1ZW0A

Crystal structure of the yersinia type iii secretion protein ysce
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHYVAGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Yersinia type III secretion protein YscE
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone
molecule keywords type III secretion protein
total genus 27
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1zw0A00
1H0TB 1EC5A 5K5GB 1LP1B 1BDDA 1Y47A 4EYYQ 2Q1KA 3MZWB 1OVUA 4IOIH 2QVAA 5DJTB 3QWOC 1EDJA 2KZJA 2RKLA 3FXDA 2B87B 2WMMA 1Q2NA 2I8DA 4ASVA 2K3RA 1ZW0A 2LXBA 3RGUA 4NPEA 5EFWB 3S1KA 2M5AB 4K3AA 3MHVA 4GOFA 2JWDA 1U7JA 1OVVA 5C39A 4HKZH 5CBOA 1NVOA 4BXLA 1ZXGA 1EDIA 5DJUB 2KUBA 2UWJE 2KI7B 1LT1A 2HR3A 4GODA 2M5AA 4JBZA 2LR2A 3PH0A 3ZDMA 1H0TA 1U7MA 1EDKA 4GOEA 1MFTA 1FC2C 2QRXA 5CBNA 2B88A 1LP1A 1DEEG 4K35A 1EDLA 2LXCB 1OVRA 2P58A 1S3JA 3FXEA 2M0BA 4MN4C 4ASWA 4HJGH 4CPGA 4ZMDA 1JM0A 1X0TA 2SPZA 4HB1A 1BDCA 2KIKA 2KS1B 2B87A 2KZIA 1SS1A 2ZAEB 1JMBA 2B89A 4NPFX 2R44A 4WWIA 4ZNCA 4KJMA 2OTKE 4NPDA
chains in the Genus database with same CATH superfamily
2BASA 2FYNC 2YMKA 1BCCJ 1EC5A 2ZXEB 2WSFH 1LT9B 3B71A 3IN6A 1KQFB 1G1IA 3RK3B 4C7NA 1NTZD 1CZQA 1TU3F 1YQ3C 2WWWA 4LC1A 1AVOA 4D6TJ 3CC7P 1BGYJ 3L72D 2YIUB 2H88C 3HD7A 1WMKA 1PGOA 1RF0C 3LIDA 3V2RA 1YTZT 5CCGA 2L91A 1CW5A 3MZWB 5AVVB 1RF1C 1MV8A 1NTZJ 1ZR4A 5CJ0A 3QWOC 5AVSB 3VOPA 3H25A 1BGYD 3L72J 3FWLA 4AYCA 1KYOH 4I6MC 1QVGO 2B87B 2WMMA 4WVZA 1L0NG 2H43A 4RESB 1BSHA 3L75J 3SSUA 4O9BA 3T97B 1FU1A 1KB9D 3L72G 1HTLC 1LTBC 2YO2A 2HODB 1Q2NA 4GKGA 2E42A 4ASVA 2K3RA 3NMDA 1S9KD 3RK2C 3HE4A 3IAOA 1NU1K 1JO5A 1NAFA 1CI6A 4L76A 3D6ZA 1VQOP 3RBZA 4EYYQ 3S1KA 1N86A 1BGYG 3O8ZA 1IFDA 2Q7CA 4D6TG 3CCUP 1GZLA 3FGAD 3HD7D 1OVVA 1L0ND 2C0WA 3II6A 1GL2A 4H13D 1BGYE 1G2CA 2E74B 4HKZH 1GU5A 1J1DC 1HJ0A 1NTME 1NVOA 1R5LA 1G2CB 3H1LD 2IX7C 1YIJP 3H1JJ 1FS0E 1VQ8P 3CX5H 2NZ2A 5DJUB 3U1CA 1MFZA 2QSIA 2DW3A 2O01J 4H13B 1JY3O 3L36A 2RN0A 2OYIC 2R5BA 3K5BA 2UWJE 3H1IE 2G3AA 2HR3A 4GDOA 3WU2E 1YITP 3VMXA 3CD6P 4GODA 3HUSA 1BE3E 1SP4A 1YBKA 1S72P 1JUNA 3HTKB 4OGQD 1Q82Q 2JP3A 3AE8C 2I1KA 2LR2A 1LNQA 3HRNA 4GT1A 2B9BA 3PH0A 5B5EH 1NWQA 3JCUE 2QM7A 1PP9J 2P7JA 2MJZA 1NTKK 2HODA 1PL5A 3L74D 3U1AA 2WSEH 4EDFA 3AEEC 3BASA 1A02F 3I55P 2OYHA 3P32A 4RKUJ 2OTLP 3G9RA 1SFCD 1L0LK 2HLOA 2QRXA 5AVYB 1S5LX 1SQPG 2B88A 1LP1A 1NH4A 2FXOA 3H1JE 4TT3H 2KSJA 1USEA 1L0NE 2QM8A 4OVNF 1N2DC 3C1LA 1SQQJ 4IFFA 3RK2B 1JTHA 2JR8A 1CSBA 3B5NC 1GW4A 5AW6B 1FZCC 1OVRA 3L70D 4PD4I 1LWUB 5M1BA 4D6TE 1N7SB 4C7RA 1GD2E 1S3JA 2L5GB 2QG4A 3FXEA 1J1EB 4WB4A 3RL0g 1AV1A 1T3UA 2E75C 1J1DB 1SFCB 1HF9A 1RE4A 1FZBA 1LWUC 2A06G 3EFFK 4HJGH 4ZMDA 2AXCA 4H44D 1M1JC 1NU1G 2NPSD 2V4HA 4I7ZB 1BE3D 2YXRB 1JM0A 3MP7B 1RE3A 3EFGA 3IF4A 3SWYA 2OYIB 3E1RA 1JCDA 1OWAA 4HB1A 1K8AQ 1HUCA 2H7HA 2M3BA 1BDCA 3IFMA 5APYA 2KIKA 2YXQB 2E5TA 2OTJP 2K88A 1FJPA 2N1TB 4WY4D 1ZRTD 2N9BA 2WPVB 2A06D 1M8OB 1PIXA 2YO3A 2BEQD 2ZT9D 4PD4E 2ZAEB 1SQQE 2WPRA 1XTGB 1S5LH 5KAFH 3D71A 2QA4P 3H1LE 3CCRP 3HE5A 1JMBA 2GUVA 5CHXA 5CCHA 4NPFX 3D6YA 1AVYA 3Q5SA 1R8EA 3HUSC 3V4WA 1EZVG 2NPSC 3CXHE 3PTZA 3LIEA 4H0LB 3Q5RA 3W68A 3GHGC 3A5TA 3CCMP 1KQSO 1HGZA 4UB8H 2FKWB 3VTPC 4YTPC 3UIAA 2HPCB 5K5GB 1LP1B 2OYOA 4H44C 3H1KE 2PGDA 4JQ0D 5KLVJ 1Y47A 2KS1A 2E75D 3MGNA 2H8PD 2Q1KA 3L71E 2WSCH 4DJGA 4YXDC 2IBZD 1BSNA 1VDFA 1SQVG 3HE5B 1L4AD 1URQA 3VP8A 1RQUA 4DT0A 1FZGA 1GDTA 1NTZK 1KFNA 1LJ2A 1P84D 3GMAA 1EDJA 2RKLA 3OA7A 5KLVD 3SFDC 2WITA 3USSA 3CXHD 2ZT9C 2BCCD 1Q86Q 1NTMK 1FZCA 1S1CX 3H1LJ 1XTCC 1W2BO 3AE7C 2O01H 3CC4P 3GLMA 1SFCA 2HYNA 2KLVA 1OW6A 1JY2N 3H1JG 1X9VA 2O1KA 3L70J 1ZW0A 3I5CA 4PD4D 3RK3C 3CCQP 1KB9H 2D2CB 5AW2B 1OFCX 2R3CA 3CWBE 1OW7A 1IFIA 4NPEA 5GTIH 1QGKB 2GM4A 1VQ6P 2XKMA 5EFWB 2M5AB 3W67A 5KLVG 2N1TC 3SWKA 1KYOI 4OGQC 1KTMA 1USDA 3G6EP 1FDOA 1U7JA 1PZQA 3M0DA 3H1IJ 5KLVE 1AQ5A 1HBWA 1HJBA 1VF5D 2KK7A 2QJPC 3A0BE 3HE4B 2K9JB 1X22A 3L71J 3GHGB 1SQQK 2K37A 3A0HE 1BE3J 4I7ZC 1PP9D 4N78D 4W7YA 1ZXGA 3RBXA 2J59M 1OX3A 2W6AA 2ZT9B 3WMM0 3JCUH 1RY3A 3WUVA 1VQPP 1H8AA 3L72E 3VMAA 3CPWO 3M06A 4QMAA 3V4QA 3L71D 3RL0B 1ZR2A 2I1JA 2IBZE 1L4AA 1URQD 3LW5H 3C8VA 2FYUE 1S5LE 3AE9C 3AECC 4PJ0E 5KAFE 2Y0DA 3HTKA 3CXHH 3NTNA 1URQB 3ABVC 2E76D 2PP6A 2QIWA 3B5ND 1E79H 5B5EE 1IZNB 3L74J 1NJIQ 1L0NK 1JMMA 2W6BA 3V2NA 1NHLA 3GHGA 2GA1A 1Q81Q 1A02J 3M9HA 3CL3D 1DD3A 3M9BA 1LTSC 2ZXXA 3SFEC 3AEBC 4U3FD 2W8ZA 2K9YA 5GTHH 1VF5B 2XNDH 3O6QB 1U57A 5KLIC 3TNUB 1FZEA 3MTUE 1L0LE 1SQBD 3BCCD 1LTJC 2V7QJ 1RF0A 1U7MA 3S9OA 1VQKP 1OXZA 4GOEA 1MFTA 3AE4C 2WTYA 3QH9A 2XU6A 5CCHD 1URQC 1VQ7P 1DEEG 3BATA 3H1ID 4K35A 2QJKC 3GW6A 4AQRD 1EDLA 1YQ4C 1K9MQ 2R3SA 2JKVA 2LXCB 4RJTA 2WPQA 1HH0A 2CPSA 3L75G 4LLHA 4PV1B 4WY4B 3F89A 1HWTC 1YYCA 2WSCJ 3B5NB 2P2UA 2FYUJ 5AW0B 1KYOE 2KSEA 2P58A 1SQBG 1SLQA 3BCCG 3GG2A 4U3FJ 1P84E 4Y28J 3N4XA 1Y9BA 4YPCA 5GTIE 2C9LY 3KDPB 1NTZG 3L74E 4YXWH 4ZKUA 1KILB 3CX5I 2QJPB 4EIJA 1MUUA 4H13C 3H1IG 3S4RA 3T97A 2Y9ZA 3TGUE 2IZ1A 4OGQB 1PP9E 3MIWA 3MD0A 4UB6H 1M57D 3A0BH 2E75B 2AEMA 2WQYC 2WSFJ 1GL2C 1X0TA 3M0DC 2WT7A 3OAKA 3O6QA 3TNUA 2D2CC 3B8EB 3LW5J 3U59A 3KQGA 2ZYGA 1LTAC 1IFMA 2ZJSE 2MKVA 3L70E 4N3YB 1UIIA 1FZAA 2KS1B 1SQBJ 2B87A 3BCCJ 4Y99B 1JB0J 2IDBA 3CWBJ 3EQ2A 3G3ZA 3RK2D 4H0LD 2IPPA 3L35A 2KZIA 2O3JA 1SS1A 2XV5A 3A2AA 1KC8Q 1VPCA 2Z5HA 3L4FA 5AVUB 3H1KJ 3TGUD 5H2FE 1ZOYC 1LT9C 2FXMA 2E74D 2YKOA 1T6AA 5KJ7A 1GTWA 4ZNCA 1Z56A 2ZVNB 5BU8B 1FOSF 4U3FE 2XZRA 3NFQA 4KJMA 2M8RA 2AXTH 3C9IA 2OYHB 2OTKE 1PPJD 2C9NY 2N1TD 2OGUA 5GTHE 4NPDA 1H0TB 3CLQA 1AQTA 1RF1B 2A06E 1BDDA 3CCEP 3TGUG 2VRSA 1JOCA 2NPSB 2BCCJ 2A45G 1OIPA 1IFPA 1R5SA 4IOIH 3ITKA 4IL6H 2K9JA 3GF7A 2KZJA 4WBAA 4IL6X 3H32B 1GK4A 1GL2B 3CMEP 3B5NA 2IYPA 5APVA 1P84H 5KKZC 1N7SC 3V2QA 1T8ZA 1N8RQ 1JY2O 1L0LJ 3P8CE 4OH8B 2KNCB 1JY3N 3KYQA 5CCGD 1OW8A 2LXBA 3H1KD 3E1IA 3A7OA 4XE5B 3BVHA 1LWUA 2WSSH 3I56P 1K05A 3Q2YA 1KB9E 1PFIA 5AW1B 5KAIH 2ZVOB 4K3AA 1KFMA 1LTGC 5L8RJ 2IZ0A 1M1JA 1WT6A 5C39A 3M0AA 1RE3C 5AVXB 2W90A 2RH0A 1N73C 2BCCE 2YKQA 4BXLA 2J5UA 4KT0J 3L70G 3BRTB 1VL2A 1NKZB 5AW5B 1EDIA 3VP9A 1YI2P 2Q5UA 2KUBA 3D70A 2Y9YA 3WUTA 4L75A 3AE3C 1M7LA 3PP5A 4C46A 1IK7A 4PV1D 1T3JA 1VQ9P 5APSA 3JC22 5CCHC 3G4SP 2KI7B 4HH2A 1N7SD 1LT1A 1IFJA 1J2JB 2FFDC 3HUSB 3NXSA 5TISE 3AEDC 1NU1D 2M5AA 1IC2A 4JBZA 5KLVK 1Q7YQ 2IFNA 1BE3G 1NOHA 1S4XA 4KHXA 1IO4A 1S2EA 1FDMA 4N78E 3CI9A 3P8CD 4M3LA 1J1EC 1DEBA 1GL2D 3N7NA 1LTIC 3HD7C 3L73J 2Q3EA 2KYVA 5CCGC 3CXHI 1EDKA 1FZCB 1L2PA 1KZUB 2CPBA 1FC2C 1SQPE 3AEFC 4OWFA 5APWA 4D6TD 1SQXK 1NTKE 5BVZA 5KJ7D 1GU4A 1QVFO 3VMYA 3JSVC 4DZOA 1ZV8A 5AVWB 4W7ZA 3IR9A 1PGPA 1RH5B 2LKMA 1EZVD 2FXPA 2P10A 1SQBK 2P67A 3B4SA 1N7SA 3H1LG 3OW2O 4PV1C 5AVQB 4TLFA 1SFCC 2FY8A 3F5HA 2R5DA 3KZIE 2A45I 2QJKB 4WY4A 1OMIA 4MN4C 1EQ7A 1L0LD 1SQBE 3BCCE 4ASWA 3PHLA 1VQ5P 4R4MA 5AVRB 1M90Q 4CPGA 1KYOD 2NRGA 2IBZG 2R32A 1BCCE 3MUDA 2OQQA 4JYBA 1SQVD 5AVTB 2XNXA 1VQ4P 1KILC 1JTHB 2N9YB 2BEZF 2CK3H 1NKNA 4RO0A 1QL1A 2K1AA 4C7NB 1N73A 2IFMA 1EZVE 1PV3A 1YJNP 4W80A 1AJYA 2FYNB 1UIXA 4JF7A 1L0LG 1NTZE 2J58A 1HVVA 3L74G 5APTA 4EOTA 1EXJA 1FOSE 1T2KC 1M1KQ 3AEGC 5CJ4A 1KN7A 1IFNA 3E7KA 3P8MC 3ZDMA 1L4AC 1KQGB 1P84I 1SQPD 2C0XA 4PD4H 3TDKA 4A7PA 3CCVP 1WRGA 4WWIA 1QX8A 4AUWA 2FFDA 2W83C 2XDJA 1Q90D 2KLUA 4DCKA 5B66E 4IL6E 4N6JA 1VF5C 2FBWC 1KILD 1FAVA 1FJKA 2E5YA 3WU2H 2YIUC 1GK6A 1EXIA 3TGUJ 1X8YA 1SQXJ 3R4YA 1JY2P 1PP9G 1X79B 1G1JA 1W5CE 5AW8B 1DIPA 1S9KE 3CC2P 1LTJA 1N7LA 2HFED 2WPSA 1PGQA 1PGJA 5APUA 3KXDA 2O1JA 3GF3A 2OYHC 2Z5IA 1OVUA 1GMJA 3V6IA 4L74A 1N73B 2E74C 2POHA 2QVAA 5DJTB 3RK3D 1E5WA 2AXTE 2IYOA 2KOGA 3P7KA 2YNYA 1OZHA 2JDIH 3FXDA 1KV4A 2WSEJ 1KILE 5KAIE 4H0LC 2JWAA 2FYUK 4IFMA 3CWBG 5KTBA 5AW9B 2RMZA 2I8DA 1CI6B 2W27A 3TYYA 1VQLP 2WT7B 4WY4C 1SQPJ 1JEKA 1SQVJ 2E76B 2JJLA 2JO1A 1NTKJ 1W2EA 4JYCA 1MZ9A 1RE4C 4LGDE 5AVZB 3RGUA 3WUUA 1IJDB 3TF5A 5KKZB 1KD1Q 3VMZA 3MUDC 3RL0D 4H44B 3MHVA 4GOFA 1KILA 2JWDA 5E79H 1LTTC 5CBOA 1QLED 1ZP0C 4UB6E 3CWBD 5KLIB 1YJWP 1SQXG 2HPCA 3OJAB 5E79E 3CCLP 1NO4A 1M1JB 5AW3B 2Q3IA 1YHQP 3H1HE 2GUSA 2FYUG 3PRJA 2YKPA 3A0HH 2QE7H 5AW7B 1L0NJ 1K04A 1FE6A 4L73A 5BU5A 2Q6QA 1JNMA 2G8YA 1M56D 1FDIA 1LT9A 5KJ7C 1AA0A 3RK3E 5CMZA 1K73Q 4XFJA 5AW4B 4BRYA 1SQXD 1FZFA 2WZ7A 2A45H 1H89A 2D2CD 2BCCG 2NPSA 3M9QA 5TISH 3A3YB 1VQNP 2FYUD 1ZN5A 2AEFA 3CX5E 3CCSP 1VQMP 1H88A 3AE6C 2Q9IA 3BRVB 3H1JD 1H0TA 2FYZA 1NU1J 1Y8AA 1ZLLA 3L75E 3AE2C 2P1JA 3KZIH 5APQA 3PLNA 3Q1MA 4Y99C 1JY3P 2M3EA 3SWFA 1RF1A 3VYIA 4DOJA 1L4AB 2H89C 5CBNA 3CCJP 1RQVA 1EZVI 2JEEA 4U7JA 5TJHA 5B66H 3V5BA 3Q5PA 2ITAA 1SQXE 3AE5C 2E76C 2IBZI 3L73D 2YMYA 4B86A 1KQLA 1YTZI 1DX7A 1GW3A 4UB8E 1LGHB 1PPJG 3VN0A 1NTKD 1SQQG 2PFXA 1NTMJ 3G71P 1JCCA 3H1HD 3FX0A 2QJYB 1T2KD 2O01N 4XA4A 2WVRA 4R4LA 3AE1C 2M0BA 2KNCA 2QJYC 3L71G 3TSIA 4ZKPA 4IFDK 1SQPK 1KORA 1NGMB 1HGVA 3L73G 2PRRA 3HD7B 4PJ0H 2QEXP 2N1TA 2KXPB 4JPZB 2V7QH 5APXA 3CMAP 1ZRTE 1NU1E 1NAYA 2Y0CA 4BWNA 1D7MA 3L73E 2SPZA 1BCCG 3V2PA 4EI2A 1NTKG 1SQQD 2Y0EA 3Q3DA 3H1HG 2Z4EA 3RL0C 3R2PA 1QEXA 2PAJA 2OARA 4U3FG 1KB9I 1LTJB 1NTMG 1SQVE 2ZYAA 3H32A 3PJSK 2FFDB 1FBMA 2ZFCA 1IK9A 1NYHA 3KPEA 2W6JH 3M91A 4I1LA 4Z1MH 1RHZB 3L37A 3H1KG 1PPJE 2KP8A 3KHUA 1DH3A 2OYIA 3AEAC 3H6PA 1QL2A 1SQVK 2B89A 4HYTB 3CX5D 3EWKA 1KMIZ 2R44A 4I2LC 2KB7P 1BCCD 4GIFA 2AEJA 3TK1A 1SVFA 3FWNA 4BRYB 1MKMA 5H2FH 2ZYDA 3L75D 1DD4A 2HG5D 1YJ9P 1NTMD 3H1HJ 1AFOA 1ZMEC 2E43A
chains in the Genus database with same CATH topology
1H0TB 1EC5A 5K5GB 1LP1B 1BDDA 1Y47A 4EYYQ 2Q1KA 3MZWB 1OVUA 4IOIH 2QVAA 5DJTB 3QWOC 1EDJA 2KZJA 2RKLA 3FXDA 2B87B 2WMMA 1Q2NA 2I8DA 4ASVA 2K3RA 1ZW0A 2LXBA 3RGUA 4NPEA 5EFWB 3S1KA 2M5AB 4K3AA 3MHVA 4GOFA 2JWDA 1U7JA 1OVVA 5C39A 4HKZH 5CBOA 1NVOA 4BXLA 1ZXGA 1EDIA 5DJUB 2KUBA 2UWJE 2KI7B 1LT1A 2HR3A 4GODA 2M5AA 4JBZA 2LR2A 3PH0A 3ZDMA 1H0TA 1U7MA 1EDKA 4GOEA 1MFTA 1FC2C 2QRXA 5CBNA 2B88A 1LP1A 1DEEG 4K35A 1EDLA 2LXCB 1OVRA 2P58A 1S3JA 3FXEA 2M0BA 4MN4C 4ASWA 4HJGH 4CPGA 4ZMDA 1JM0A 1X0TA 2SPZA 4HB1A 1BDCA 2KIKA 2KS1B 2B87A 2KZIA 1SS1A 2ZAEB 1JMBA 2B89A 4NPFX 2R44A 4WWIA 4ZNCA 4KJMA 2OTKE 4NPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0T B;  1EC5 A;  5K5G B;  1LP1 B;  1BDD A;  1Y47 A;  4EYY Q;  2Q1K A;  3MZW B;  1OVU A;  4IOI H;  2QVA A;  5DJT B;  3QWO C;  1EDJ A;  2KZJ A;  2RKL A;  3FXD A;  2B87 B;  2WMM A;  1Q2N A;  2I8D A;  4ASV A;  2K3R A;  1ZW0 A;  2LXB A;  3RGU A;  4NPE A;  5EFW B;  3S1K A;  2M5A B;  4K3A A;  3MHV A;  4GOF A;  2JWD A;  1U7J A;  1OVV A;  5C39 A;  4HKZ H;  5CBO A;  1NVO A;  4BXL A;  1ZXG A;  1EDI A;  5DJU B;  2KUB A;  2UWJ E;  2KI7 B;  1LT1 A;  2HR3 A;  4GOD A;  2M5A A;  4JBZ A;  2LR2 A;  3PH0 A;  3ZDM A;  1H0T A;  1U7M A;  1EDK A;  4GOE A;  1MFT A;  1FC2 C;  2QRX A;  5CBN A;  2B88 A;  1LP1 A;  1DEE G;  4K35 A;  1EDL A;  2LXC B;  1OVR A;  2P58 A;  1S3J A;  3FXE A;  2M0B A;  4MN4 C;  4ASW A;  4HJG H;  4CPG A;  4ZMD A;  1JM0 A;  1X0T A;  2SPZ A;  4HB1 A;  1BDC A;  2KIK A;  2KS1 B;  2B87 A;  2KZI A;  1SS1 A;  2ZAE B;  1JMB A;  2B89 A;  4NPF X;  2R44 A;  4WWI A;  4ZNC A;  4KJM A;  2OTK E;  4NPD A; 
#chains in the Genus database with same CATH topology
 2BAS A;  2FYN C;  2YMK A;  1BCC J;  1EC5 A;  2ZXE B;  2WSF H;  1LT9 B;  3B71 A;  3IN6 A;  1KQF B;  1G1I A;  3RK3 B;  4C7N A;  1NTZ D;  1CZQ A;  1TU3 F;  1YQ3 C;  2WWW A;  4LC1 A;  1AVO A;  4D6T J;  3CC7 P;  1BGY J;  3L72 D;  2YIU B;  2H88 C;  3HD7 A;  1WMK A;  1PGO A;  1RF0 C;  3LID A;  3V2R A;  1YTZ T;  5CCG A;  2L91 A;  1CW5 A;  3MZW B;  5AVV B;  1RF1 C;  1MV8 A;  1NTZ J;  1ZR4 A;  5CJ0 A;  3QWO C;  5AVS B;  3VOP A;  3H25 A;  1BGY D;  3L72 J;  3FWL A;  4AYC A;  1KYO H;  4I6M C;  1QVG O;  2B87 B;  2WMM A;  4WVZ A;  1L0N G;  2H43 A;  4RES B;  1BSH A;  3L75 J;  3SSU A;  4O9B A;  3T97 B;  1FU1 A;  1KB9 D;  3L72 G;  1HTL C;  1LTB C;  2YO2 A;  2HOD B;  1Q2N A;  4GKG A;  2E42 A;  4ASV A;  2K3R A;  3NMD A;  1S9K D;  3RK2 C;  3HE4 A;  3IAO A;  1NU1 K;  1JO5 A;  1NAF A;  1CI6 A;  4L76 A;  3D6Z A;  1VQO P;  3RBZ A;  4EYY Q;  3S1K A;  1N86 A;  1BGY G;  3O8Z A;  1IFD A;  2Q7C A;  4D6T G;  3CCU P;  1GZL A;  3FGA D;  3HD7 D;  1OVV A;  1L0N D;  2C0W A;  3II6 A;  1GL2 A;  4H13 D;  1BGY E;  1G2C A;  2E74 B;  4HKZ H;  1GU5 A;  1J1D C;  1HJ0 A;  1NTM E;  1NVO A;  1R5L A;  1G2C B;  3H1L D;  2IX7 C;  1YIJ P;  3H1J J;  1FS0 E;  1VQ8 P;  3CX5 H;  2NZ2 A;  5DJU B;  3U1C A;  1MFZ A;  2QSI A;  2DW3 A;  2O01 J;  4H13 B;  1JY3 O;  3L36 A;  2RN0 A;  2OYI C;  2R5B A;  3K5B A;  2UWJ E;  3H1I E;  2G3A A;  2HR3 A;  4GDO A;  3WU2 E;  1YIT P;  3VMX A;  3CD6 P;  4GOD A;  3HUS A;  1BE3 E;  1SP4 A;  1YBK A;  1S72 P;  1JUN A;  3HTK B;  4OGQ D;  1Q82 Q;  2JP3 A;  3AE8 C;  2I1K A;  2LR2 A;  1LNQ A;  3HRN A;  4GT1 A;  2B9B A;  3PH0 A;  5B5E H;  1NWQ A;  3JCU E;  2QM7 A;  1PP9 J;  2P7J A;  2MJZ A;  1NTK K;  2HOD A;  1PL5 A;  3L74 D;  3U1A A;  2WSE H;  4EDF A;  3AEE C;  3BAS A;  1A02 F;  3I55 P;  2OYH A;  3P32 A;  4RKU J;  2OTL P;  3G9R A;  1SFC D;  1L0L K;  2HLO A;  2QRX A;  5AVY B;  1S5L X;  1SQP G;  2B88 A;  1LP1 A;  1NH4 A;  2FXO A;  3H1J E;  4TT3 H;  2KSJ A;  1USE A;  1L0N E;  2QM8 A;  4OVN F;  1N2D C;  3C1L A;  1SQQ J;  4IFF A;  3RK2 B;  1JTH A;  2JR8 A;  1CSB A;  3B5N C;  1GW4 A;  5AW6 B;  1FZC C;  1OVR A;  3L70 D;  4PD4 I;  1LWU B;  5M1B A;  4D6T E;  1N7S B;  4C7R A;  1GD2 E;  1S3J A;  2L5G B;  2QG4 A;  3FXE A;  1J1E B;  4WB4 A;  3RL0 g;  1AV1 A;  1T3U A;  2E75 C;  1J1D B;  1SFC B;  1HF9 A;  1RE4 A;  1FZB A;  1LWU C;  2A06 G;  3EFF K;  4HJG H;  4ZMD A;  2AXC A;  4H44 D;  1M1J C;  1NU1 G;  2NPS D;  2V4H A;  4I7Z B;  1BE3 D;  2YXR B;  1JM0 A;  3MP7 B;  1RE3 A;  3EFG A;  3IF4 A;  3SWY A;  2OYI B;  3E1R A;  1JCD A;  1OWA A;  4HB1 A;  1K8A Q;  1HUC A;  2H7H A;  2M3B A;  1BDC A;  3IFM A;  5APY A;  2KIK A;  2YXQ B;  2E5T A;  2OTJ P;  2K88 A;  1FJP A;  2N1T B;  4WY4 D;  1ZRT D;  2N9B A;  2WPV B;  2A06 D;  1M8O B;  1PIX A;  2YO3 A;  2BEQ D;  2ZT9 D;  4PD4 E;  2ZAE B;  1SQQ E;  2WPR A;  1XTG B;  1S5L H;  5KAF H;  3D71 A;  2QA4 P;  3H1L E;  3CCR P;  3HE5 A;  1JMB A;  2GUV A;  5CHX A;  5CCH A;  4NPF X;  3D6Y A;  1AVY A;  3Q5S A;  1R8E A;  3HUS C;  3V4W A;  1EZV G;  2NPS C;  3CXH E;  3PTZ A;  3LIE A;  4H0L B;  3Q5R A;  3W68 A;  3GHG C;  3A5T A;  3CCM P;  1KQS O;  1HGZ A;  4UB8 H;  2FKW B;  3VTP C;  4YTP C;  3UIA A;  2HPC B;  5K5G B;  1LP1 B;  2OYO A;  4H44 C;  3H1K E;  2PGD A;  4JQ0 D;  5KLV J;  1Y47 A;  2KS1 A;  2E75 D;  3MGN A;  2H8P D;  2Q1K A;  3L71 E;  2WSC H;  4DJG A;  4YXD C;  2IBZ D;  1BSN A;  1VDF A;  1SQV G;  3HE5 B;  1L4A D;  1URQ A;  3VP8 A;  1RQU A;  4DT0 A;  1FZG A;  1GDT A;  1NTZ K;  1KFN A;  1LJ2 A;  1P84 D;  3GMA A;  1EDJ A;  2RKL A;  3OA7 A;  5KLV D;  3SFD C;  2WIT A;  3USS A;  3CXH D;  2ZT9 C;  2BCC D;  1Q86 Q;  1NTM K;  1FZC A;  1S1C X;  3H1L J;  1XTC C;  1W2B O;  3AE7 C;  2O01 H;  3CC4 P;  3GLM A;  1SFC A;  2HYN A;  2KLV A;  1OW6 A;  1JY2 N;  3H1J G;  1X9V A;  2O1K A;  3L70 J;  1ZW0 A;  3I5C A;  4PD4 D;  3RK3 C;  3CCQ P;  1KB9 H;  2D2C B;  5AW2 B;  1OFC X;  2R3C A;  3CWB E;  1OW7 A;  1IFI A;  4NPE A;  5GTI H;  1QGK B;  2GM4 A;  1VQ6 P;  2XKM A;  5EFW B;  2M5A B;  3W67 A;  5KLV G;  2N1T C;  3SWK A;  1KYO I;  4OGQ C;  1KTM A;  1USD A;  3G6E P;  1FDO A;  1U7J A;  1PZQ A;  3M0D A;  3H1I J;  5KLV E;  1AQ5 A;  1HBW A;  1HJB A;  1VF5 D;  2KK7 A;  2QJP C;  3A0B E;  3HE4 B;  2K9J B;  1X22 A;  3L71 J;  3GHG B;  1SQQ K;  2K37 A;  3A0H E;  1BE3 J;  4I7Z C;  1PP9 D;  4N78 D;  4W7Y A;  1ZXG A;  3RBX A;  2J59 M;  1OX3 A;  2W6A A;  2ZT9 B;  3WMM 0;  3JCU H;  1RY3 A;  3WUV A;  1VQP P;  1H8A A;  3L72 E;  3VMA A;  3CPW O;  3M06 A;  4QMA A;  3V4Q A;  3L71 D;  3RL0 B;  1ZR2 A;  2I1J A;  2IBZ E;  1L4A A;  1URQ D;  3LW5 H;  3C8V A;  2FYU E;  1S5L E;  3AE9 C;  3AEC C;  4PJ0 E;  5KAF E;  2Y0D A;  3HTK A;  3CXH H;  3NTN A;  1URQ B;  3ABV C;  2E76 D;  2PP6 A;  2QIW A;  3B5N D;  1E79 H;  5B5E E;  1IZN B;  3L74 J;  1NJI Q;  1L0N K;  1JMM A;  2W6B A;  3V2N A;  1NHL A;  3GHG A;  2GA1 A;  1Q81 Q;  1A02 J;  3M9H A;  3CL3 D;  1DD3 A;  3M9B A;  1LTS C;  2ZXX A;  3SFE C;  3AEB C;  4U3F D;  2W8Z A;  2K9Y A;  5GTH H;  1VF5 B;  2XND H;  3O6Q B;  1U57 A;  5KLI C;  3TNU B;  1FZE A;  3MTU E;  1L0L E;  1SQB D;  3BCC D;  1LTJ C;  2V7Q J;  1RF0 A;  1U7M A;  3S9O A;  1VQK P;  1OXZ A;  4GOE A;  1MFT A;  3AE4 C;  2WTY A;  3QH9 A;  2XU6 A;  5CCH D;  1URQ C;  1VQ7 P;  1DEE G;  3BAT A;  3H1I D;  4K35 A;  2QJK C;  3GW6 A;  4AQR D;  1EDL A;  1YQ4 C;  1K9M Q;  2R3S A;  2JKV A;  2LXC B;  4RJT A;  2WPQ A;  1HH0 A;  2CPS A;  3L75 G;  4LLH A;  4PV1 B;  4WY4 B;  3F89 A;  1HWT C;  1YYC A;  2WSC J;  3B5N B;  2P2U A;  2FYU J;  5AW0 B;  1KYO E;  2KSE A;  2P58 A;  1SQB G;  1SLQ A;  3BCC G;  3GG2 A;  4U3F J;  1P84 E;  4Y28 J;  3N4X A;  1Y9B A;  4YPC A;  5GTI E;  2C9L Y;  3KDP B;  1NTZ G;  3L74 E;  4YXW H;  4ZKU A;  1KIL B;  3CX5 I;  2QJP B;  4EIJ A;  1MUU A;  4H13 C;  3H1I G;  3S4R A;  3T97 A;  2Y9Z A;  3TGU E;  2IZ1 A;  4OGQ B;  1PP9 E;  3MIW A;  3MD0 A;  4UB6 H;  1M57 D;  3A0B H;  2E75 B;  2AEM A;  2WQY C;  2WSF J;  1GL2 C;  1X0T A;  3M0D C;  2WT7 A;  3OAK A;  3O6Q A;  3TNU A;  2D2C C;  3B8E B;  3LW5 J;  3U59 A;  3KQG A;  2ZYG A;  1LTA C;  1IFM A;  2ZJS E;  2MKV A;  3L70 E;  4N3Y B;  1UII A;  1FZA A;  2KS1 B;  1SQB J;  2B87 A;  3BCC J;  4Y99 B;  1JB0 J;  2IDB A;  3CWB J;  3EQ2 A;  3G3Z A;  3RK2 D;  4H0L D;  2IPP A;  3L35 A;  2KZI A;  2O3J A;  1SS1 A;  2XV5 A;  3A2A A;  1KC8 Q;  1VPC A;  2Z5H A;  3L4F A;  5AVU B;  3H1K J;  3TGU D;  5H2F E;  1ZOY C;  1LT9 C;  2FXM A;  2E74 D;  2YKO A;  1T6A A;  5KJ7 A;  1GTW A;  4ZNC A;  1Z56 A;  2ZVN B;  5BU8 B;  1FOS F;  4U3F E;  2XZR A;  3NFQ A;  4KJM A;  2M8R A;  2AXT H;  3C9I A;  2OYH B;  2OTK E;  1PPJ D;  2C9N Y;  2N1T D;  2OGU A;  5GTH E;  4NPD A;  1H0T B;  3CLQ A;  1AQT A;  1RF1 B;  2A06 E;  1BDD A;  3CCE P;  3TGU G;  2VRS A;  1JOC A;  2NPS B;  2BCC J;  2A45 G;  1OIP A;  1IFP A;  1R5S A;  4IOI H;  3ITK A;  4IL6 H;  2K9J A;  3GF7 A;  2KZJ A;  4WBA A;  4IL6 X;  3H32 B;  1GK4 A;  1GL2 B;  3CME P;  3B5N A;  2IYP A;  5APV A;  1P84 H;  5KKZ C;  1N7S C;  3V2Q A;  1T8Z A;  1N8R Q;  1JY2 O;  1L0L J;  3P8C E;  4OH8 B;  2KNC B;  1JY3 N;  3KYQ A;  5CCG D;  1OW8 A;  2LXB A;  3H1K D;  3E1I A;  3A7O A;  4XE5 B;  3BVH A;  1LWU A;  2WSS H;  3I56 P;  1K05 A;  3Q2Y A;  1KB9 E;  1PFI A;  5AW1 B;  5KAI H;  2ZVO B;  4K3A A;  1KFM A;  1LTG C;  5L8R J;  2IZ0 A;  1M1J A;  1WT6 A;  5C39 A;  3M0A A;  1RE3 C;  5AVX B;  2W90 A;  2RH0 A;  1N73 C;  2BCC E;  2YKQ A;  4BXL A;  2J5U A;  4KT0 J;  3L70 G;  3BRT B;  1VL2 A;  1NKZ B;  5AW5 B;  1EDI A;  3VP9 A;  1YI2 P;  2Q5U A;  2KUB A;  3D70 A;  2Y9Y A;  3WUT A;  4L75 A;  3AE3 C;  1M7L A;  3PP5 A;  4C46 A;  1IK7 A;  4PV1 D;  1T3J A;  1VQ9 P;  5APS A;  3JC2 2;  5CCH C;  3G4S P;  2KI7 B;  4HH2 A;  1N7S D;  1LT1 A;  1IFJ A;  1J2J B;  2FFD C;  3HUS B;  3NXS A;  5TIS E;  3AED C;  1NU1 D;  2M5A A;  1IC2 A;  4JBZ A;  5KLV K;  1Q7Y Q;  2IFN A;  1BE3 G;  1NOH A;  1S4X A;  4KHX A;  1IO4 A;  1S2E A;  1FDM A;  4N78 E;  3CI9 A;  3P8C D;  4M3L A;  1J1E C;  1DEB A;  1GL2 D;  3N7N A;  1LTI C;  3HD7 C;  3L73 J;  2Q3E A;  2KYV A;  5CCG C;  3CXH I;  1EDK A;  1FZC B;  1L2P A;  1KZU B;  2CPB A;  1FC2 C;  1SQP E;  3AEF C;  4OWF A;  5APW A;  4D6T D;  1SQX K;  1NTK E;  5BVZ A;  5KJ7 D;  1GU4 A;  1QVF O;  3VMY A;  3JSV C;  4DZO A;  1ZV8 A;  5AVW B;  4W7Z A;  3IR9 A;  1PGP A;  1RH5 B;  2LKM A;  1EZV D;  2FXP A;  2P10 A;  1SQB K;  2P67 A;  3B4S A;  1N7S A;  3H1L G;  3OW2 O;  4PV1 C;  5AVQ B;  4TLF A;  1SFC C;  2FY8 A;  3F5H A;  2R5D A;  3KZI E;  2A45 I;  2QJK B;  4WY4 A;  1OMI A;  4MN4 C;  1EQ7 A;  1L0L D;  1SQB E;  3BCC E;  4ASW A;  3PHL A;  1VQ5 P;  4R4M A;  5AVR B;  1M90 Q;  4CPG A;  1KYO D;  2NRG A;  2IBZ G;  2R32 A;  1BCC E;  3MUD A;  2OQQ A;  4JYB A;  1SQV D;  5AVT B;  2XNX A;  1VQ4 P;  1KIL C;  1JTH B;  2N9Y B;  2BEZ F;  2CK3 H;  1NKN A;  4RO0 A;  1QL1 A;  2K1A A;  4C7N B;  1N73 A;  2IFM A;  1EZV E;  1PV3 A;  1YJN P;  4W80 A;  1AJY A;  2FYN B;  1UIX A;  4JF7 A;  1L0L G;  1NTZ E;  2J58 A;  1HVV A;  3L74 G;  5APT A;  4EOT A;  1EXJ A;  1FOS E;  1T2K C;  1M1K Q;  3AEG C;  5CJ4 A;  1KN7 A;  1IFN A;  3E7K A;  3P8M C;  3ZDM A;  1L4A C;  1KQG B;  1P84 I;  1SQP D;  2C0X A;  4PD4 H;  3TDK A;  4A7P A;  3CCV P;  1WRG A;  4WWI A;  1QX8 A;  4AUW A;  2FFD A;  2W83 C;  2XDJ A;  1Q90 D;  2KLU A;  4DCK A;  5B66 E;  4IL6 E;  4N6J A;  1VF5 C;  2FBW C;  1KIL D;  1FAV A;  1FJK A;  2E5Y A;  3WU2 H;  2YIU C;  1GK6 A;  1EXI A;  3TGU J;  1X8Y A;  1SQX J;  3R4Y A;  1JY2 P;  1PP9 G;  1X79 B;  1G1J A;  1W5C E;  5AW8 B;  1DIP A;  1S9K E;  3CC2 P;  1LTJ A;  1N7L A;  2HFE D;  2WPS A;  1PGQ A;  1PGJ A;  5APU A;  3KXD A;  2O1J A;  3GF3 A;  2OYH C;  2Z5I A;  1OVU A;  1GMJ A;  3V6I A;  4L74 A;  1N73 B;  2E74 C;  2POH A;  2QVA A;  5DJT B;  3RK3 D;  1E5W A;  2AXT E;  2IYO A;  2KOG A;  3P7K A;  2YNY A;  1OZH A;  2JDI H;  3FXD A;  1KV4 A;  2WSE J;  1KIL E;  5KAI E;  4H0L C;  2JWA A;  2FYU K;  4IFM A;  3CWB G;  5KTB A;  5AW9 B;  2RMZ A;  2I8D A;  1CI6 B;  2W27 A;  3TYY A;  1VQL P;  2WT7 B;  4WY4 C;  1SQP J;  1JEK A;  1SQV J;  2E76 B;  2JJL A;  2JO1 A;  1NTK J;  1W2E A;  4JYC A;  1MZ9 A;  1RE4 C;  4LGD E;  5AVZ B;  3RGU A;  3WUU A;  1IJD B;  3TF5 A;  5KKZ B;  1KD1 Q;  3VMZ A;  3MUD C;  3RL0 D;  4H44 B;  3MHV A;  4GOF A;  1KIL A;  2JWD A;  5E79 H;  1LTT C;  5CBO A;  1QLE D;  1ZP0 C;  4UB6 E;  3CWB D;  5KLI B;  1YJW P;  1SQX G;  2HPC A;  3OJA B;  5E79 E;  3CCL P;  1NO4 A;  1M1J B;  5AW3 B;  2Q3I A;  1YHQ P;  3H1H E;  2GUS A;  2FYU G;  3PRJ A;  2YKP A;  3A0H H;  2QE7 H;  5AW7 B;  1L0N J;  1K04 A;  1FE6 A;  4L73 A;  5BU5 A;  2Q6Q A;  1JNM A;  2G8Y A;  1M56 D;  1FDI A;  1LT9 A;  5KJ7 C;  1AA0 A;  3RK3 E;  5CMZ A;  1K73 Q;  4XFJ A;  5AW4 B;  4BRY A;  1SQX D;  1FZF A;  2WZ7 A;  2A45 H;  1H89 A;  2D2C D;  2BCC G;  2NPS A;  3M9Q A;  5TIS H;  3A3Y B;  1VQN P;  2FYU D;  1ZN5 A;  2AEF A;  3CX5 E;  3CCS P;  1VQM P;  1H88 A;  3AE6 C;  2Q9I A;  3BRV B;  3H1J D;  1H0T A;  2FYZ A;  1NU1 J;  1Y8A A;  1ZLL A;  3L75 E;  3AE2 C;  2P1J A;  3KZI H;  5APQ A;  3PLN A;  3Q1M A;  4Y99 C;  1JY3 P;  2M3E A;  3SWF A;  1RF1 A;  3VYI A;  4DOJ A;  1L4A B;  2H89 C;  5CBN A;  3CCJ P;  1RQV A;  1EZV I;  2JEE A;  4U7J A;  5TJH A;  5B66 H;  3V5B A;  3Q5P A;  2ITA A;  1SQX E;  3AE5 C;  2E76 C;  2IBZ I;  3L73 D;  2YMY A;  4B86 A;  1KQL A;  1YTZ I;  1DX7 A;  1GW3 A;  4UB8 E;  1LGH B;  1PPJ G;  3VN0 A;  1NTK D;  1SQQ G;  2PFX A;  1NTM J;  3G71 P;  1JCC A;  3H1H D;  3FX0 A;  2QJY B;  1T2K D;  2O01 N;  4XA4 A;  2WVR A;  4R4L A;  3AE1 C;  2M0B A;  2KNC A;  2QJY C;  3L71 G;  3TSI A;  4ZKP A;  4IFD K;  1SQP K;  1KOR A;  1NGM B;  1HGV A;  3L73 G;  2PRR A;  3HD7 B;  4PJ0 H;  2QEX P;  2N1T A;  2KXP B;  4JPZ B;  2V7Q H;  5APX A;  3CMA P;  1ZRT E;  1NU1 E;  1NAY A;  2Y0C A;  4BWN A;  1D7M A;  3L73 E;  2SPZ A;  1BCC G;  3V2P A;  4EI2 A;  1NTK G;  1SQQ D;  2Y0E A;  3Q3D A;  3H1H G;  2Z4E A;  3RL0 C;  3R2P A;  1QEX A;  2PAJ A;  2OAR A;  4U3F G;  1KB9 I;  1LTJ B;  1NTM G;  1SQV E;  2ZYA A;  3H32 A;  3PJS K;  2FFD B;  1FBM A;  2ZFC A;  1IK9 A;  1NYH A;  3KPE A;  2W6J H;  3M91 A;  4I1L A;  4Z1M H;  1RHZ B;  3L37 A;  3H1K G;  1PPJ E;  2KP8 A;  3KHU A;  1DH3 A;  2OYI A;  3AEA C;  3H6P A;  1QL2 A;  1SQV K;  2B89 A;  4HYT B;  3CX5 D;  3EWK A;  1KMI Z;  2R44 A;  4I2L C;  2KB7 P;  1BCC D;  4GIF A;  2AEJ A;  3TK1 A;  1SVF A;  3FWN A;  4BRY B;  1MKM A;  5H2F H;  2ZYD A;  3L75 D;  1DD4 A;  2HG5 D;  1YJ9 P;  1NTM D;  3H1H J;  1AFO A;  1ZME C;  2E43 A; 
#chains in the Genus database with same CATH homology
 1H0T B;  1EC5 A;  5K5G B;  1LP1 B;  1BDD A;  1Y47 A;  4EYY Q;  2Q1K A;  3MZW B;  1OVU A;  4IOI H;  2QVA A;  5DJT B;  3QWO C;  1EDJ A;  2KZJ A;  2RKL A;  3FXD A;  2B87 B;  2WMM A;  1Q2N A;  2I8D A;  4ASV A;  2K3R A;  1ZW0 A;  2LXB A;  3RGU A;  4NPE A;  5EFW B;  3S1K A;  2M5A B;  4K3A A;  3MHV A;  4GOF A;  2JWD A;  1U7J A;  1OVV A;  5C39 A;  4HKZ H;  5CBO A;  1NVO A;  4BXL A;  1ZXG A;  1EDI A;  5DJU B;  2KUB A;  2UWJ E;  2KI7 B;  1LT1 A;  2HR3 A;  4GOD A;  2M5A A;  4JBZ A;  2LR2 A;  3PH0 A;  3ZDM A;  1H0T A;  1U7M A;  1EDK A;  4GOE A;  1MFT A;  1FC2 C;  2QRX A;  5CBN A;  2B88 A;  1LP1 A;  1DEE G;  4K35 A;  1EDL A;  2LXC B;  1OVR A;  2P58 A;  1S3J A;  3FXE A;  2M0B A;  4MN4 C;  4ASW A;  4HJG H;  4CPG A;  4ZMD A;  1JM0 A;  1X0T A;  2SPZ A;  4HB1 A;  1BDC A;  2KIK A;  2KS1 B;  2B87 A;  2KZI A;  1SS1 A;  2ZAE B;  1JMB A;  2B89 A;  4NPF X;  2R44 A;  4WWI A;  4ZNC A;  4KJM A;  2OTK E;  4NPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...