1ZW3A

Vinculin head (0-258) in complex with the talin rod residues 1630-1652
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
251
structure length
251
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 108
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw3A01
1ST6A 4ONSA 1RKCA 1L7CA 1U89A 3TJ6A 2L7AA 5FZTA 1DOVA 1T01A 3H2VA 4K1OA 2GWWA 1ZVZA 1RKEB 4P9TA 3T6GB 2LQGA 2IBFA 1U6HA 2B0HA 4DJ9A 1DOWA 3ZDLA 1ZW3A 3S90A 5L0GA 1ZW2A 1RKEA 4PR9A 5L0CA 2GDCA 4E18A 5L0DA 5L0HA 5L0IA 3MYIA 3VF0A 1SYQA 4IGGA 2HSQA 1YDIA 2X0CA 3TJ5A 5L0FA 3H2UA 4W8PA 4EHPA 1H6GA 1XWJA 4E17A 5L0JA 1TR2A 1QKRA 3RF3A
chains in the Genus database with same CATH superfamily
3DE8A 5EGYA 1H7IA 3SXZA 1WOLA 2DYSC 4Z9JA 5CIVA 2YEVA 2KW3C 2Q9CA 1JRAA 2R25A 3K1HA 1DOVA 4D4NA 1WWPA 2HZ8A 2NUPB 4YL0A 3TOLA 3DZAA 1Y4CA 4G7OF 2HV6A 3L1MA 4ER9A 4JTAB 3T6GB 3EH1A 4AL1A 3CQZA 3AG4C 1U6HA 3MYFA 3WODF 3NMKA 1DOWA 4JE9A 4EBJA 3JCUQ 1NU9C 3S27A 1MNDA 3K1IA 3QVYA 1OKKD 1ZHTA 2AP3A 1NG1A 3KPHA 1LPEA 3N0TA 4JJFA 4JW1A 4MW3A 4YL3A 3JSZA 5JS5A 1TWAA 1LE2A 2CYDA 2CNWA 4DRHB 1VMAA 2Q9BA 4MNDA 2IXMA 3Q7LA 2EILC 2I8BA 5A69A 1G4WR 4YK5A 2I15A 2D5RB 2HFIA 2YQYA 4MTOA 3GEHA 4Q7CA 3L8IA 3RF3A 4AX2A 1HW2A 4J30B 4F4BA 1E86A 1LS4A 3NG1A 3F46A 2OOCA 1YYXA 5CI8A 1ZHZA 4O6NA 4U5FE 3TK0A 2CCYA 3VYWA 1T01A 3CEXA 3GM2A 4ULWA 2NG1A 3JT1A 1D1BA 2EPNA 1A7EA 5HSWA 3KL4A 4XLPF 5L0GA 1NLXA 1E2XA 5L0DA 3S29A 3M15A 1D1CA 1T9KA 5D91A 3T6BA 3U8PA 1EQ1A 5F5HA 2A0BA 4BJ5C 2NPUA 1K04A 3RH3A 3VM6A 2FAPB 2G3VA 4OINF 5B1BC 3JTLO 1EKYA 1Q0KA 1E83A 3JYHA 4X0RA 3RQFA 3CSKA 4PK4A 1EA8A 3U3BA 2IXPA 3C8GA 3FHDA 3S28A 2CDQA 1VYKA 1T6IA 4OIOF 3O6XA 4JVSA 1ST6A 3WG7C 4ONSA 4I1MA 3AG1C 3MLGA 2YL7A 3ATPA 1L7CA 4BEJA 3Q7GA 1C03A 1YA9A 3U5SA 2J46A 2J0WA 4L6RA 2P61A 2IBFA 2NUTA 4PFPA 4NCQA 1KU2A 4N6HA 2XXAB 4LLEA 4MVSA 1J8YF 2QUPA 2GDCA 3IHUA 3HLZA 1YAUO 1I4YA 4MVOA 3VF0A 2W45A 2OU6A 4NTFA 3W2VA 3C8GB 2OKUA 4O6YA 3BRJA 4W8PA 2GA0A 3PMRA 4EHPA 5JSLA 1JOGA 5DQZA 2H7VC 3EZHA 4R32A 5A6AA 2UUHA 2LP4A 5E3CA 3ABLC 1HMDA 4U5HA 3C7JA 1M56C 1Q0GA 1RMVA 4U5EE 3EHMA 5T1DB 5IY5C 2W4BA 2J9UA 3DM9B 4O6MA 4WGZA 1U89A 4LDRA 4UDVA 2NUTB 3AGUA 2VCCA 5FZTA 3TULA 4J7TA 3LUTB 2G3KA 5COFA 3ABMC 4ANJA 2Y3GA 4NTAA 2PFDA 3AOUA 2B0HA 3PDMP 4P9FA 4ZLDA 2XM4A 3AG3C 3ITFA 2P1AA 1RKEA 4GEHA 5COMA 1PCXA 2KNHA 2VB6A 2YLDA 4E18A 1M6TA 1QZXA 3K1IC 4KNWA 3TOMA 1L3PA 4BJ1A 3U8VA 1A7DA 4CJOA 3R7CA 2XM0A 3QMKA 3ZVRA 3AQCA 1QSPA 2L6FA 3DJUB 1V55C 3G4XA 3KKBA 4IWBA 5D92A 2ASRA 3U2LA 1IZMA 1MMNA 2YWAA 3U3FA 3U9MA 3V5XA 4LACB 2HSBA 3LNRA 1JPJA 3OEOA 5A6KA 3EFOB 2NSGA 2R05A 2WL8A 4W8KA 2CW0F 4J7YA 5DS4A 1TQGA 2M4EA 2R7OA 2ZD9A 3DWWA 1K40A 2GWWA 2Q4FA 3U0CA 1RKEB 3B9QA 2J9VA 5A6BD 1LVKA 2EPMX 2A69F 1T6QA 5EK0A 5F28E 1NFNA 1KTMA 1C02A 1QQ3A 1VLTA 3LS0A 2R7VA 1G8XA 4E7ZA 1ZHWA 2L6GA 5TJ5E 4IARA 1RXQA 1YZCA 4BJ6A 1YDIA 3HNLA 2Q00A 3JRTA 2OJED 4IAOA 3RIPA 1HY5A 3EG9A 1OW8A 3RVYA 2C04A 2Y3HA 2G62A 3DI5A 3M79A 3QW0A 2IYLD 2XL8A 3ZWIA 1TR2A 2QE9A 4DOZA 3L0IA 2BC5A 2J7PA 4WGYA 1YVIA 3GEIA 4CDVA 4JCHA 4BJTA 3RKOF 1YA7O 2XLDA 2J0XA 2J9WA 4RBNA 5KYUB 2VCBA 4E7SA 2J8WA 4FAPB 4O7GA 1WATA 1Y6DA 1ZVZA 1JPNA 2GFHA 4O79A 3UGPA 4N6CA 2HJ3A 256BA 1OXKA 2CNWD 2ZXRA 4DJ9A 3SYNA 2HS5A 3MX3A 5KYXA 2MYSA 5KYWB 3IQ5A 3VRCA 5JLIA 3KYJA 3EG9B 3M1CB 3N2ZB 4I44A 3ZC4A 3TJ5A 2YL0A 4BG0A 1QPUA 2WVQA 3TD7A 4DVYP 4JC7A 4JRZA 4EUKB 3FDQA 3POVA 4OIPF 3JYYA 4DRIB 5L0JA 1K05A 1QKRA 2B0JA 5KYYB 4JURI 1OQCA 4XLNF 5JVEA 2XLEA 1CGOA 2ZXWC 3AQBA 3W2WA 4RDAA 1BZ4A 1TFKB 1ZHXA 3E70C 5EHHA 2R02A 1JAFA 4I1OB 4K1OA 1A0BA 3T9OA 5KYXB 1M2OA 3E9VA 4JZAA 1Q0FA 2WVOA 4WJ0A 3BEHA 1WN0A 2XRHA 3Q6NA 4QI0A 3T6JA 1VB5A 2A1DD 1G4US 4MVRA 4N06A 1C17M 4CJGA 2BL2A 2XS1A 3C8GD 4H54A 3MYIA 4AE4A 4CS8C 4EIYA 2YZSA 1APCA 1BDJB 4PJLA 4C3DA 4JEAA 4YT8A 1A41A 4CS9C 3S84A 2FFHA 2XXAA 5E33A 5T3TA 1T6UA 4OIRF 5A6JA 4XQ1A 2P6VA 2W9YA 3CZ6A 2IXNA 1ORYA 5AC4A 2OQMA 4U9EA 4YJWA 4Q5SF 3G4ZA 1LKXA 3RVZA 1ZU4A 1B68A 3UR3C 3B0PA 4CBEA 2PNOA 3FOPA 4JEBA 2EPLX 2HUJA 1Q0DA 2YL1A 2QY9A 4AE4B 4U5GA 1PD1A 1WGWA 2P7VA 1PD0A 2DYRC 1TWHA 3IPMO 1AUEA 2OJQA 3NMJA 4JTDB 4ZLCA 4IGGA 3SP1A 2L6HA 2QTVA 2L81A 3RQGA 4ULVA 2LCHA 3UGOA 1I5NA 4YT5A 1V54C 3PCVA 3QVZA 1AEPA 3G50A 2C03A 2R7RA 2RD9A 4YL1A 4NY3A 1R4TA 4IAQA 1BBHA 3DAFA 3QW1A 3JRMO 4IB4A 3DKAA 3SEOA 3SNHA 3LS1A 4MVZA 4Z9HA 3W8IA 3ABKC 2RSEB 4U5CE 5E2QA 4PFOA 3RW0A 3ZTMA 5BQHA 4FESA 5DVWA 3EFOA 1LI7A 4XEKA 1CGNA 3I5PA 2YLGA 4E0IA 3RFYA 2AWCA 1OW6A 3EHNA 4U9DA 3MFNA 2Y39A 1LS1A 4EWCA 3GM1A 3ZQVA 1OW7A 1SYQA 1F1MA 1Z6AA 3C62A 3IQCA 3SXMA 2EIMC 2XLVA 2HSQA 3EGDA 1YARO 3GWLA 2XLOA 4YWQA 1BR1A 3UNGC 3ZQYA 4LDQA 1TWCA 3VAYA 2YL3A 3FVYA 3GORA 3KH2A 2XL6A 1LI5A 2WZGA 2DI3A 3LEOA 4QI2A 3NYJA 2F22A 1MMGA 2DGJA 3F47A 3FOOA 2PBEA 3LLIA 2WB7A 2Z15A 2LFDA 4MTFA 3RQEA 1VYIA 3FAJA 2NSFA 3AG2C 3UMKA 1CPQA 3GWNA 1W2WA 3U9JA 2GAQA 5DS5A 1V74B 1ZU5A 4KC9A 4CX9A 4E0HA 1CGME 1RJ9A 2M64A 2H7OA 4B6IA 4EBKA 2V3CC 2LQGA 1FFTC 1YZAA 2EIKC 5KYUA 4CSAA 1N1CA 2EPKX 3EGDB 1ZZPA 3SXYA 2DB4A 1NU7D 4MVMA 2JD3A 4BJ5A 2H8AA 3K7DA 1FMVA 3C63A 3DE9A 3DXJF 1GM5A 4XPWA 1VK5A 5KYWA 3NYMA 1XWJA 3H65A 1M2VA 5BQGA 1Z5ZA 2XSEA 2W4MA 1ZHYA 4E17A 5JUAA 2E87A 3NMIA 3WAQA 4IJJA 4NC3A 3HNKA 1HE9A 1RJ9B 3TQOA 3ZSUA 2IM8A 4LLCA 3DMDA 1NZEA 2Y3DA 3O55A 4NQFA 3T4RA 4CS7A 4G7ZF 2KK1A 5KYYA 4K7BA 2BE5F 1QLEC 3DAGA 3V7OA 1D0YA 5JRAA 2A6EF 2R7TA 4XTKA 2WZFA 4MW8A 3ZDLA 5DQTA 3JSEO 3C18A 4QDLA 1FFHA 2YHSA 4YT4A 3LESA 3W8HA 5DS6A 1M2VB 1XZPA 2Y69C 2KQ9A 3FAPB 1YYJA 2R7SA 2KJGA 4XEFA 2V26A 4C7OB 1BR4A 3IEEA 4HE8D 2Y3BA 3EH2A 2XLMA 1ORSC 4G7HF 3JZ0A 1TKNA 2XLWA 2YVKA 2AVKA 3LAYA 5CI9A 1FNTc 1RKCA 3OA1A 5B3IA 3N24A 2OG2A 5F5FA 3HNIA 4AK9A 1LIHA 4MVUA 2XLHA 1EI7A 4FX5A 2J45A 2ZPAA 4PJJA 1M57C 4AL0A 4H4KC 3WHNA 3HJCA 4JJGA 1S05A 1MMAA 2VH3A 4HFFB 4Z9IA 5L0HA 5L0IA 4GQHA 3HKKA 1Q0MA 2O9XA 2PX3A 4MTGA 3ASOC 3SXKA 4JTCB 2VC9A 5COGA 1NBBA 2R7WA 3ZTZA 3ECSA 2MHRA 3FXHA 3J06A 5FCLA 1SR2A 1G5ZA 1HE1A 5DLJA 5AC5A 4KNVA 1D0ZA 1D0XA 4A2NB 1OCCC 2IXOA 1OKKA 1O87A 4DXWA 1LM3B 3PHF2 1R5ID 2J9BA 1SF8A 5KYNA 2HKVA 2PF4E 4PJMA 3B29A 1U0BB 1E85A 3NKDA 1OCRC 1Z3IX 3I4UA 1I4ZA 2R9RB 2PP4A 1H9GA 2PX0A 1GGQA 2ETSA 1WASA 3H2VA 2LIGA 1OR2A 3ASNC 3GODA 4OD4A 3S0XA 3EJNA 4LERA 4P9TA 4LDKA 1Z63A 2FGYA 4G78A 1BR2A 3S90A 4PJNA 3IQTA 4CSAC 3US6A 1LE4A 3B0UX 1IW7F 3ZIBA 2WVNA 2VASA 3K33A 2X51A 1OCOC 1TFOB 3Q6MA 3UMIA 2Q3TA 2YKZA 4DRJB 2R7XA 1T5OA 4BJ6C 2WZLA 3EPVA 1KNYA 2JPUA 3UMHA 4P6IC 2OEXA 1CPRA 1UFBA 2VCAA 4CIHA 3HNJA 4OD5A 4C3BA 4PACA 1FMWA 2L9JA 1OXBA 3TJ6A 2A0UA 3ZG1A 4DBRA 3A9CA 4Q4ZF 1SZIA 3LNMB 3A11A 4HFKB 2A68F 1JR8A 1MNEA 1V4AA 1YJGA 1ORJA 3AGTA 1AVOB 3M4CA 3M4BA 3LJBA 1WTYA 1NSGB 1TWGA 3IQ6A 3NKEA 3V5ZA 3X1OA 2ZXPA 3L8JA 5AGFA 4YT2A 5JT4A 1ZYRF 3FMSA 4M63A 3QTHA 2UUIA 2IOQA 3KMIA 1ZW2A 1NFOA 5L0CA 1PV3A 1E84A 4XPXA 4CDYA 2HMQA 2CGEA 1GS9A 2R7UA 4A4AA 4U5DE 4CDAA 3SZRA 4JCZA 3LLKA 5L3VA 1H6GA 2TMVP 5T3WA 4BEMJ 3B71A 1FTSA 1D1AA 2HV7A 1S7ZA 1SMYF 4G0HA 4DBQA 2H7BA 1Z23A 2QNLA 1J8MF 2P0NA 2Q9AA 3C8ZA 3GEEA 3L34A 3O10A 1JMWA 3OWTA 3S9OA 4XEVA 2HJMA 4KBLA 1XZQA 4XWJA 4KI2A 3NYLA 4MVQA 1HMOA 3V5YA 3LEVA 1FR0A 4I3MA 4NTBA 1VTMP 1O3UA 1VOMA 2JX0A 2LD6A 3W4YA 5K0IA 1ZW3A 1QVXA 4CS8A 2LK4A 2LSEA 4C3EA 4DVZA 2R03A 4MQ9F 4FWVA 2ZXOA 5B1AC 4CS9A 1O5HA 4CIPA 3R2PA 4OIQF 2J7PD 2KSFA 2X0CA 3KYIA 2KGOA 2D4UA 4MS2A 3H2UA 4EBBA 5BUOA 2R7QA 3RYLA 3CAXA 3EGXA 4BPMA 1OCZC 1UG7A 2XL4A 1OR3A 3GM3A 2ICWG 3EZIA 3O39A 2XS8A 3HTKC 4J32B 2KC3A 4XPYA 4RD9A 2LFFA 5GPGB 4EKWA 3GANA 4YN0B 3X2QC 2OCCC 4C7OA 3B0VC 2EPOA 2Q7RA 4N4WA 3NRHA 1Z7Qc 2L7AA 2EIJC 2YLIA 2AWYA 3DD7A 3MBGA 2KYHA 3I5QA 4U5BE 1GQAA 3K66A 4IRUA 4K0DA 3NDBB 5BQIA 4HEAJ 4WABA 1A7VA 5L3QA 2YRFA 1MQVA 2MWQA 2NUPA 1VLSA 3EQLF 4JIOA 4PR9A 3DM5A 5JP7A 1H9TA 2QLAA 3QZCA 2HMZA 2EINC 1FAPB 3EGXB 3K6BA 1MMDA 3AJMA 5A6BA 2AU5A 4JKVA 4D4XA 5HV9A 5L0FA 1YLMA 3U2MA 3DJNB 1RCPA 2OEVA 5E3AA 5B3SC 4GYTA 2A6HF 1HW1A
chains in the Genus database with same CATH topology
1ST6A 4ONSA 1RKCA 1L7CA 1U89A 3TJ6A 2L7AA 5FZTA 1DOVA 1T01A 3H2VA 4K1OA 2GWWA 1ZVZA 1RKEB 4P9TA 3T6GB 2LQGA 2IBFA 1U6HA 2B0HA 4DJ9A 1DOWA 3ZDLA 1ZW3A 3S90A 5L0GA 1ZW2A 1RKEA 4PR9A 5L0CA 2GDCA 4E18A 5L0DA 5L0HA 5L0IA 3MYIA 3VF0A 1SYQA 4IGGA 2HSQA 1YDIA 2X0CA 3TJ5A 5L0FA 3H2UA 4W8PA 4EHPA 1H6GA 1XWJA 4E17A 5L0JA 1TR2A 1QKRA 3RF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ST6 A;  4ONS A;  1RKC A;  1L7C A;  1U89 A;  3TJ6 A;  2L7A A;  5FZT A;  1DOV A;  1T01 A;  3H2V A;  4K1O A;  2GWW A;  1ZVZ A;  1RKE B;  4P9T A;  3T6G B;  2LQG A;  2IBF A;  1U6H A;  2B0H A;  4DJ9 A;  1DOW A;  3ZDL A;  1ZW3 A;  3S90 A;  5L0G A;  1ZW2 A;  1RKE A;  4PR9 A;  5L0C A;  2GDC A;  4E18 A;  5L0D A;  5L0H A;  5L0I A;  3MYI A;  3VF0 A;  1SYQ A;  4IGG A;  2HSQ A;  1YDI A;  2X0C A;  3TJ5 A;  5L0F A;  3H2U A;  4W8P A;  4EHP A;  1H6G A;  1XWJ A;  4E17 A;  5L0J A;  1TR2 A;  1QKR A;  3RF3 A; 
#chains in the Genus database with same CATH topology
 3DE8 A;  5EGY A;  1H7I A;  3SXZ A;  1WOL A;  2DYS C;  4Z9J A;  5CIV A;  2YEV A;  2KW3 C;  2Q9C A;  1JRA A;  2R25 A;  3K1H A;  1DOV A;  4D4N A;  1WWP A;  2HZ8 A;  2NUP B;  4YL0 A;  3TOL A;  3DZA A;  1Y4C A;  4G7O F;  2HV6 A;  3L1M A;  4ER9 A;  4JTA B;  3T6G B;  3EH1 A;  4AL1 A;  3CQZ A;  3AG4 C;  1U6H A;  3MYF A;  3WOD F;  3NMK A;  1DOW A;  4JE9 A;  4EBJ A;  3JCU Q;  1NU9 C;  3S27 A;  1MND A;  3K1I A;  3QVY A;  1OKK D;  1ZHT A;  2AP3 A;  1NG1 A;  3KPH A;  1LPE A;  3N0T A;  4JJF A;  4JW1 A;  4MW3 A;  4YL3 A;  3JSZ A;  5JS5 A;  1TWA A;  1LE2 A;  2CYD A;  2CNW A;  4DRH B;  1VMA A;  2Q9B A;  4MND A;  2IXM A;  3Q7L A;  2EIL C;  2I8B A;  5A69 A;  1G4W R;  4YK5 A;  2I15 A;  2D5R B;  2HFI A;  2YQY A;  4MTO A;  3GEH A;  4Q7C A;  3L8I A;  3RF3 A;  4AX2 A;  1HW2 A;  4J30 B;  4F4B A;  1E86 A;  1LS4 A;  3NG1 A;  3F46 A;  2OOC A;  1YYX A;  5CI8 A;  1ZHZ A;  4O6N A;  4U5F E;  3TK0 A;  2CCY A;  3VYW A;  1T01 A;  3CEX A;  3GM2 A;  4ULW A;  2NG1 A;  3JT1 A;  1D1B A;  2EPN A;  1A7E A;  5HSW A;  3KL4 A;  4XLP F;  5L0G A;  1NLX A;  1E2X A;  5L0D A;  3S29 A;  3M15 A;  1D1C A;  1T9K A;  5D91 A;  3T6B A;  3U8P A;  1EQ1 A;  5F5H A;  2A0B A;  4BJ5 C;  2NPU A;  1K04 A;  3RH3 A;  3VM6 A;  2FAP B;  2G3V A;  4OIN F;  5B1B C;  3JTL O;  1EKY A;  1Q0K A;  1E83 A;  3JYH A;  4X0R A;  3RQF A;  3CSK A;  4PK4 A;  1EA8 A;  3U3B A;  2IXP A;  3C8G A;  3FHD A;  3S28 A;  2CDQ A;  1VYK A;  1T6I A;  4OIO F;  3O6X A;  4JVS A;  1ST6 A;  3WG7 C;  4ONS A;  4I1M A;  3AG1 C;  3MLG A;  2YL7 A;  3ATP A;  1L7C A;  4BEJ A;  3Q7G A;  1C03 A;  1YA9 A;  3U5S A;  2J46 A;  2J0W A;  4L6R A;  2P61 A;  2IBF A;  2NUT A;  4PFP A;  4NCQ A;  1KU2 A;  4N6H A;  2XXA B;  4LLE A;  4MVS A;  1J8Y F;  2QUP A;  2GDC A;  3IHU A;  3HLZ A;  1YAU O;  1I4Y A;  4MVO A;  3VF0 A;  2W45 A;  2OU6 A;  4NTF A;  3W2V A;  3C8G B;  2OKU A;  4O6Y A;  3BRJ A;  4W8P A;  2GA0 A;  3PMR A;  4EHP A;  5JSL A;  1JOG A;  5DQZ A;  2H7V C;  3EZH A;  4R32 A;  5A6A A;  2UUH A;  2LP4 A;  5E3C A;  3ABL C;  1HMD A;  4U5H A;  3C7J A;  1M56 C;  1Q0G A;  1RMV A;  4U5E E;  3EHM A;  5T1D B;  5IY5 C;  2W4B A;  2J9U A;  3DM9 B;  4O6M A;  4WGZ A;  1U89 A;  4LDR A;  4UDV A;  2NUT B;  3AGU A;  2VCC A;  5FZT A;  3TUL A;  4J7T A;  3LUT B;  2G3K A;  5COF A;  3ABM C;  4ANJ A;  2Y3G A;  4NTA A;  2PFD A;  3AOU A;  2B0H A;  3PDM P;  4P9F A;  4ZLD A;  2XM4 A;  3AG3 C;  3ITF A;  2P1A A;  1RKE A;  4GEH A;  5COM A;  1PCX A;  2KNH A;  2VB6 A;  2YLD A;  4E18 A;  1M6T A;  1QZX A;  3K1I C;  4KNW A;  3TOM A;  1L3P A;  4BJ1 A;  3U8V A;  1A7D A;  4CJO A;  3R7C A;  2XM0 A;  3QMK A;  3ZVR A;  3AQC A;  1QSP A;  2L6F A;  3DJU B;  1V55 C;  3G4X A;  3KKB A;  4IWB A;  5D92 A;  2ASR A;  3U2L A;  1IZM A;  1MMN A;  2YWA A;  3U3F A;  3U9M A;  3V5X A;  4LAC B;  2HSB A;  3LNR A;  1JPJ A;  3OEO A;  5A6K A;  3EFO B;  2NSG A;  2R05 A;  2WL8 A;  4W8K A;  2CW0 F;  4J7Y A;  5DS4 A;  1TQG A;  2M4E A;  2R7O A;  2ZD9 A;  3DWW A;  1K40 A;  2GWW A;  2Q4F A;  3U0C A;  1RKE B;  3B9Q A;  2J9V A;  5A6B D;  1LVK A;  2EPM X;  2A69 F;  1T6Q A;  5EK0 A;  5F28 E;  1NFN A;  1KTM A;  1C02 A;  1QQ3 A;  1VLT A;  3LS0 A;  2R7V A;  1G8X A;  4E7Z A;  1ZHW A;  2L6G A;  5TJ5 E;  4IAR A;  1RXQ A;  1YZC A;  4BJ6 A;  1YDI A;  3HNL A;  2Q00 A;  3JRT A;  2OJE D;  4IAO A;  3RIP A;  1HY5 A;  3EG9 A;  1OW8 A;  3RVY A;  2C04 A;  2Y3H A;  2G62 A;  3DI5 A;  3M79 A;  3QW0 A;  2IYL D;  2XL8 A;  3ZWI A;  1TR2 A;  2QE9 A;  4DOZ A;  3L0I A;  2BC5 A;  2J7P A;  4WGY A;  1YVI A;  3GEI A;  4CDV A;  4JCH A;  4BJT A;  3RKO F;  1YA7 O;  2XLD A;  2J0X A;  2J9W A;  4RBN A;  5KYU B;  2VCB A;  4E7S A;  2J8W A;  4FAP B;  4O7G A;  1WAT A;  1Y6D A;  1ZVZ A;  1JPN A;  2GFH A;  4O79 A;  3UGP A;  4N6C A;  2HJ3 A;  256B A;  1OXK A;  2CNW D;  2ZXR A;  4DJ9 A;  3SYN A;  2HS5 A;  3MX3 A;  5KYX A;  2MYS A;  5KYW B;  3IQ5 A;  3VRC A;  5JLI A;  3KYJ A;  3EG9 B;  3M1C B;  3N2Z B;  4I44 A;  3ZC4 A;  3TJ5 A;  2YL0 A;  4BG0 A;  1QPU A;  2WVQ A;  3TD7 A;  4DVY P;  4JC7 A;  4JRZ A;  4EUK B;  3FDQ A;  3POV A;  4OIP F;  3JYY A;  4DRI B;  5L0J A;  1K05 A;  1QKR A;  2B0J A;  5KYY B;  4JUR I;  1OQC A;  4XLN F;  5JVE A;  2XLE A;  1CGO A;  2ZXW C;  3AQB A;  3W2W A;  4RDA A;  1BZ4 A;  1TFK B;  1ZHX A;  3E70 C;  5EHH A;  2R02 A;  1JAF A;  4I1O B;  4K1O A;  1A0B A;  3T9O A;  5KYX B;  1M2O A;  3E9V A;  4JZA A;  1Q0F A;  2WVO A;  4WJ0 A;  3BEH A;  1WN0 A;  2XRH A;  3Q6N A;  4QI0 A;  3T6J A;  1VB5 A;  2A1D D;  1G4U S;  4MVR A;  4N06 A;  1C17 M;  4CJG A;  2BL2 A;  2XS1 A;  3C8G D;  4H54 A;  3MYI A;  4AE4 A;  4CS8 C;  4EIY A;  2YZS A;  1APC A;  1BDJ B;  4PJL A;  4C3D A;  4JEA A;  4YT8 A;  1A41 A;  4CS9 C;  3S84 A;  2FFH A;  2XXA A;  5E33 A;  5T3T A;  1T6U A;  4OIR F;  5A6J A;  4XQ1 A;  2P6V A;  2W9Y A;  3CZ6 A;  2IXN A;  1ORY A;  5AC4 A;  2OQM A;  4U9E A;  4YJW A;  4Q5S F;  3G4Z A;  1LKX A;  3RVZ A;  1ZU4 A;  1B68 A;  3UR3 C;  3B0P A;  4CBE A;  2PNO A;  3FOP A;  4JEB A;  2EPL X;  2HUJ A;  1Q0D A;  2YL1 A;  2QY9 A;  4AE4 B;  4U5G A;  1PD1 A;  1WGW A;  2P7V A;  1PD0 A;  2DYR C;  1TWH A;  3IPM O;  1AUE A;  2OJQ A;  3NMJ A;  4JTD B;  4ZLC A;  4IGG A;  3SP1 A;  2L6H A;  2QTV A;  2L81 A;  3RQG A;  4ULV A;  2LCH A;  3UGO A;  1I5N A;  4YT5 A;  1V54 C;  3PCV A;  3QVZ A;  1AEP A;  3G50 A;  2C03 A;  2R7R A;  2RD9 A;  4YL1 A;  4NY3 A;  1R4T A;  4IAQ A;  1BBH A;  3DAF A;  3QW1 A;  3JRM O;  4IB4 A;  3DKA A;  3SEO A;  3SNH A;  3LS1 A;  4MVZ A;  4Z9H A;  3W8I A;  3ABK C;  2RSE B;  4U5C E;  5E2Q A;  4PFO A;  3RW0 A;  3ZTM A;  5BQH A;  4FES A;  5DVW A;  3EFO A;  1LI7 A;  4XEK A;  1CGN A;  3I5P A;  2YLG A;  4E0I A;  3RFY A;  2AWC A;  1OW6 A;  3EHN A;  4U9D A;  3MFN A;  2Y39 A;  1LS1 A;  4EWC A;  3GM1 A;  3ZQV A;  1OW7 A;  1SYQ A;  1F1M A;  1Z6A A;  3C62 A;  3IQC A;  3SXM A;  2EIM C;  2XLV A;  2HSQ A;  3EGD A;  1YAR O;  3GWL A;  2XLO A;  4YWQ A;  1BR1 A;  3UNG C;  3ZQY A;  4LDQ A;  1TWC A;  3VAY A;  2YL3 A;  3FVY A;  3GOR A;  3KH2 A;  2XL6 A;  1LI5 A;  2WZG A;  2DI3 A;  3LEO A;  4QI2 A;  3NYJ A;  2F22 A;  1MMG A;  2DGJ A;  3F47 A;  3FOO A;  2PBE A;  3LLI A;  2WB7 A;  2Z15 A;  2LFD A;  4MTF A;  3RQE A;  1VYI A;  3FAJ A;  2NSF A;  3AG2 C;  3UMK A;  1CPQ A;  3GWN A;  1W2W A;  3U9J A;  2GAQ A;  5DS5 A;  1V74 B;  1ZU5 A;  4KC9 A;  4CX9 A;  4E0H A;  1CGM E;  1RJ9 A;  2M64 A;  2H7O A;  4B6I A;  4EBK A;  2V3C C;  2LQG A;  1FFT C;  1YZA A;  2EIK C;  5KYU A;  4CSA A;  1N1C A;  2EPK X;  3EGD B;  1ZZP A;  3SXY A;  2DB4 A;  1NU7 D;  4MVM A;  2JD3 A;  4BJ5 A;  2H8A A;  3K7D A;  1FMV A;  3C63 A;  3DE9 A;  3DXJ F;  1GM5 A;  4XPW A;  1VK5 A;  5KYW A;  3NYM A;  1XWJ A;  3H65 A;  1M2V A;  5BQG A;  1Z5Z A;  2XSE A;  2W4M A;  1ZHY A;  4E17 A;  5JUA A;  2E87 A;  3NMI A;  3WAQ A;  4IJJ A;  4NC3 A;  3HNK A;  1HE9 A;  1RJ9 B;  3TQO A;  3ZSU A;  2IM8 A;  4LLC A;  3DMD A;  1NZE A;  2Y3D A;  3O55 A;  4NQF A;  3T4R A;  4CS7 A;  4G7Z F;  2KK1 A;  5KYY A;  4K7B A;  2BE5 F;  1QLE C;  3DAG A;  3V7O A;  1D0Y A;  5JRA A;  2A6E F;  2R7T A;  4XTK A;  2WZF A;  4MW8 A;  3ZDL A;  5DQT A;  3JSE O;  3C18 A;  4QDL A;  1FFH A;  2YHS A;  4YT4 A;  3LES A;  3W8H A;  5DS6 A;  1M2V B;  1XZP A;  2Y69 C;  2KQ9 A;  3FAP B;  1YYJ A;  2R7S A;  2KJG A;  4XEF A;  2V26 A;  4C7O B;  1BR4 A;  3IEE A;  4HE8 D;  2Y3B A;  3EH2 A;  2XLM A;  1ORS C;  4G7H F;  3JZ0 A;  1TKN A;  2XLW A;  2YVK A;  2AVK A;  3LAY A;  5CI9 A;  1FNT c;  1RKC A;  3OA1 A;  5B3I A;  3N24 A;  2OG2 A;  5F5F A;  3HNI A;  4AK9 A;  1LIH A;  4MVU A;  2XLH A;  1EI7 A;  4FX5 A;  2J45 A;  2ZPA A;  4PJJ A;  1M57 C;  4AL0 A;  4H4K C;  3WHN A;  3HJC A;  4JJG A;  1S05 A;  1MMA A;  2VH3 A;  4HFF B;  4Z9I A;  5L0H A;  5L0I A;  4GQH A;  3HKK A;  1Q0M A;  2O9X A;  2PX3 A;  4MTG A;  3ASO C;  3SXK A;  4JTC B;  2VC9 A;  5COG A;  1NBB A;  2R7W A;  3ZTZ A;  3ECS A;  2MHR A;  3FXH A;  3J06 A;  5FCL A;  1SR2 A;  1G5Z A;  1HE1 A;  5DLJ A;  5AC5 A;  4KNV A;  1D0Z A;  1D0X A;  4A2N B;  1OCC C;  2IXO A;  1OKK A;  1O87 A;  4DXW A;  1LM3 B;  3PHF 2;  1R5I D;  2J9B A;  1SF8 A;  5KYN A;  2HKV A;  2PF4 E;  4PJM A;  3B29 A;  1U0B B;  1E85 A;  3NKD A;  1OCR C;  1Z3I X;  3I4U A;  1I4Z A;  2R9R B;  2PP4 A;  1H9G A;  2PX0 A;  1GGQ A;  2ETS A;  1WAS A;  3H2V A;  2LIG A;  1OR2 A;  3ASN C;  3GOD A;  4OD4 A;  3S0X A;  3EJN A;  4LER A;  4P9T A;  4LDK A;  1Z63 A;  2FGY A;  4G78 A;  1BR2 A;  3S90 A;  4PJN A;  3IQT A;  4CSA C;  3US6 A;  1LE4 A;  3B0U X;  1IW7 F;  3ZIB A;  2WVN A;  2VAS A;  3K33 A;  2X51 A;  1OCO C;  1TFO B;  3Q6M A;  3UMI A;  2Q3T A;  2YKZ A;  4DRJ B;  2R7X A;  1T5O A;  4BJ6 C;  2WZL A;  3EPV A;  1KNY A;  2JPU A;  3UMH A;  4P6I C;  2OEX A;  1CPR A;  1UFB A;  2VCA A;  4CIH A;  3HNJ A;  4OD5 A;  4C3B A;  4PAC A;  1FMW A;  2L9J A;  1OXB A;  3TJ6 A;  2A0U A;  3ZG1 A;  4DBR A;  3A9C A;  4Q4Z F;  1SZI A;  3LNM B;  3A11 A;  4HFK B;  2A68 F;  1JR8 A;  1MNE A;  1V4A A;  1YJG A;  1ORJ A;  3AGT A;  1AVO B;  3M4C A;  3M4B A;  3LJB A;  1WTY A;  1NSG B;  1TWG A;  3IQ6 A;  3NKE A;  3V5Z A;  3X1O A;  2ZXP A;  3L8J A;  5AGF A;  4YT2 A;  5JT4 A;  1ZYR F;  3FMS A;  4M63 A;  3QTH A;  2UUI A;  2IOQ A;  3KMI A;  1ZW2 A;  1NFO A;  5L0C A;  1PV3 A;  1E84 A;  4XPX A;  4CDY A;  2HMQ A;  2CGE A;  1GS9 A;  2R7U A;  4A4A A;  4U5D E;  4CDA A;  3SZR A;  4JCZ A;  3LLK A;  5L3V A;  1H6G A;  2TMV P;  5T3W A;  4BEM J;  3B71 A;  1FTS A;  1D1A A;  2HV7 A;  1S7Z A;  1SMY F;  4G0H A;  4DBQ A;  2H7B A;  1Z23 A;  2QNL A;  1J8M F;  2P0N A;  2Q9A A;  3C8Z A;  3GEE A;  3L34 A;  3O10 A;  1JMW A;  3OWT A;  3S9O A;  4XEV A;  2HJM A;  4KBL A;  1XZQ A;  4XWJ A;  4KI2 A;  3NYL A;  4MVQ A;  1HMO A;  3V5Y A;  3LEV A;  1FR0 A;  4I3M A;  4NTB A;  1VTM P;  1O3U A;  1VOM A;  2JX0 A;  2LD6 A;  3W4Y A;  5K0I A;  1ZW3 A;  1QVX A;  4CS8 A;  2LK4 A;  2LSE A;  4C3E A;  4DVZ A;  2R03 A;  4MQ9 F;  4FWV A;  2ZXO A;  5B1A C;  4CS9 A;  1O5H A;  4CIP A;  3R2P A;  4OIQ F;  2J7P D;  2KSF A;  2X0C A;  3KYI A;  2KGO A;  2D4U A;  4MS2 A;  3H2U A;  4EBB A;  5BUO A;  2R7Q A;  3RYL A;  3CAX A;  3EGX A;  4BPM A;  1OCZ C;  1UG7 A;  2XL4 A;  1OR3 A;  3GM3 A;  2ICW G;  3EZI A;  3O39 A;  2XS8 A;  3HTK C;  4J32 B;  2KC3 A;  4XPY A;  4RD9 A;  2LFF A;  5GPG B;  4EKW A;  3GAN A;  4YN0 B;  3X2Q C;  2OCC C;  4C7O A;  3B0V C;  2EPO A;  2Q7R A;  4N4W A;  3NRH A;  1Z7Q c;  2L7A A;  2EIJ C;  2YLI A;  2AWY A;  3DD7 A;  3MBG A;  2KYH A;  3I5Q A;  4U5B E;  1GQA A;  3K66 A;  4IRU A;  4K0D A;  3NDB B;  5BQI A;  4HEA J;  4WAB A;  1A7V A;  5L3Q A;  2YRF A;  1MQV A;  2MWQ A;  2NUP A;  1VLS A;  3EQL F;  4JIO A;  4PR9 A;  3DM5 A;  5JP7 A;  1H9T A;  2QLA A;  3QZC A;  2HMZ A;  2EIN C;  1FAP B;  3EGX B;  3K6B A;  1MMD A;  3AJM A;  5A6B A;  2AU5 A;  4JKV A;  4D4X A;  5HV9 A;  5L0F A;  1YLM A;  3U2M A;  3DJN B;  1RCP A;  2OEV A;  5E3A A;  5B3S C;  4GYT A;  2A6H F;  1HW1 A; 
#chains in the Genus database with same CATH homology
 1ST6 A;  4ONS A;  1RKC A;  1L7C A;  1U89 A;  3TJ6 A;  2L7A A;  5FZT A;  1DOV A;  1T01 A;  3H2V A;  4K1O A;  2GWW A;  1ZVZ A;  1RKE B;  4P9T A;  3T6G B;  2LQG A;  2IBF A;  1U6H A;  2B0H A;  4DJ9 A;  1DOW A;  3ZDL A;  1ZW3 A;  3S90 A;  5L0G A;  1ZW2 A;  1RKE A;  4PR9 A;  5L0C A;  2GDC A;  4E18 A;  5L0D A;  5L0H A;  5L0I A;  3MYI A;  3VF0 A;  1SYQ A;  4IGG A;  2HSQ A;  1YDI A;  2X0C A;  3TJ5 A;  5L0F A;  3H2U A;  4W8P A;  4EHP A;  1H6G A;  1XWJ A;  4E17 A;  5L0J A;  1TR2 A;  1QKR A;  3RF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...