BGY D;  1EZV G;  2K88 A;  1Y47 A;  2BAS A;  1W2E A;  1A02 F;  4CPG A;  1OVV A;  2KSE A;  3NFQ A;  1BCC E;  3O8Z A;  2IBZ E;  3RK3 B;  1PGP A;  1GDT A;  1LWU C;  1SQX K;  1LP1 B;  2IZ1 A;  1QL2 A;  3VMA A;  2Q6Q A;  3L71 J;  5AVW B;  2G3A A;  4JYC A;  2H89 C;  2CPS A;  1LWU A;  2NRG A;  1RE4 C;  1SQB G;  3HE5 A;  4QMA A;  3WU2 H;  1G2C A;  1SQB K;  2K9J A;  2P10 A;  1RE4 A;  1IFN A;  1EDL A;  1IJD B;  4I1L A;  4DJG A;  2IPP A;  1VQO P;  3SWY A;  3A0B H;  2Z5H A;  1S72 P;  1HH0 A;  2KNC A;  4U3F E;  3AE2 C;  3WMM 0;  1L0L G;  1SQV D;  1LTT C;  3R4Y A;  4WBA A;  2P67 A;  1L0L K;  1AA0 A;  3CME P;  1YYC A;  3PLN A;  4IFF A;  4PD4 H;  1VPC A;  5KLI C;  1M57 D;  3M9H A;  2A45 I;  3L74 D;  3G6E P;  1EDJ A;  1URQ C;  3ABV C;  4GOD A;  1L4A C;  2N1T B;  3OJA B;  3EFF K;  2M8R A;  1JUN A;  2E5Y A;  1URQ A;  3AEF C;  2WVR A;  1L4A A;  4RKU J;  3CI9 A;  1L0N D;  2IBZ G;  1YTZ I;  2RKL A;  3M06 A;  2ZAE B;  2Q9I A;  1H8A A;  1USD A;  1LTJ C;  2PFX A;  2HR3 A;  1YQ4 C;  2Z4E A;  5KKZ C;  3SWF A;  1PZQ A;  1Y9B A;  1KIL B;  4OWF A;  1URQ D;  1LTJ A;  1T6A A;  1L4A D;  3JCU E;  2QG4 A;  3LIE A;  2Q1K A;  1FJK A;  1BSN A;  4YPC A;  3VMZ A;  3IN6 A;  1U57 A;  3KDP B;  4BRY A;  2K1A A;  5AW5 B;  1RE3 A;  2FYU D;  3M0A A;  3AE6 C;  2D2C C;  2BEQ D;  1SQV G;  4WY4 B;  3I55 P;  3L74 J;  4JYB A;  1KYO D;  5AW6 B;  1P84 H;  1Q2N A;  3TK1 A;  1PPJ D;  4U3F G;  1OW6 A;  5KLV E;  2FFD C;  5H2F E;  1L0N J;  1BSH A;  1RHZ B;  3RK2 B;  2FFD A;  1PP9 D;  1LJ2 A;  5E79 E;  3AE8 C;  2D2C D;  2H88 C;  1VQ4 P;  2XNX A;  1RF0 C;  4MN4 C;  4XFJ A;  2PGD A;  3P8C E;  1YHQ P;  1VQP P;  3TGU D;  5DJU B;  1QGK B;  2YKP A;  5APV A;  4D6T J;  4DCK A;  1HGV A;  1RF0 A;  4ZMD A;  3H1I E;  1LGH B;  3G9R A;  1LT1 A;  2FYU J;  5APU A;  2WPV B;  3IF4 A;  1ZRT E;  4I7Z B;  3OW2 O;  2C9L Y;  1FZC C;  3RBZ A;  4BXL A;  1Q86 Q;  1SS1 A;  2A06 D;  1KZU B;  1FZC A;  3C8V A;  2O3J A;  1DIP A;  4LC1 A;  1KB9 E;  2ITA A;  2E43 A;  4L73 A;  3AEA C;  1VQ7 P;  1X22 A;  2Q3I A;  2QJY C;  4N6J A;  1PP9 J;  3CCE P;  3MIW A;  3HE4 A;  3H1L E;  2YXR B;  2K9Y A;  1J1D C;  5DJT B;  3H1K E;  2QEX P;  4N3Y B;  4Y99 B;  1T3J A;  1KQG B;  1JCC A;  3FWL A;  2M5A B;  2ZVO B;  1NVO A;  5KLV G;  3L73 E;  4IL6 H;  1T8Z A;  1FZE A;  2AEF A;  3CX5 H;  1S4X A;  5KAI E;  2MJZ A;  1DD4 A;  5KLV K;  1N73 B;  1QVG O;  1QL1 A;  4UB6 E;  2Y9Z A;  3TGU G;  2QM7 A;  1ZOY C;  3WUT A;  1KFN A;  3HTK A;  2YXQ B;  2JR8 A;  1FAV A;  1SQP D;  4OGQ C;  1FOS F;  3VN0 A;  2QJK B;  1L2P A;  3H1J D;  2MKV A;  4H0L B;  3HD7 C;  2FYN C;  2JEE A;  2WSC H;  1SQQ D;  2ZYG A;  2J58 A;  2BCC E;  3HD7 A;  5BU8 B;  1NH4 A;  2KXP B;  1VQ9 P;  2RH0 A;  1NTZ D;  3E1R A;  1GMJ A;  3KHU A;  1T2K C;  2ZT9 B;  5CJ0 A;  3GHG C;  2V7Q J;  3L72 J;  1DH3 A;  2OYH B;  4OGQ D;  1LT9 C;  3U59 A;  1PGO A;  3HD7 D;  1NTK D;  1FDI A;  2W6A A;  3GHG A;  1S5L E;  1NTM E;  4IFD K;  1LT9 A;  3H1L G;  3O6Q B;  1KMI Z;  1DEB A;  3B5N C;  1T2K D;  2Q7C A;  3CWB E;  3W68 A;  3B5N A;  1CW5 A;  3L73 G;  1NYH A;  1OFC X;  3HUS B;  2E74 B;  2XDJ A;  4EIJ A;  1KC8 Q;  2O1J A;  1RY3 A;  2FXP A;  1EDI A;  1KFM A;  3VYI A;  5CCG A;  1GK6 A;  3RK3 E;  3B5N D;  1NTZ J;  1CI6 A;  2OAR A;  4WWI A;  2QE7 H;  3LW5 H;  1FU1 A;  2P1J A;  4C7N B;  1SQQ G;  3A0H H;  5AVV B;  1BDD A;  1JMM A;  2WZ7 A;  3AEB C;  4JPZ B;  2KP8 A;  1EXJ A;  3CXH I;  1ZR2 A;  1J1E C;  3L75 E;  3FX0 A;  2IX7 C;  2OYO A;  4IFM A;  1SLQ A;  2BCC G;  1Z56 A;  1EQ7 A;  3CLQ A;  3KPE A;  5B66 E;  1IFP A;  4JF7 A;  1EZV D;  1VF5 B;  3BCC D;  4DZO A;  4H44 C;  1KYO H;  1JOC A;  3WUV A;  1SQX D;  1ZW0 A;  3AEE C;  1JY3 P;  1XTG B;  1VQK P;  1BE3 J;  4RJT A;  3AE9 C;  1NTM G;  2M0B A;  2E76 C;  1JY2 P;  1U7M A;  4ASV A;  2HLO A;  3U1C A;  4PJ0 E;  1SQB D;  3CWB G;  1S9K E;  2HFE D;  4K35 A;  1KB9 I;  1ZME C;  4IOI H;  4H44 D;  3H1H J;  3AEC C;  1R5S A;  4BWN A;  4L76 A;  2A45 G;  3E7K A;  1AQT A;  1SFC C;  2E76 D;  3A2A A;  2AXT E;  2O01 N;  3V2R A;  1SP4 A;  2AXC A;  4W7Y A;  1SFC A;  5AVZ B;  5K5G B;  3QH9 A;  1L0L D;  1KIL E;  3MHV A;  1IC2 A;  3AE7 C;  3SFD C;  2I1J A;  1Q81 Q;  1QX8 A;  3L75 G;  1RQU A;  3EQ2 A;  4HJG H;  1M1K Q;  1JTH B;  3BCC G;  2XZR A;  3T97 A;  1SQX G;  1U7J A;  3L37 A;  2XND H;  1UII A;  2LKM A;  2E75 C;  2GA1 A;  3G71 P;  2L91 A;  4U7J A;  4KHX A;  4EDF A;  5B5E H;  1IFI A;  1BCC D;  2IBZ D;  2XKM A;  2JWD A;  5CBO A;  1MFT A;  2V7Q H;  4PD4 I;  2XV5 A;  3Q2Y A;  2N9Y B;  3NTN A;  4WVZ A;  1OMI A;  3PRJ A;  3TNU A;  1L0L J;  1OW7 A;  2E75 D;  3PTZ A;  1NU1 J;  2Y0C A;  2R5D A;  2WT7 B;  3P7K A;  1HBW A;  1NO4 A;  3KZI E;  1BGY J;  1VL2 A;  1S2E A;  2I1K A;  2HG5 D;  1LTG C;  5APY A;  2KS1 B;  5KJ7 A;  4GOE A;  4U3F D;  2HOD A;  3VTP C;  2V4H A;  1N7S B;  1FDM A;  2CPB A;  2WSC J;  4GDO A;  4H13 C;  4EYY Q;  2YIU C;  2WWW A;  1IFD A;  5APX A;  4A7P A;  4ZNC A;  1MFZ A;  3NXS A;  1BCC G;  2BEZ F;  2J59 M;  1P84 I;  3JC2 2;  3RL0 B;  5AVT B;  2WQY C;  2VRS A;  1K04 A;  2KI7 B;  2P7J A;  3S9O A;  1AQ5 A;  1Q7Y Q;  1FS0 E;  3V2Q A;  2GUV A;  1QLE D;  3S1K A;  2FBW C;  3CC2 P;  1J2J B;  4H13 D;  1SQV J;  1VQN P;  4C7R A;  1RE3 C;  3MTU E;  5L8R J;  1K05 A;  4D6T E;  2E5T A;  2GM4 A;  1FE6 A;  2ZXE B;  4U3F J;  5AW7 B;  5CHX A;  1GL2 C;  3LID A;  1LTB C;  2JO1 A;  3A7O A;  1KTM A;  1IK9 A;  1GL2 A;  1S1C X;  1YTZ T;  2I8D A;  3D6Z A;  1HF9 A;  1OVR A;  2NZ2 A;  3H32 A;  4AUW A;  5TIS E;  1ZXG A;  1KN7 A;  4PV1 C;  3GF3 A;  3CXH E;  1VDF A;  1LTI C;  3LW5 J;  3WUU A;  2WIT A;  1GL2 D;  5KLV D;  5AW1 B;  2UWJ E;  3D6Y A;  1NOH A;  1WRG A;  1LWU B;  1JO5 A;  1FDO A;  1VQ8 P;  3HE5 B;  4W80 A;  1OWA A;  1N8R Q;  2SPZ A;  3O6Q A;  2ZVN B;  4PV1 D;  1G2C B;  1FOS E;  2K9J B;  1UIX A;  3CC4 P;  3CMA P;  3P8C D;  1X8Y A;  3RGU A;  1OW8 A;  3USS A;  1CSB A;  2NPS C;  1PIX A;  1RF1 C;  3H1I D;  3I56 P;  3CX5 I;  2NPS A;  3CCU P;  2KNC B;  1RF1 A;  3UIA A;  1KV4 A;  2OGU A;  1ZRT D;  3MUD A;  2AEM A;  3H6P A;  1X9V A;  5AVU B;  1GZL A;  2O1K A;  5CCH C;  1OX3 A;  5APQ A;  4OVN F;  3HRN A;  2NPS D;  2CK3 H;  2Y0E A;  1KB9 D;  1X79 B;  5CCH A;  3AED C;  1YBK A;  5GTI H;  3TSI A;  2W83 C;  1GD2 E;  1M56 D;  1H0T A;  1W5C E;  3TGU J;  5KLI B;  3H1L D;  2OYI C;  2XU6 A;  2KB7 P;  1AVY A;  5GTH H;  3H1K D;  1URQ B;  3L72 E;  3C9I A;  2OYI A;  5CCH D;  2ZJS E;  3WU2 E;  1L4A B;  1M8O B;  5KAF H;  1NAF A;  4UB8 H;  1DX7 A;  3L73 D;  3N4X A;  3OA7 A;  4IL6 X;  1JB0 J;  1EXI A;  2FY8 A;  3PJS K;  3V4W A;  1OZH A;  1R5L A;  1NKZ B;  5APS A;  3A0B E;  5AW4 B;  1LTJ B;  1LTA C;  5KKZ B;  3M91 A;  3A5T A;  3H1I G;  1KQF B;  1M1J C;  2OTJ P;  4BRY B;  1M7L A;  3CCM P;  5AW2 B;  3FWN A;  3SSU A;  1AVO A;  1XTC C;  2QJP C;  1M1J A;  3V6I A;  1NKN A;  4PD4 E;  2Q3E A;  1HJB A;  1WMK A;  2O01 H;  2D2C B;  3H1L J;  1YJW P;  3P32 A;  4HYT B;  5CJ4 A;  2BCC D;  4RES B;  2HPC B;  1EDK A;  4R4M A;  1PGQ A;  4W7Z A;  3RL0 g;  2FFD B;  1HVV A;  1HTL C;  2M3E A;  3H1K G;  3KXD A;  3OAK A;  4TLF A;  3R2P A;  3RBX A;  3IAO A;  1NTM D;  2KLV A;  3GF7 A;  1D7M A;  1FZA A;  1SQP J;  2OTK E;  2E42 A;  2H43 A;  3H1J J;  3RK3 C;  2QSI A;  4L74 A;  3L72 G;  5CCG C;  3V4Q A;  2YKQ A;  3VP8 A;  1SQQ J;  3CWB D;  3CC7 P;  2QIW A;  2YMY A;  5M1B A;  1BE3 E;  1LP1 A;  3Q5P A;  3A3Y B;  1KYO I;  3D71 A;  1P84 E;  1FZC B;  3L70 E; 
#chains in the Genus database with same CATH homology
 1BDC A;  1DEE G;  2B87 A;  2LXB A;  2P58 A;  4NPE A;  5C39 A;  1EDL A;  4HKZ H;  3RGU A;  1FC2 C;  2KI7 B;  1ZW0 A;  2LR2 A;  2B88 A;  3ZDM A;  4ASW A;  3S1K A;  2KZI A;  3PH0 A;  2M0B A;  2JWD A;  5CBO A;  5DJT B;  1MFT A;  1U7M A;  4HB1 A;  2R44 A;  4ASV A;  2B87 B;  1Q2N A;  1EC5 A;  5EFW B;  2M5A B;  1S3J A;  2B89 A;  2M5A A;  5CBN A;  1NVO A;  1EDK A;  2WMM A;  3QWO C;  3FXD A;  4K35 A;  4IOI H;  3MZW B;  2QVA A;  1EDI A;  2I8D A;  1H0T B;  4KJM A;  1H0T A;  1OVR A;  1EDJ A;  4GOF A;  4MN4 C;  1ZXG A;  4GOD A;  2OTK E;  2LXC B;  4WWI A;  1OVU A;  2KS1 B;  1Y47 A;  5K5G B;  2KIK A;  5DJU B;  4CPG A;  4GOE A;  1OVV A;  4ZMD A;  1BDD A;  2Q1K A;  3MHV A;  3FXE A;  4JBZ A;  1LT1 A;  2QRX A;  2RKL A;  1LP1 B;  2ZAE B;  2UWJ E;  1JMB A;  1LP1 A;  2HR3 A;  2KUB A;  4NPD A;  4HJG H;  1JM0 A;  4BXL A;  1SS1 A;  1X0T A;  4EYY Q;  4K3A A;  2SPZ A;  2K3R A;  2KZJ A;  4ZNC A;  1U7J A;  4NPF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...