1ZW3A

Vinculin head (0-258) in complex with the talin rod residues 1630-1652
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
251
structure length
251
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Vinculin
total genus 108
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw3A01
4E18A 1TR2A 1ZVZA 1RKEB 5L0HA 4E17A 4DJ9A 1XWJA 5FZTA 2HSQA 1DOVA 1SYQA 4K1OA 4PR9A 3RF3A 1U89A 1U6HA 1H6GA 5L0CA 1ST6A 1DOWA 2IBFA 5L0FA 3H2UA 3TJ5A 5L0JA 1YDIA 2X0CA 5L0DA 4W8PA 4ONSA 2L7AA 3H2VA 1RKEA 4IGGA 5L0GA 5L0IA 3S90A 1T01A 3T6GB 1QKRA 4P9TA 3VF0A 4EHPA 1RKCA 1ZW2A 1L7CA 2B0HA 2GWWA 2LQGA 3MYIA 3ZDLA 2GDCA 1ZW3A 3TJ6A
chains in the Genus database with same CATH superfamily
4BJ1A 2A68F 3JRMO 4ULWA 2EPNA 4O6NA 1LS1A 1WN0A 1ZYRF 4IARA 2HFIA 3AG3C 2CGEA 4JIOA 4E0IA 3ZSUA 2PNOA 3B0PA 4DVYP 4CSAC 4I1OB 4G7ZF 4R32A 4WGZA 2IYLD 3LS0A 3U5SA 2QLAA 3EH1A 4JE9A 3DI5A 4OIPF 1RMVA 3JSZA 1IW7F 4JTCB 3DXJF 4JRZA 5JRAA 1YLMA 1ZZPA 2CNWA 2J7PD 3L8IA 3WHNA 1JPNA 1M2OA 4B6IA 2XL4A 3CQZA 2IXMA 3GEHA 3Q6MA 1LIHA 1OXBA 4XPXA 4U5HA 2LD6A 2PP4A 3K1IA 3AG1C 1FFTC 4U5GA 1D0YA 4N4WA 2J0XA 4ZLCA 3EG9A 1H9TA 1NBBA 2WVQA 3V7OA 5DS6A 2XM0A 1OQCA 2YZSA 1RXQA 2YEVA 1Z23A 4P9FA 2G62A 2DI3A 3E70C 4J32B 2ZPAA 2KC3A 3DAGA 1CPRA 3JRTA 2VC9A 3B0UX 2LK4A 4YK5A 2HMQA 5TJ5E 1Z6AA 2Y39A 1LI7A 2PF4E 2QNLA 5A6BD 1RCPA 2R9RB 1QVXA 5D91A 2YL1A 1RJ9B 4N6CA 3LNMB 1E85A 3J06A 3DAFA 2DGJA 5E3AA 1UFBA 2HSBA 3EZIA 4I44A 4JEBA 5E33A 1JRAA 3ABKC 3EQLF 2XRHA 2A6EF 4U5FE 3NYMA 3LUTB 1O3UA 2FAPB 1TWGA 3KKBA 1Q0KA 4MS2A 1TQGA 1GM5A 1B68A 4AE4B 2MHRA 1FR0A 2OJED 3VYWA 2X51A 3NKDA 2CYDA 3K7DA 4AL1A 2UUHA 3K1IC 1V55C 3PCVA 3X1OA 3EGXB 4E7ZA 2EPMX 1A7DA 2OQMA 4IAOA 2BL2A 3H2UA 2AP3A 3TJ5A 1GQAA 4G0HA 1WTYA 3A9CA 3IQ6A 2A0UA 3EJNA 2XLDA 3FXHA 1T5OA 1MMDA 3AJMA 2QY9A 3DJNB 2XS1A 1ORSC 1TFOB 2KW3C 2W4MA 1RKEA 3I4UA 2J9UA 3MLGA 4LLEA 5CI8A 2I15A 1E83A 2J46A 2LCHA 1LPEA 4P9TA 3GANA 3IQ5A 3KH2A 4RBNA 4C3EA 4MVUA 4XPWA 2VCCA 2Q3TA 3I5PA 3DD7A 1D0XA 3JTLO 2EIKC 2XLHA 4W8KA 2HMZA 3W4YA 2Z15A 3DE9A 4KNVA 4O6YA 5L3QA 4DRHB 3S0XA 3S27A 1EI7A 4O79A 4JKVA 4QI2A 2A0BA 3DKAA 2XL8A 2VH3A 1VYIA 2YLDA 1K40A 2ICWG 1OR2A 3AG4C 4F4BA 2EIJC 1YYJA 3KYIA 1O87A 2M64A 1F1MA 4C7OA 3QVYA 4MVRA 3SEOA 3O10A 2WZFA 3C18A 1UG7A 2JX0A 3LS1A 3U0CA 1V4AA 3BRJA 4CS9C 4G78A 5KYYA 2AWYA 3TD7A 3IQTA 1HE1A 4YJWA 4BJ6C 3FDQA 1ZHZA 1R4TA 5KYUB 3NRHA 3S90A 2XXAB 1ZHWA 5JUAA 2ZXPA 3JZ0A 1VOMA 2GWWA 3ZDLA 2FFHA 2DB4A 3JYYA 4JTAB 1CPQA 4CDVA 5K0IA 3ZIBA 2HKVA 5F5FA 2HUJA 3UR3C 4CJGA 1C02A 1K04A 3EGDA 3GODA 4JURI 3MBGA 4KC9A 2L81A 4IB4A 1SYQA 2LFDA 3O55A 3KPHA 4K1OA 3RVZA 3L0IA 3N0TA 3C62A 1U89A 3SNHA 3RQFA 2ZXWC 3DZAA 1C03A 3HNLA 4CS8A 3BEHA 3OA1A 4EBBA 256BA 1D1AA 4J7TA 2AU5A 4AE4A 2PFDA 2D5RB 2VCBA 2WL8A 3US6A 5KYXA 2MWQA 2DYRC 1OCRC 4PJLA 1T01A 3B9QA 4E7SA 3VF0A 2XLEA 1HE9A 3GM2A 4MVOA 1ZHYA 1FTSA 1L7CA 4FAPB 4MQ9F 2QUPA 1O5HA 2YL0A 3GEEA 2GDCA 1YA7O 2KGOA 2EILC 3Q6NA 4YL0A 3RH3A 4JJGA 4PJJA 3C63A 1MQVA 4CS9A 3M15A 3S84A 3T9OA 2HZ8A 1ZU4A 2W4BA 3FOOA 2XS8A 3RKOF 3T4RA 3UMHA 1CGOA 3ZWIA 4CX9A 3ABMC 4PACA 3WODF 2O9XA 4CDYA 4JCZA 4DRIB 1ST6A 4N06A 4EIYA 1VK5A 1BR1A 1D1BA 3HNJA 4U5DE 3QMKA 2NG1A 3TOMA 4U9EA 5E2QA 4JTDB 4XEVA 3C8GD 4PFPA 4O6MA 2L7AA 2Y69C 4IGGA 4CSAA 2KJGA 3SZRA 5A6JA 3W8IA 2IXOA 3PHF2 1SR2A 1S05A 3RQEA 3VAYA 1LS4A 3S28A 1YARO 2KK1A 1OXKA 2KSFA 4BG0A 4AL0A 4CS8C 1MMNA 2C03A 3ATPA 4WGYA 2OOCA 3TJ6A 4EUKB 3G50A 2H8AA 2Y3BA 5DVWA 4YT8A 1OW7A 3H65A 5F28E 1XWJA 2J8WA 4DJ9A 1L3PA 2IXPA 1ZHTA 4EWCA 3NMJA 1MNDA 4FWVA 2AWCA 4JW1A 4ZLDA 1U6HA 5A69A 2BE5F 4XLNF 4A4AA 4Q7CA 1NSGB 2PX3A 4WJ0A 5BQIA 3GEIA 3ZVRA 4HFFB 4Z9IA 1QPUA 2CDQA 2H7OA 2VB6A 3EGDB 2GFHA 4BEMJ 5EGYA 5DQZA 1J8MF 3NDBB 3V5YA 2FGYA 1NU9C 4OIQF 4XQ1A 5KYWA 1BDJB 4MVSA 3GM3A 1A41A 3LAYA 1TFKB 2WVNA 1TKNA 3DM9B 1MMAA 2R7UA 3ITFA 4WABA 4DBQA 1KTMA 2EIMC 2TMVP 2R7TA 5KYXB 4JJFA 4BJ5A 2XLMA 5JLIA 2CNWD 2J7PA 4NC3A 4NQFA 3KL4A 2E87A 3AOUA 4GEHA 4C7OB 2A1DD 1HY5A 5A6BA 4OIRF 3R2PA 1QQ3A 4MVMA 1DOWA 2IBFA 3RW0A 2EINC 1WGWA 4XWJA 2L6FA 3UGOA 3LNRA 4L6RA 1G5ZA 4PK4A 1BZ4A 3CZ6A 3U8VA 5AC5A 3K66A 2GA0A 3HNIA 3SP1A 2HV6A 2P0NA 1A7EA 1CGNA 1Z5ZA 4H4KC 4YT4A 3NKEA 1KNYA 5GPGB 5DQTA 2PX0A 4D4XA 1Q0MA 4KBLA 1G4US 5T3WA 2J9WA 1LVKA 1FAPB 1NFOA 1ZW3A 4AK9A 1LKXA 1PD1A 1ZVZA 4U5EE 1NLXA 3POVA 4U5CE 3IQCA 2EPKX 3DM5A 3TK0A 1NZEA 2J0WA 5JS5A 1PCXA 1YVIA 2I8BA 3NMIA 5CI9A 3SXMA 3O39A 1JPJA 3V5ZA 5B3SC 4ULVA 2P61A 1APCA 1AUEA 3VM6A 1IZMA 2R25A 4NTBA 3SXYA 1T6IA 1VLTA 3EFOB 2KQ9A 3GWNA 1VB5A 1Y6DA 2ETSA 3RVYA 4GYTA 2ZXOA 2B0JA 2D4UA 3ASNC 4C3BA 2XXAA 1WOLA 2HJMA 2YKZA 3U2MA 3AGTA 1SZIA 2NUPB 2YVKA 4JC7A 2IXNA 2RSEB 1Q0GA 3JYHA 3ZTZA 5HV9A 1E86A 1RKCA 1VYKA 3C8ZA 3DWWA 2YRFA 4YL3A 2P1AA 4IRUA 5FCLA 3ZTMA 5JT4A 1JR8A 2JD3A 4IJJA 2L6GA 3OEOA 2A69F 5AC4A 1RKEB 3LLIA 3NMKA 2LIGA 5L0HA 3M1CB 4M63A 3RIPA 4BJ6A 4EBJA 4EBKA 3SXKA 2Y3DA 2YLIA 4LACB 3RF3A 3GORA 4BPMA 1JAFA 4HEAJ 1VLSA 2YWAA 1XZQA 2XLWA 4J7YA 3K1HA 1Q0DA 4IWBA 4OD4A 4QDLA 3FHDA 1M56C 4NTAA 3WG7C 4E0HA 3A11A 4YN0B 3U9MA 2OCCC 2QTVA 5T1DB 2H7VC 2X0CA 3FVYA 1FFHA 4UDVA 4XEKA 2RD9A 1AVOB 3LLKA 3KMIA 1U0BB 1K05A 2L9JA 4MTGA 2OEVA 3UGPA 3LEOA 4MW3A 1I4YA 1WATA 2KNHA 3AQBA 3IEEA 4FX5A 1MMGA 2B0HA 1Z7Qc 4Z9HA 3FAPB 4LDKA 4E18A 2R7RA 3G4XA 4Z9JA 1LI5A 5FZTA 4YT5A 3LJBA 4JEAA 1E2XA 1GGQA 2C04A 1BR4A 4D4NA 3T6JA 1HW1A 3WAQA 4LDRA 2EPOA 2J9BA 4O7GA 4K0DA 3HNKA 2R7SA 4G7OF 2Q9AA 3Q7LA 3ZQYA 1W2WA 3CEXA 1OCZC 4ONSA 5BUOA 2KYHA 1QZXA 4N6HA 4AX2A 3U2LA 5L0IA 2R03A 3DE8A 1YYXA 1YZAA 2QE9A 3HLZA 4CBEA 1V74B 3W8HA 2DYSC 2L6HA 4G7HF 1ZW2A 4YT2A 4XLPF 2R05A 1D1CA 2NSGA 4OIOF 4JZAA 1R5ID 1HMDA 2LSEA 2V26A 3GM1A 3RFYA 3ZQVA 1BBHA 4PJNA 2HV7A 3IPMO 1GS9A 5B1AC 3U3FA 3ABLC 5COMA 1Z63A 4YWQA 3EHNA 3MYFA 4NTFA 3HJCA 1C17M 1JOGA 1NU7D 3MX3A 3Q7GA 1H6GA 4QI0A 3KYJA 1KU2A 4BJTA 3TQOA 2OG2A 3DMDA 3EZHA 5COFA 4OINF 5B3IA 5EK0A 3EPVA 1LM3B 4U9DA 2JPUA 3M79A 3AG2C 3FMSA 4LDQA 5KYWB 3I5QA 3K6BA 1NFNA 2XLOA 4U5BE 3R7CA 1SMYF 1EQ1A 3C8GB 1Z3IX 3HKKA 1M57C 3ECSA 1N1CA 3N2ZB 1WASA 4XEFA 1VTMP 3M4BA 2R02A 1ORJA 3EGXA 2CCYA 4CJOA 1TR2A 1QSPA 1TWAA 2EPLX 3FOPA 5DS4A 1PV3A 2LFFA 2Q00A 3JCUQ 3NYJA 5DS5A 1Y4CA 2XLVA 1OW8A 3N24A 2NUTB 1QLEC 4JCHA 1G4WR 3QW1A 4NCQA 2R7OA 4EKWA 2MYSA 1A7VA 2XM4A 3UMIA 2WZGA 5L0FA 3UNGC 1LE2A 4DVZA 2A6HF 1EKYA 5COGA 1T6QA 3F47A 4BEJA 2W45A 3B29A 3H2VA 2WVOA 1VMAA 3NYLA 3U8PA 5L0GA 3T6GB 4ER9A 4NY3A 4OD5A 1OR3A 1SF8A 3FAJA 3JSEO 4K7BA 4PFOA 2LP4A 5E3CA 3L8JA 2Q7RA 4I1MA 5DLJA 4DBRA 2HJ3A 3W2WA 1JMWA 2Y3HA 3QW0A 1OW6A 2W9YA 3JT1A 1WWPA 1Q0FA 1M2VB 4A2NB 2OJQA 4RDAA 2HSQA 3NG1A 4MW8A 1DOVA 1YZCA 4CDAA 4Q5SF 3QVZA 5B1BC 4PR9A 3U3BA 2J45A 3EFOA 4CS7A 5L0CA 1H7IA 3TOLA 2XL6A 5EHHA 5L0JA 5T3TA 1V54C 2ZD9A 1YA9A 2CW0F 1LE4A 1AEPA 2YHSA 3HTKC 2Q9CA 2OEXA 3O6XA 4I3MA 3W2VA 1J8YF 1RJ9A 3AQCA 5A6AA 4LERA 2NPUA 4XPYA 4EHPA 2R7XA 3U9JA 4DRJB 2G3VA 2ASRA 1NG1A 3K33A 4XTKA 2LQGA 2VCAA 1BR2A 3MFNA 3MYIA 4LLCA 2Q9BA 3GWLA 5BQGA 3LEVA 3QZCA 3PDMP 2PBEA 1MNEA 3G4ZA 3ZG1A 2YQYA 1OKKA 2H7BA 4X0RA 5D92A 1HMOA 3L1MA 3T6BA 1FNTc 3TULA 1OCOC 1OKKD 2NSFA 1ZU5A 2YL3A 4PJMA 2Q4FA 4ANJA 1YJGA 2BC5A 2OU6A 2WB7A 2J9VA 3SXZA 3B71A 5F5HA 4MTOA 3EH2A 3V5XA 4MVQA 3E9VA 2P6VA 5JVEA 4Q4ZF 3S9OA 5L0DA 1E84A 4P6IC 3EG9B 2NUTA 1EA8A 1T6UA 2R7QA 3CSKA 4H54A 3UMKA 1I5NA 4BJ5C 5BQHA 2Y3GA 3IHUA 3C7JA 4CIPA 3L34A 1TWCA 3EHMA 1I4ZA 5L3VA 4RD9A 5KYYB 3M4CA 3CAXA 5AGFA 1G8XA 3PMRA 3X2QC 5A6KA 2IOQA 4MTFA 4C3DA 3S29A 2ZXRA 4DOZA 2R7VA 2HS5A 3AGUA 2NUPA 4E17A 2AVKA 4FESA 4J30B 3RYLA 4GQHA 1CGME 4KI2A 3OWTA 2OKUA 1TWHA 2YLGA 3DJUB 4HFKB 4MVZA 2IM8A 1FMVA 2M4EA 3SYNA 1D0ZA 2P7VA 1A0BA 5HSWA 1ZHXA 3VRCA 1M6TA 2GAQA 1HW2A 1OCCC 3F46A 1M2VA 3B0VC 3RQGA 4IAQA 5KYNA 2XSEA 5CIVA 1YDIA 3ASOC 2VASA 4JVSA 4W8PA 1S7ZA 2F22A 3ZC4A 3LESA 1FMWA 2UUIA 4CIHA 3QTHA 3C8GA 5JSLA 4DXWA 4HE8D 1QKRA 4KNWA 1H9GA 1PD0A 1YAUO 4MNDA 5KYUA 4YL1A 5IY5C 2G3KA 2WZLA 1T9KA 5JP7A 2V3CC 2R7WA 1XZPA 1ORYA 2YL7A
chains in the Genus database with same CATH topology
4E18A 1TR2A 1ZVZA 1RKEB 5L0HA 4E17A 4DJ9A 1XWJA 5FZTA 2HSQA 1DOVA 1SYQA 4K1OA 4PR9A 3RF3A 1U89A 1U6HA 1H6GA 5L0CA 1ST6A 1DOWA 2IBFA 5L0FA 3H2UA 3TJ5A 5L0JA 1YDIA 2X0CA 5L0DA 4W8PA 4ONSA 2L7AA 3H2VA 1RKEA 4IGGA 5L0GA 5L0IA 3S90A 1T01A 3T6GB 1QKRA 4P9TA 3VF0A 4EHPA 1RKCA 1ZW2A 1L7CA 2B0HA 2GWWA 2LQGA 3MYIA 3ZDLA 2GDCA 1ZW3A 3TJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E18 A;  1TR2 A;  1ZVZ A;  1RKE B;  5L0H A;  4E17 A;  4DJ9 A;  1XWJ A;  5FZT A;  2HSQ A;  1DOV A;  1SYQ A;  4K1O A;  4PR9 A;  3RF3 A;  1U89 A;  1U6H A;  1H6G A;  5L0C A;  1ST6 A;  1DOW A;  2IBF A;  5L0F A;  3H2U A;  3TJ5 A;  5L0J A;  1YDI A;  2X0C A;  5L0D A;  4W8P A;  4ONS A;  2L7A A;  3H2V A;  1RKE A;  4IGG A;  5L0G A;  5L0I A;  3S90 A;  1T01 A;  3T6G B;  1QKR A;  4P9T A;  3VF0 A;  4EHP A;  1RKC A;  1ZW2 A;  1L7C A;  2B0H A;  2GWW A;  2LQG A;  3MYI A;  3ZDL A;  2GDC A;  1ZW3 A;  3TJ6 A; 
#chains in the Genus database with same CATH topology
 4BJ1 A;  2A68 F;  3JRM O;  4ULW A;  2EPN A;  4O6N A;  1LS1 A;  1WN0 A;  1ZYR F;  4IAR A;  2HFI A;  3AG3 C;  2CGE A;  4JIO A;  4E0I A;  3ZSU A;  2PNO A;  3B0P A;  4DVY P;  4CSA C;  4I1O B;  4G7Z F;  4R32 A;  4WGZ A;  2IYL D;  3LS0 A;  3U5S A;  2QLA A;  3EH1 A;  4JE9 A;  3DI5 A;  4OIP F;  1RMV A;  3JSZ A;  1IW7 F;  4JTC B;  3DXJ F;  4JRZ A;  5JRA A;  1YLM A;  1ZZP A;  2CNW A;  2J7P D;  3L8I A;  3WHN A;  1JPN A;  1M2O A;  4B6I A;  2XL4 A;  3CQZ A;  2IXM A;  3GEH A;  3Q6M A;  1LIH A;  1OXB A;  4XPX A;  4U5H A;  2LD6 A;  2PP4 A;  3K1I A;  3AG1 C;  1FFT C;  4U5G A;  1D0Y A;  4N4W A;  2J0X A;  4ZLC A;  3EG9 A;  1H9T A;  1NBB A;  2WVQ A;  3V7O A;  5DS6 A;  2XM0 A;  1OQC A;  2YZS A;  1RXQ A;  2YEV A;  1Z23 A;  4P9F A;  2G62 A;  2DI3 A;  3E70 C;  4J32 B;  2ZPA A;  2KC3 A;  3DAG A;  1CPR A;  3JRT A;  2VC9 A;  3B0U X;  2LK4 A;  4YK5 A;  2HMQ A;  5TJ5 E;  1Z6A A;  2Y39 A;  1LI7 A;  2PF4 E;  2QNL A;  5A6B D;  1RCP A;  2R9R B;  1QVX A;  5D91 A;  2YL1 A;  1RJ9 B;  4N6C A;  3LNM B;  1E85 A;  3J06 A;  3DAF A;  2DGJ A;  5E3A A;  1UFB A;  2HSB A;  3EZI A;  4I44 A;  4JEB A;  5E33 A;  1JRA A;  3ABK C;  3EQL F;  2XRH A;  2A6E F;  4U5F E;  3NYM A;  3LUT B;  1O3U A;  2FAP B;  1TWG A;  3KKB A;  1Q0K A;  4MS2 A;  1TQG A;  1GM5 A;  1B68 A;  4AE4 B;  2MHR A;  1FR0 A;  2OJE D;  3VYW A;  2X51 A;  3NKD A;  2CYD A;  3K7D A;  4AL1 A;  2UUH A;  3K1I C;  1V55 C;  3PCV A;  3X1O A;  3EGX B;  4E7Z A;  2EPM X;  1A7D A;  2OQM A;  4IAO A;  2BL2 A;  3H2U A;  2AP3 A;  3TJ5 A;  1GQA A;  4G0H A;  1WTY A;  3A9C A;  3IQ6 A;  2A0U A;  3EJN A;  2XLD A;  3FXH A;  1T5O A;  1MMD A;  3AJM A;  2QY9 A;  3DJN B;  2XS1 A;  1ORS C;  1TFO B;  2KW3 C;  2W4M A;  1RKE A;  3I4U A;  2J9U A;  3MLG A;  4LLE A;  5CI8 A;  2I15 A;  1E83 A;  2J46 A;  2LCH A;  1LPE A;  4P9T A;  3GAN A;  3IQ5 A;  3KH2 A;  4RBN A;  4C3E A;  4MVU A;  4XPW A;  2VCC A;  2Q3T A;  3I5P A;  3DD7 A;  1D0X A;  3JTL O;  2EIK C;  2XLH A;  4W8K A;  2HMZ A;  3W4Y A;  2Z15 A;  3DE9 A;  4KNV A;  4O6Y A;  5L3Q A;  4DRH B;  3S0X A;  3S27 A;  1EI7 A;  4O79 A;  4JKV A;  4QI2 A;  2A0B A;  3DKA A;  2XL8 A;  2VH3 A;  1VYI A;  2YLD A;  1K40 A;  2ICW G;  1OR2 A;  3AG4 C;  4F4B A;  2EIJ C;  1YYJ A;  3KYI A;  1O87 A;  2M64 A;  1F1M A;  4C7O A;  3QVY A;  4MVR A;  3SEO A;  3O10 A;  2WZF A;  3C18 A;  1UG7 A;  2JX0 A;  3LS1 A;  3U0C A;  1V4A A;  3BRJ A;  4CS9 C;  4G78 A;  5KYY A;  2AWY A;  3TD7 A;  3IQT A;  1HE1 A;  4YJW A;  4BJ6 C;  3FDQ A;  1ZHZ A;  1R4T A;  5KYU B;  3NRH A;  3S90 A;  2XXA B;  1ZHW A;  5JUA A;  2ZXP A;  3JZ0 A;  1VOM A;  2GWW A;  3ZDL A;  2FFH A;  2DB4 A;  3JYY A;  4JTA B;  1CPQ A;  4CDV A;  5K0I A;  3ZIB A;  2HKV A;  5F5F A;  2HUJ A;  3UR3 C;  4CJG A;  1C02 A;  1K04 A;  3EGD A;  3GOD A;  4JUR I;  3MBG A;  4KC9 A;  2L81 A;  4IB4 A;  1SYQ A;  2LFD A;  3O55 A;  3KPH A;  4K1O A;  3RVZ A;  3L0I A;  3N0T A;  3C62 A;  1U89 A;  3SNH A;  3RQF A;  2ZXW C;  3DZA A;  1C03 A;  3HNL A;  4CS8 A;  3BEH A;  3OA1 A;  4EBB A;  256B A;  1D1A A;  4J7T A;  2AU5 A;  4AE4 A;  2PFD A;  2D5R B;  2VCB A;  2WL8 A;  3US6 A;  5KYX A;  2MWQ A;  2DYR C;  1OCR C;  4PJL A;  1T01 A;  3B9Q A;  4E7S A;  3VF0 A;  2XLE A;  1HE9 A;  3GM2 A;  4MVO A;  1ZHY A;  1FTS A;  1L7C A;  4FAP B;  4MQ9 F;  2QUP A;  1O5H A;  2YL0 A;  3GEE A;  2GDC A;  1YA7 O;  2KGO A;  2EIL C;  3Q6N A;  4YL0 A;  3RH3 A;  4JJG A;  4PJJ A;  3C63 A;  1MQV A;  4CS9 A;  3M15 A;  3S84 A;  3T9O A;  2HZ8 A;  1ZU4 A;  2W4B A;  3FOO A;  2XS8 A;  3RKO F;  3T4R A;  3UMH A;  1CGO A;  3ZWI A;  4CX9 A;  3ABM C;  4PAC A;  3WOD F;  2O9X A;  4CDY A;  4JCZ A;  4DRI B;  1ST6 A;  4N06 A;  4EIY A;  1VK5 A;  1BR1 A;  1D1B A;  3HNJ A;  4U5D E;  3QMK A;  2NG1 A;  3TOM A;  4U9E A;  5E2Q A;  4JTD B;  4XEV A;  3C8G D;  4PFP A;  4O6M A;  2L7A A;  2Y69 C;  4IGG A;  4CSA A;  2KJG A;  3SZR A;  5A6J A;  3W8I A;  2IXO A;  3PHF 2;  1SR2 A;  1S05 A;  3RQE A;  3VAY A;  1LS4 A;  3S28 A;  1YAR O;  2KK1 A;  1OXK A;  2KSF A;  4BG0 A;  4AL0 A;  4CS8 C;  1MMN A;  2C03 A;  3ATP A;  4WGY A;  2OOC A;  3TJ6 A;  4EUK B;  3G50 A;  2H8A A;  2Y3B A;  5DVW A;  4YT8 A;  1OW7 A;  3H65 A;  5F28 E;  1XWJ A;  2J8W A;  4DJ9 A;  1L3P A;  2IXP A;  1ZHT A;  4EWC A;  3NMJ A;  1MND A;  4FWV A;  2AWC A;  4JW1 A;  4ZLD A;  1U6H A;  5A69 A;  2BE5 F;  4XLN F;  4A4A A;  4Q7C A;  1NSG B;  2PX3 A;  4WJ0 A;  5BQI A;  3GEI A;  3ZVR A;  4HFF B;  4Z9I A;  1QPU A;  2CDQ A;  2H7O A;  2VB6 A;  3EGD B;  2GFH A;  4BEM J;  5EGY A;  5DQZ A;  1J8M F;  3NDB B;  3V5Y A;  2FGY A;  1NU9 C;  4OIQ F;  4XQ1 A;  5KYW A;  1BDJ B;  4MVS A;  3GM3 A;  1A41 A;  3LAY A;  1TFK B;  2WVN A;  1TKN A;  3DM9 B;  1MMA A;  2R7U A;  3ITF A;  4WAB A;  4DBQ A;  1KTM A;  2EIM C;  2TMV P;  2R7T A;  5KYX B;  4JJF A;  4BJ5 A;  2XLM A;  5JLI A;  2CNW D;  2J7P A;  4NC3 A;  4NQF A;  3KL4 A;  2E87 A;  3AOU A;  4GEH A;  4C7O B;  2A1D D;  1HY5 A;  5A6B A;  4OIR F;  3R2P A;  1QQ3 A;  4MVM A;  1DOW A;  2IBF A;  3RW0 A;  2EIN C;  1WGW A;  4XWJ A;  2L6F A;  3UGO A;  3LNR A;  4L6R A;  1G5Z A;  4PK4 A;  1BZ4 A;  3CZ6 A;  3U8V A;  5AC5 A;  3K66 A;  2GA0 A;  3HNI A;  3SP1 A;  2HV6 A;  2P0N A;  1A7E A;  1CGN A;  1Z5Z A;  4H4K C;  4YT4 A;  3NKE A;  1KNY A;  5GPG B;  5DQT A;  2PX0 A;  4D4X A;  1Q0M A;  4KBL A;  1G4U S;  5T3W A;  2J9W A;  1LVK A;  1FAP B;  1NFO A;  1ZW3 A;  4AK9 A;  1LKX A;  1PD1 A;  1ZVZ A;  4U5E E;  1NLX A;  3POV A;  4U5C E;  3IQC A;  2EPK X;  3DM5 A;  3TK0 A;  1NZE A;  2J0W A;  5JS5 A;  1PCX A;  1YVI A;  2I8B A;  3NMI A;  5CI9 A;  3SXM A;  3O39 A;  1JPJ A;  3V5Z A;  5B3S C;  4ULV A;  2P61 A;  1APC A;  1AUE A;  3VM6 A;  1IZM A;  2R25 A;  4NTB A;  3SXY A;  1T6I A;  1VLT A;  3EFO B;  2KQ9 A;  3GWN A;  1VB5 A;  1Y6D A;  2ETS A;  3RVY A;  4GYT A;  2ZXO A;  2B0J A;  2D4U A;  3ASN C;  4C3B A;  2XXA A;  1WOL A;  2HJM A;  2YKZ A;  3U2M A;  3AGT A;  1SZI A;  2NUP B;  2YVK A;  4JC7 A;  2IXN A;  2RSE B;  1Q0G A;  3JYH A;  3ZTZ A;  5HV9 A;  1E86 A;  1RKC A;  1VYK A;  3C8Z A;  3DWW A;  2YRF A;  4YL3 A;  2P1A A;  4IRU A;  5FCL A;  3ZTM A;  5JT4 A;  1JR8 A;  2JD3 A;  4IJJ A;  2L6G A;  3OEO A;  2A69 F;  5AC4 A;  1RKE B;  3LLI A;  3NMK A;  2LIG A;  5L0H A;  3M1C B;  4M63 A;  3RIP A;  4BJ6 A;  4EBJ A;  4EBK A;  3SXK A;  2Y3D A;  2YLI A;  4LAC B;  3RF3 A;  3GOR A;  4BPM A;  1JAF A;  4HEA J;  1VLS A;  2YWA A;  1XZQ A;  2XLW A;  4J7Y A;  3K1H A;  1Q0D A;  4IWB A;  4OD4 A;  4QDL A;  3FHD A;  1M56 C;  4NTA A;  3WG7 C;  4E0H A;  3A11 A;  4YN0 B;  3U9M A;  2OCC C;  2QTV A;  5T1D B;  2H7V C;  2X0C A;  3FVY A;  1FFH A;  4UDV A;  4XEK A;  2RD9 A;  1AVO B;  3LLK A;  3KMI A;  1U0B B;  1K05 A;  2L9J A;  4MTG A;  2OEV A;  3UGP A;  3LEO A;  4MW3 A;  1I4Y A;  1WAT A;  2KNH A;  3AQB A;  3IEE A;  4FX5 A;  1MMG A;  2B0H A;  1Z7Q c;  4Z9H A;  3FAP B;  4LDK A;  4E18 A;  2R7R A;  3G4X A;  4Z9J A;  1LI5 A;  5FZT A;  4YT5 A;  3LJB A;  4JEA A;  1E2X A;  1GGQ A;  2C04 A;  1BR4 A;  4D4N A;  3T6J A;  1HW1 A;  3WAQ A;  4LDR A;  2EPO A;  2J9B A;  4O7G A;  4K0D A;  3HNK A;  2R7S A;  4G7O F;  2Q9A A;  3Q7L A;  3ZQY A;  1W2W A;  3CEX A;  1OCZ C;  4ONS A;  5BUO A;  2KYH A;  1QZX A;  4N6H A;  4AX2 A;  3U2L A;  5L0I A;  2R03 A;  3DE8 A;  1YYX A;  1YZA A;  2QE9 A;  3HLZ A;  4CBE A;  1V74 B;  3W8H A;  2DYS C;  2L6H A;  4G7H F;  1ZW2 A;  4YT2 A;  4XLP F;  2R05 A;  1D1C A;  2NSG A;  4OIO F;  4JZA A;  1R5I D;  1HMD A;  2LSE A;  2V26 A;  3GM1 A;  3RFY A;  3ZQV A;  1BBH A;  4PJN A;  2HV7 A;  3IPM O;  1GS9 A;  5B1A C;  3U3F A;  3ABL C;  5COM A;  1Z63 A;  4YWQ A;  3EHN A;  3MYF A;  4NTF A;  3HJC A;  1C17 M;  1JOG A;  1NU7 D;  3MX3 A;  3Q7G A;  1H6G A;  4QI0 A;  3KYJ A;  1KU2 A;  4BJT A;  3TQO A;  2OG2 A;  3DMD A;  3EZH A;  5COF A;  4OIN F;  5B3I A;  5EK0 A;  3EPV A;  1LM3 B;  4U9D A;  2JPU A;  3M79 A;  3AG2 C;  3FMS A;  4LDQ A;  5KYW B;  3I5Q A;  3K6B A;  1NFN A;  2XLO A;  4U5B E;  3R7C A;  1SMY F;  1EQ1 A;  3C8G B;  1Z3I X;  3HKK A;  1M57 C;  3ECS A;  1N1C A;  3N2Z B;  1WAS A;  4XEF A;  1VTM P;  3M4B A;  2R02 A;  1ORJ A;  3EGX A;  2CCY A;  4CJO A;  1TR2 A;  1QSP A;  1TWA A;  2EPL X;  3FOP A;  5DS4 A;  1PV3 A;  2LFF A;  2Q00 A;  3JCU Q;  3NYJ A;  5DS5 A;  1Y4C A;  2XLV A;  1OW8 A;  3N24 A;  2NUT B;  1QLE C;  4JCH A;  1G4W R;  3QW1 A;  4NCQ A;  2R7O A;  4EKW A;  2MYS A;  1A7V A;  2XM4 A;  3UMI A;  2WZG A;  5L0F A;  3UNG C;  1LE2 A;  4DVZ A;  2A6H F;  1EKY A;  5COG A;  1T6Q A;  3F47 A;  4BEJ A;  2W45 A;  3B29 A;  3H2V A;  2WVO A;  1VMA A;  3NYL A;  3U8P A;  5L0G A;  3T6G B;  4ER9 A;  4NY3 A;  4OD5 A;  1OR3 A;  1SF8 A;  3FAJ A;  3JSE O;  4K7B A;  4PFO A;  2LP4 A;  5E3C A;  3L8J A;  2Q7R A;  4I1M A;  5DLJ A;  4DBR A;  2HJ3 A;  3W2W A;  1JMW A;  2Y3H A;  3QW0 A;  1OW6 A;  2W9Y A;  3JT1 A;  1WWP A;  1Q0F A;  1M2V B;  4A2N B;  2OJQ A;  4RDA A;  2HSQ A;  3NG1 A;  4MW8 A;  1DOV A;  1YZC A;  4CDA A;  4Q5S F;  3QVZ A;  5B1B C;  4PR9 A;  3U3B A;  2J45 A;  3EFO A;  4CS7 A;  5L0C A;  1H7I A;  3TOL A;  2XL6 A;  5EHH A;  5L0J A;  5T3T A;  1V54 C;  2ZD9 A;  1YA9 A;  2CW0 F;  1LE4 A;  1AEP A;  2YHS A;  3HTK C;  2Q9C A;  2OEX A;  3O6X A;  4I3M A;  3W2V A;  1J8Y F;  1RJ9 A;  3AQC A;  5A6A A;  4LER A;  2NPU A;  4XPY A;  4EHP A;  2R7X A;  3U9J A;  4DRJ B;  2G3V A;  2ASR A;  1NG1 A;  3K33 A;  4XTK A;  2LQG A;  2VCA A;  1BR2 A;  3MFN A;  3MYI A;  4LLC A;  2Q9B A;  3GWL A;  5BQG A;  3LEV A;  3QZC A;  3PDM P;  2PBE A;  1MNE A;  3G4Z A;  3ZG1 A;  2YQY A;  1OKK A;  2H7B A;  4X0R A;  5D92 A;  1HMO A;  3L1M A;  3T6B A;  1FNT c;  3TUL A;  1OCO C;  1OKK D;  2NSF A;  1ZU5 A;  2YL3 A;  4PJM A;  2Q4F A;  4ANJ A;  1YJG A;  2BC5 A;  2OU6 A;  2WB7 A;  2J9V A;  3SXZ A;  3B71 A;  5F5H A;  4MTO A;  3EH2 A;  3V5X A;  4MVQ A;  3E9V A;  2P6V A;  5JVE A;  4Q4Z F;  3S9O A;  5L0D A;  1E84 A;  4P6I C;  3EG9 B;  2NUT A;  1EA8 A;  1T6U A;  2R7Q A;  3CSK A;  4H54 A;  3UMK A;  1I5N A;  4BJ5 C;  5BQH A;  2Y3G A;  3IHU A;  3C7J A;  4CIP A;  3L34 A;  1TWC A;  3EHM A;  1I4Z A;  5L3V A;  4RD9 A;  5KYY B;  3M4C A;  3CAX A;  5AGF A;  1G8X A;  3PMR A;  3X2Q C;  5A6K A;  2IOQ A;  4MTF A;  4C3D A;  3S29 A;  2ZXR A;  4DOZ A;  2R7V A;  2HS5 A;  3AGU A;  2NUP A;  4E17 A;  2AVK A;  4FES A;  4J30 B;  3RYL A;  4GQH A;  1CGM E;  4KI2 A;  3OWT A;  2OKU A;  1TWH A;  2YLG A;  3DJU B;  4HFK B;  4MVZ A;  2IM8 A;  1FMV A;  2M4E A;  3SYN A;  1D0Z A;  2P7V A;  1A0B A;  5HSW A;  1ZHX A;  3VRC A;  1M6T A;  2GAQ A;  1HW2 A;  1OCC C;  3F46 A;  1M2V A;  3B0V C;  3RQG A;  4IAQ A;  5KYN A;  2XSE A;  5CIV A;  1YDI A;  3ASO C;  2VAS A;  4JVS A;  4W8P A;  1S7Z A;  2F22 A;  3ZC4 A;  3LES A;  1FMW A;  2UUI A;  4CIH A;  3QTH A;  3C8G A;  5JSL A;  4DXW A;  4HE8 D;  1QKR A;  4KNW A;  1H9G A;  1PD0 A;  1YAU O;  4MND A;  5KYU A;  4YL1 A;  5IY5 C;  2G3K A;  2WZL A;  1T9K A;  5JP7 A;  2V3C C;  2R7W A;  1XZP A;  1ORY A;  2YL7 A; 
#chains in the Genus database with same CATH homology
 4E18 A;  1TR2 A;  1ZVZ A;  1RKE B;  5L0H A;  4E17 A;  4DJ9 A;  1XWJ A;  5FZT A;  2HSQ A;  1DOV A;  1SYQ A;  4K1O A;  4PR9 A;  3RF3 A;  1U89 A;  1U6H A;  1H6G A;  5L0C A;  1ST6 A;  1DOW A;  2IBF A;  5L0F A;  3H2U A;  3TJ5 A;  5L0J A;  1YDI A;  2X0C A;  5L0D A;  4W8P A;  4ONS A;  2L7A A;  3H2V A;  1RKE A;  4IGG A;  5L0G A;  5L0I A;  3S90 A;  1T01 A;  3T6G B;  1QKR A;  4P9T A;  3VF0 A;  4EHP A;  1RKC A;  1ZW2 A;  1L7C A;  2B0H A;  2GWW A;  2LQG A;  3MYI A;  3ZDL A;  2GDC A;  1ZW3 A;  3TJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...