1ZW3A

Vinculin head (0-258) in complex with the talin rod residues 1630-1652
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
251
structure length
251
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
molecule tags Protein binding
source organism Gallus gallus
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
total genus 108
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zw3A01
5L0HA 4W8PA 4E18A 1ZW3A 1DOVA 2IBFA 4K1OA 5FZTA 5L0DA 4E17A 4ONSA 4DJ9A 2HSQA 1RKCA 1TR2A 3S90A 2GWWA 1SYQA 4EHPA 1T01A 1QKRA 3T6GB 1ST6A 4IGGA 1RKEA 3H2UA 1ZVZA 1L7CA 3VF0A 1RKEB 2GDCA 3H2VA 1DOWA 4P9TA 3MYIA 4PR9A 1U89A 1ZW2A 1YDIA 1H6GA 1XWJA 5L0GA 1U6HA 5L0CA 3TJ6A 2B0HA 5L0FA 5L0JA 2LQGA 3RF3A 3ZDLA 2X0CA 5L0IA 3TJ5A 2L7AA
chains in the Genus database with same CATH superfamily
4W8PA 2XSEA 1ZW3A 3QTHA 1QLEC 3BEHA 2J9UA 4ZLDA 2HSBA 4LDQA 4LLCA 3O55A 3B9QA 1C03A 1G5ZA 3B0PA 3GEHA 3EGXA 2R7OA 3TK0A 3R7CA 3ZQYA 5BQHA 5E2QA 4N4WA 3GM2A 2L6FA 3MBGA 4G78A 4BG0A 3U9JA 1DOWA 2YKZA 4JEAA 3DXJF 2FFHA 3JSZA 3W4YA 5KYXA 3JZ0A 2LIGA 2ICWG 2DYSC 1K05A 1PV3A 1YARO 2WZFA 2QY9A 3L8JA 3FAPB 3M1CB 4JCZA 1YVIA 2B0JA 2G3VA 4A2NB 4CDAA 3EG9B 4JJGA 4DRJB 3PMRA 4MTOA 1NLXA 5F5HA 5E3CA 2L7AA 3AG3C 1Z23A 3NRHA 5E3AA 1Q0DA 4OINF 5KYWB 3KYIA 4E0IA 1ZYRF 4LDRA 3WODF 5KYUB 2HSQA 2Y3HA 2GFHA 2KJGA 1M56C 1G4WR 4YT2A 2YZSA 2IXOA 2ZD9A 3EZHA 4FESA 3B71A 1H9TA 3JSEO 1CPQA 4EWCA 3C18A 3Q7GA 2VC9A 3QW0A 3KMIA 3IQ6A 4PFOA 5A69A 3V5ZA 1NFNA 2P0NA 3AGUA 3GWNA 1YA7O 4IAOA 5DVWA 3ZTZA 5DQZA 3KKBA 4CDVA 4CJOA 2J9WA 5T3TA 2Y39A 2NUPB 3UMHA 1QSPA 2QLAA 4DRHB 1FFTC 1OW6A 1WATA 1AEPA 1Y4CA 2A69F 2P6VA 1Q0FA 2KNHA 5B3SC 5JUAA 3B0VC 1ORSC 3VRCA 4I1MA 4KBLA 4OD4A 3ZDLA 3ZTMA 5L0IA 4IJJA 4AL1A 4YL1A 2D5RB 3LJBA 3ABKC 5CI9A 2EPMX 1OCRC 3DE8A 5B1AC 5JVEA 4PFPA 4XPYA 2MWQA 3GODA 2FAPB 3ITFA 1OCCC 4CIHA 5E33A 4BPMA 4U5DE 2A68F 2HS5A 1RKEA 2H7OA 2GDCA 4FWVA 4OIRF 3L34A 1LS1A 1UG7A 1NU9C 1WTYA 1YA9A 1N1CA 2OKUA 3AOUA 3U3BA 3ZG1A 2G3KA 1TFOB 1VLTA 4WGZA 1I4ZA 2KC3A 4EBBA 5CIVA 4E7SA 3W8IA 1E85A 2R7WA 3NKEA 4BJ5C 2Y69C 3KH2A 3DZAA 4BJ6C 4XPXA 4PK4A 2GAQA 4N6HA 4CS8A 2XS1A 4EBJA 1G8XA 4GEHA 5A6JA 2XM0A 1E84A 4KI2A 3IQCA 2M64A 2Q7RA 4MVQA 1SMYF 2XLVA 2L6GA 4CX9A 4C7OA 3CAXA 4BJ6A 3I5PA 2NUTA 3RW0A 3ABMC 2OOCA 3O6XA 4XEKA 1APCA 1ZZPA 3C7JA 4DVZA 3M15A 3GM3A 3H2VA 1FR0A 3N0TA 4O7GA 3QVYA 2A6HF 2H7VC 2EPOA 1OW8A 2VB6A 2YLGA 3ABLC 3DI5A 3K7DA 3NYJA 4YWQA 4RBNA 4XWJA 4JTCB 2IXPA 2P61A 3RQGA 2RD9A 1Z7Qc 5KYNA 2NUPA 4U5GA 4NTBA 1RCPA 1LVKA 2YEVA 3HTKC 4LACB 4OIOF 1T6IA 2BL2A 3Q7LA 4DRIB 1M2VA 4I44A 3OA1A 1DOVA 3LEVA 1FNTc 3JTLO 4MTFA 4E17A 4ONSA 1SZIA 2EPKX 3IEEA 1LKXA 4E7ZA 1WWPA 4HEAJ 4U5CE 2Y3GA 4GYTA 3HNIA 5KYUA 1KTMA 3F46A 4G0HA 2EIKC 4Z9IA 1NFOA 1H7IA 2WL8A 4Q7CA 4BEJA 3UNGC 4AX2A 2J46A 3A9CA 3IHUA 3PDMP 3Q6NA 4JTDB 3ASOC 2W4MA 3SXKA 4NY3A 1NBBA 1QQ3A 3QZCA 5JP7A 4Q4ZF 1Q0MA 1U6HA 2CYDA 1VLSA 2WVQA 4C3BA 4H54A 2R03A 3AGTA 4RD9A 1VK5A 4MVUA 2FGYA 1ORJA 3CSKA 1VMAA 3TD7A 4DBQA 1TWAA 5BQIA 1IW7F 1XZQA 3B29A 3CEXA 4YT4A 2VASA 1HW2A 5FZTA 4LLEA 4U9EA 2IM8A 3NKDA 4U9DA 5TJ5E 2PX0A 3K66A 2VCAA 4Q5SF 3SZRA 5KYYB 4JVSA 4NC3A 4NTAA 3NMJA 1GS9A 1L7CA 2AU5A 1OKKA 2NPUA 3MYIA 2WVOA 2Q9BA 4DOZA 4O6MA 4X0RA 2C04A 2XRHA 4NCQA 1A41A 1EI7A 2YHSA 1C17M 2ASRA 1XWJA 3TOMA 4YT8A 1HW1A 4JC7A 1CGNA 3TJ6A 1D1CA 4YL3A 3LEOA 3FOOA 4YL0A 4GQHA 2Q4FA 2G62A 3C8GB 2YL0A 2YQYA 256BA 1T5OA 3E9VA 3NYLA 5COMA 1JMWA 1RXQA 2YL3A 1LI7A 1ZHXA 2QE9A 1OXBA 3LUTB 2EINC 2YWAA 1VYIA 4J32B 3U8PA 2CNWA 1HY5A 2L81A 3EGDA 5L0DA 3HLZA 3IQTA 2XL6A 3MYFA 4CJGA 3LLIA 1TWCA 4MS2A 5D92A 2QTVA 2E87A 3QW1A 4U5BE 1WOLA 2GWWA 2EPLX 1I5NA 2OEXA 4WABA 4XTKA 3DWWA 1UFBA 2IOQA 1H9GA 2HMQA 1BDJB 2LFFA 1WN0A 3C62A 1M2OA 3U0CA 1MMDA 2HJ3A 4MVRA 3T9OA 1IZMA 2PFDA 1JPNA 1KU2A 3SEOA 1A7EA 2OEVA 2CDQA 4PJMA 3IQ5A 3GEIA 2HFIA 1KNYA 2ZPAA 2R7XA 3LNRA 1ZHWA 2B0HA 1RJ9A 2XL4A 3AQBA 2R7RA 1XZPA 5COFA 3MLGA 3FHDA 1LE2A 1R5ID 4HE8D 5T1DB 2X0CA 2HZ8A 2V3CC 2OJQA 1TQGA 1GM5A 3UMIA 2LP4A 1JAFA 1LIHA 3TQOA 3GANA 1M6TA 4WJ0A 1ZU4A 2RSEB 4K1OA 4MVZA 3U2LA 1T6QA 2MYSA 2XM4A 2PX3A 3FXHA 4C3DA 1WGWA 1O3UA 4CDYA 1OQCA 5EGYA 2Q3TA 3K1HA 4N06A 3AG1C 2XS8A 3Q6MA 1MMNA 2W9YA 3KPHA 4J7TA 1VTMP 1F1MA 2Q9CA 3O10A 3US6A 3JCUQ 2HKVA 2LK4A 2JX0A 1YJGA 1ZW2A 3HJCA 5K0IA 3DAGA 2VH3A 2A6EF 1FMVA 3C8GD 2LCHA 3IPMO 3WHNA 4AE4A 2PNOA 1MMAA 2AWCA 3DAFA 1J8MF 4MW8A 4ER9A 2KW3C 1M2VB 3K33A 2XLOA 4AE4B 5FCLA 2IYLD 3RF3A 4JZAA 1T6UA 3ASNC 4LERA 3EHMA 5DLJA 4G7OF 1D1AA 2J9BA 2BE5F 5COGA 4Z9HA 2J0XA 3LAYA 3HKKA 3FMSA 1BBHA 3JRMO 4OIQF 1QZXA 1RKCA 1JR8A 4I3MA 4CSAC 1TKNA 3UGOA 4IGGA 3E70C 3H2UA 1OR2A 4CS9C 3MX3A 2KSFA 4PJJA 1ZU5A 1OCOC 1YYXA 1ZHZA 4QDLA 3JT1A 3AG4C 2R7UA 4ULWA 3J06A 3H65A 3RYLA 1Z3IX 2XL8A 3EG9A 2UUIA 3L8IA 4ULVA 4XLNF 4BEMJ 4MNDA 1HMDA 4YJWA 3QVZA 4F4BA 5L0FA 2WVNA 2OU6A 2YLDA 2Z15A 5L0JA 3VAYA 4G7HF 2TMVP 5HV9A 3NDBB 3RIPA 3M4CA 1B68A 3AJMA 4L6RA 3DKAA 4E18A 2AWYA 2WB7A 4DBRA 2MHRA 1K04A 5IY5C 1L3PA 3S0XA 2KQ9A 1GGQA 3ZSUA 3FOPA 4XEFA 3U5SA 1K40A 1T01A 2UUHA 4EHPA 5DS5A 1CPRA 1FFHA 2XLDA 1RKEB 3U9MA 2XXAB 3GEEA 3NMIA 4PR9A 5A6BD 4QI2A 5F28E 4K0DA 2AVKA 1H6GA 2PF4E 1QVXA 4JRZA 3DJUB 4IAQA 4JCHA 4KNVA 1PCXA 4HFFB 3L1MA 4JE9A 1CGOA 2YL1A 1TWGA 2WZLA 1Z63A 2X51A 2F22A 3ZWIA 4A4AA 1LPEA 5BQGA 2EIJC 2OJED 5B1BC 3VM6A 2YLIA 1C02A 1ZHTA 5JS5A 3PHF2 4J30B 3T6JA 3FDQA 5KYYA 5AGFA 2DB4A 4MVMA 2J8WA 1TR2A 3S90A 2BC5A 3DE9A 3LESA 4YK5A 4YT5A 3CQZA 4MTGA 3S29A 3UGPA 2YL7A 2GA0A 3I5QA 1PD0A 4FX5A 2Q9AA 4O79A 3ATPA 3HNLA 5D91A 3G50A 1U89A 2H8AA 3LS0A 1O5HA 1YDIA 2YVKA 3W2WA 2R7TA 3K6BA 5EHHA 1D0YA 1A7VA 2R7SA 3LS1A 1VYKA 4EBKA 3RQEA 3T4RA 3G4XA 4C3EA 4QI0A 1MQVA 2EILC 2LFDA 3JRTA 1LI5A 3LNMB 5KYWA 4XLPF 2P7VA 4OD5A 3UMKA 3RH3A 1OCZC 3T6BA 5L3QA 5F5FA 1CGME 1T9KA 2M4EA 2DI3A 5HSWA 4G7ZF 3DM9B 1GQAA 2CNWD 2HJMA 3K1IA 4D4XA 4AK9A 2I8BA 3B0UX 1AUEA 4RDAA 4N6CA 3GWLA 4DXWA 4HFKB 1FMWA 4O6YA 4J7YA 4XPWA 2HV7A 1LM3B 5DS6A 1EKYA 3EQLF 1MNDA 1V74B 3VF0A 2R7VA 2EIMC 4NTFA 3ZC4A 1EA8A 5DS4A 3OEOA 3SXZA 3POVA 1BR4A 3DM5A 4YN0B 2C03A 2CGEA 2L9JA 2CCYA 4M63A 4EUKB 2OG2A 1MNEA 2Y3DA 2A1DD 2J9VA 3LLKA 2NSGA 1A7DA 3WG7C 2KYHA 2R9RB 5JSLA 4FAPB 1Z5ZA 4R32A 4XEVA 2YRFA 4XQ1A 5GPGB 3AG2C 4JKVA 3O39A 4WGYA 5CI8A 2W4BA 2DGJA 4JURI 3RVZA 3TOLA 3EPVA 3K1IC 3U8VA 4B6IA 1ORYA 2R02A 3W8HA 1LS4A 4BJTA 5BUOA 3C8ZA 1FAPB 3SP1A 4ZLCA 2NUTB 4P9FA 3ZIBA 1V55C 1VOMA 1D0ZA 4JEBA 4JTAB 1YZCA 4EIYA 4UDVA 4JW1A 1U0BB 1NZEA 2QUPA 4Z9JA 4CS7A 2I15A 1QPUA 3OWTA 2JPUA 4BJ1A 1D0XA 1E86A 1AVOB 1V54C 1V4AA 2EPNA 3AQCA 2HMZA 3EFOB 4JIOA 3WAQA 1M57C 2L6HA 2ZXWC 1R4TA 1RJ9B 1S05A 4C7OB 3RQFA 2LSEA 2J7PA 3S28A 4W8KA 2LQGA 1W2WA 3N24A 2J7PD 3CZ6A 4NQFA 3SXYA 4CS8C 2ZXRA 1HMOA 1J8YF 1A0BA 1Z6AA 4PACA 4BJ5A 4CS9A 2Q00A 2R25A 1YZAA 1SR2A 4OIPF 3RVYA 3ZVRA 4PJNA 2LD6A 2OQMA 5A6BA 1YAUO 4ANJA 1G4US 2QNLA 3N2ZB 1SF8A 2PP4A 5JRAA 1SYQA 3V5YA 2W45A 3EGDB 3T6GB 1ST6A 2OCCC 3EHNA 4MVSA 3EH2A 1ZVZA 3EZIA 3U3FA 4CSAA 1Q0KA 2XLEA 3DD7A 3W2VA 4CBEA 5B3IA 2ZXPA 4MQ9F 3DJNB 4LDKA 4DVYP 1EQ1A 3UR3C 3M79A 3FVYA 5JLIA 1YYJA 1HE1A 5DQTA 3SYNA 5A6KA 2HV6A 4JJFA 3X1OA 3S27A 1VB5A 4AL0A 5JT4A 2H7BA 3TULA 3X2QC 1S7ZA 4IB4A 1D1BA 3PCVA 3NYMA 3RFYA 5AC5A 3ECSA 2ETSA 2PBEA 1E2XA 3EH1A 3FAJA 4IARA 2VCBA 2DYRC 1LE4A 1OKKD 4DJ9A 4P6IC 1OW7A 1Y6DA 2IXNA 2VCCA 3JYHA 5EK0A 3V5XA 3QMKA 4PJLA 1QKRA 1NG1A 1FTSA 2Y3BA 4D4NA 1OXKA 4E0HA 1RMVA 2O9XA 2A0UA 1BR1A 2D4UA 3L0IA 4U5FE 3RKOF 2J0WA 2P1AA 2WZGA 3V7OA 1Q0GA 2ZXOA 2NG1A 4MW3A 3S9OA 1TFKB 4K7BA 3NMKA 3GM1A 1O87A 3JYYA 3R2PA 2IXMA 1MMGA 4H4KC 2KK1A 2XLHA 5T3WA 1ZHYA 3TJ5A 3M4BA 4MVOA 2JD3A 2KGOA 1I4YA 2HUJA 2NSFA 3A11A 5L0HA 3S84A 5AC4A 3KYJA 2IBFA 1NSGB 1NU7D 5KYXB 1OR3A 4IWBA 3EFOA 3EGXB 1JOGA 3I4UA 5A6AA 2CW0F 2V26A 2R7QA 3U2MA 2J45A 3HNJA 1JRAA 3EJNA 4KC9A 3F47A 3ZQVA 4I1OB 3DMDA 3NG1A 4U5EE 3SXMA 2XLMA 4P9TA 3HNKA 1HE9A 3VYWA 1BZ4A 3C8GA 2XLWA 3SNHA 1TWHA 1YLMA 4EKWA 1PD1A 5L0GA 3MFNA 5L3VA 3GORA 5L0CA 1E83A 3C63A 2R05A 1JPJA 1WASA 1BR2A 3KL4A 4KNWA 2XXAA 2A0BA 2AP3A 4O6NA 3BRJA 4IRUA 3G4ZA 4U5HA 4CIPA
chains in the Genus database with same CATH topology
5L0HA 4W8PA 4E18A 1ZW3A 1DOVA 2IBFA 4K1OA 5FZTA 5L0DA 4E17A 4ONSA 4DJ9A 2HSQA 1RKCA 1TR2A 3S90A 2GWWA 1SYQA 4EHPA 1T01A 1QKRA 3T6GB 1ST6A 4IGGA 1RKEA 3H2UA 1ZVZA 1L7CA 3VF0A 1RKEB 2GDCA 3H2VA 1DOWA 4P9TA 3MYIA 4PR9A 1U89A 1ZW2A 1YDIA 1H6GA 1XWJA 5L0GA 1U6HA 5L0CA 3TJ6A 2B0HA 5L0FA 5L0JA 2LQGA 3RF3A 3ZDLA 2X0CA 5L0IA 3TJ5A 2L7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0H A;  4W8P A;  4E18 A;  1ZW3 A;  1DOV A;  2IBF A;  4K1O A;  5FZT A;  5L0D A;  4E17 A;  4ONS A;  4DJ9 A;  2HSQ A;  1RKC A;  1TR2 A;  3S90 A;  2GWW A;  1SYQ A;  4EHP A;  1T01 A;  1QKR A;  3T6G B;  1ST6 A;  4IGG A;  1RKE A;  3H2U A;  1ZVZ A;  1L7C A;  3VF0 A;  1RKE B;  2GDC A;  3H2V A;  1DOW A;  4P9T A;  3MYI A;  4PR9 A;  1U89 A;  1ZW2 A;  1YDI A;  1H6G A;  1XWJ A;  5L0G A;  1U6H A;  5L0C A;  3TJ6 A;  2B0H A;  5L0F A;  5L0J A;  2LQG A;  3RF3 A;  3ZDL A;  2X0C A;  5L0I A;  3TJ5 A;  2L7A A; 
#chains in the Genus database with same CATH topology
 4W8P A;  2XSE A;  1ZW3 A;  3QTH A;  1QLE C;  3BEH A;  2J9U A;  4ZLD A;  2HSB A;  4LDQ A;  4LLC A;  3O55 A;  3B9Q A;  1C03 A;  1G5Z A;  3B0P A;  3GEH A;  3EGX A;  2R7O A;  3TK0 A;  3R7C A;  3ZQY A;  5BQH A;  5E2Q A;  4N4W A;  3GM2 A;  2L6F A;  3MBG A;  4G78 A;  4BG0 A;  3U9J A;  1DOW A;  2YKZ A;  4JEA A;  3DXJ F;  2FFH A;  3JSZ A;  3W4Y A;  5KYX A;  3JZ0 A;  2LIG A;  2ICW G;  2DYS C;  1K05 A;  1PV3 A;  1YAR O;  2WZF A;  2QY9 A;  3L8J A;  3FAP B;  3M1C B;  4JCZ A;  1YVI A;  2B0J A;  2G3V A;  4A2N B;  4CDA A;  3EG9 B;  4JJG A;  4DRJ B;  3PMR A;  4MTO A;  1NLX A;  5F5H A;  5E3C A;  2L7A A;  3AG3 C;  1Z23 A;  3NRH A;  5E3A A;  1Q0D A;  4OIN F;  5KYW B;  3KYI A;  4E0I A;  1ZYR F;  4LDR A;  3WOD F;  5KYU B;  2HSQ A;  2Y3H A;  2GFH A;  2KJG A;  1M56 C;  1G4W R;  4YT2 A;  2YZS A;  2IXO A;  2ZD9 A;  3EZH A;  4FES A;  3B71 A;  1H9T A;  3JSE O;  1CPQ A;  4EWC A;  3C18 A;  3Q7G A;  2VC9 A;  3QW0 A;  3KMI A;  3IQ6 A;  4PFO A;  5A69 A;  3V5Z A;  1NFN A;  2P0N A;  3AGU A;  3GWN A;  1YA7 O;  4IAO A;  5DVW A;  3ZTZ A;  5DQZ A;  3KKB A;  4CDV A;  4CJO A;  2J9W A;  5T3T A;  2Y39 A;  2NUP B;  3UMH A;  1QSP A;  2QLA A;  4DRH B;  1FFT C;  1OW6 A;  1WAT A;  1AEP A;  1Y4C A;  2A69 F;  2P6V A;  1Q0F A;  2KNH A;  5B3S C;  5JUA A;  3B0V C;  1ORS C;  3VRC A;  4I1M A;  4KBL A;  4OD4 A;  3ZDL A;  3ZTM A;  5L0I A;  4IJJ A;  4AL1 A;  4YL1 A;  2D5R B;  3LJB A;  3ABK C;  5CI9 A;  2EPM X;  1OCR C;  3DE8 A;  5B1A C;  5JVE A;  4PFP A;  4XPY A;  2MWQ A;  3GOD A;  2FAP B;  3ITF A;  1OCC C;  4CIH A;  5E33 A;  4BPM A;  4U5D E;  2A68 F;  2HS5 A;  1RKE A;  2H7O A;  2GDC A;  4FWV A;  4OIR F;  3L34 A;  1LS1 A;  1UG7 A;  1NU9 C;  1WTY A;  1YA9 A;  1N1C A;  2OKU A;  3AOU A;  3U3B A;  3ZG1 A;  2G3K A;  1TFO B;  1VLT A;  4WGZ A;  1I4Z A;  2KC3 A;  4EBB A;  5CIV A;  4E7S A;  3W8I A;  1E85 A;  2R7W A;  3NKE A;  4BJ5 C;  2Y69 C;  3KH2 A;  3DZA A;  4BJ6 C;  4XPX A;  4PK4 A;  2GAQ A;  4N6H A;  4CS8 A;  2XS1 A;  4EBJ A;  1G8X A;  4GEH A;  5A6J A;  2XM0 A;  1E84 A;  4KI2 A;  3IQC A;  2M64 A;  2Q7R A;  4MVQ A;  1SMY F;  2XLV A;  2L6G A;  4CX9 A;  4C7O A;  3CAX A;  4BJ6 A;  3I5P A;  2NUT A;  3RW0 A;  3ABM C;  2OOC A;  3O6X A;  4XEK A;  1APC A;  1ZZP A;  3C7J A;  4DVZ A;  3M15 A;  3GM3 A;  3H2V A;  1FR0 A;  3N0T A;  4O7G A;  3QVY A;  2A6H F;  2H7V C;  2EPO A;  1OW8 A;  2VB6 A;  2YLG A;  3ABL C;  3DI5 A;  3K7D A;  3NYJ A;  4YWQ A;  4RBN A;  4XWJ A;  4JTC B;  2IXP A;  2P61 A;  3RQG A;  2RD9 A;  1Z7Q c;  5KYN A;  2NUP A;  4U5G A;  4NTB A;  1RCP A;  1LVK A;  2YEV A;  3HTK C;  4LAC B;  4OIO F;  1T6I A;  2BL2 A;  3Q7L A;  4DRI B;  1M2V A;  4I44 A;  3OA1 A;  1DOV A;  3LEV A;  1FNT c;  3JTL O;  4MTF A;  4E17 A;  4ONS A;  1SZI A;  2EPK X;  3IEE A;  1LKX A;  4E7Z A;  1WWP A;  4HEA J;  4U5C E;  2Y3G A;  4GYT A;  3HNI A;  5KYU A;  1KTM A;  3F46 A;  4G0H A;  2EIK C;  4Z9I A;  1NFO A;  1H7I A;  2WL8 A;  4Q7C A;  4BEJ A;  3UNG C;  4AX2 A;  2J46 A;  3A9C A;  3IHU A;  3PDM P;  3Q6N A;  4JTD B;  3ASO C;  2W4M A;  3SXK A;  4NY3 A;  1NBB A;  1QQ3 A;  3QZC A;  5JP7 A;  4Q4Z F;  1Q0M A;  1U6H A;  2CYD A;  1VLS A;  2WVQ A;  4C3B A;  4H54 A;  2R03 A;  3AGT A;  4RD9 A;  1VK5 A;  4MVU A;  2FGY A;  1ORJ A;  3CSK A;  1VMA A;  3TD7 A;  4DBQ A;  1TWA A;  5BQI A;  1IW7 F;  1XZQ A;  3B29 A;  3CEX A;  4YT4 A;  2VAS A;  1HW2 A;  5FZT A;  4LLE A;  4U9E A;  2IM8 A;  3NKD A;  4U9D A;  5TJ5 E;  2PX0 A;  3K66 A;  2VCA A;  4Q5S F;  3SZR A;  5KYY B;  4JVS A;  4NC3 A;  4NTA A;  3NMJ A;  1GS9 A;  1L7C A;  2AU5 A;  1OKK A;  2NPU A;  3MYI A;  2WVO A;  2Q9B A;  4DOZ A;  4O6M A;  4X0R A;  2C04 A;  2XRH A;  4NCQ A;  1A41 A;  1EI7 A;  2YHS A;  1C17 M;  2ASR A;  1XWJ A;  3TOM A;  4YT8 A;  1HW1 A;  4JC7 A;  1CGN A;  3TJ6 A;  1D1C A;  4YL3 A;  3LEO A;  3FOO A;  4YL0 A;  4GQH A;  2Q4F A;  2G62 A;  3C8G B;  2YL0 A;  2YQY A;  256B A;  1T5O A;  3E9V A;  3NYL A;  5COM A;  1JMW A;  1RXQ A;  2YL3 A;  1LI7 A;  1ZHX A;  2QE9 A;  1OXB A;  3LUT B;  2EIN C;  2YWA A;  1VYI A;  4J32 B;  3U8P A;  2CNW A;  1HY5 A;  2L81 A;  3EGD A;  5L0D A;  3HLZ A;  3IQT A;  2XL6 A;  3MYF A;  4CJG A;  3LLI A;  1TWC A;  4MS2 A;  5D92 A;  2QTV A;  2E87 A;  3QW1 A;  4U5B E;  1WOL A;  2GWW A;  2EPL X;  1I5N A;  2OEX A;  4WAB A;  4XTK A;  3DWW A;  1UFB A;  2IOQ A;  1H9G A;  2HMQ A;  1BDJ B;  2LFF A;  1WN0 A;  3C62 A;  1M2O A;  3U0C A;  1MMD A;  2HJ3 A;  4MVR A;  3T9O A;  1IZM A;  2PFD A;  1JPN A;  1KU2 A;  3SEO A;  1A7E A;  2OEV A;  2CDQ A;  4PJM A;  3IQ5 A;  3GEI A;  2HFI A;  1KNY A;  2ZPA A;  2R7X A;  3LNR A;  1ZHW A;  2B0H A;  1RJ9 A;  2XL4 A;  3AQB A;  2R7R A;  1XZP A;  5COF A;  3MLG A;  3FHD A;  1LE2 A;  1R5I D;  4HE8 D;  5T1D B;  2X0C A;  2HZ8 A;  2V3C C;  2OJQ A;  1TQG A;  1GM5 A;  3UMI A;  2LP4 A;  1JAF A;  1LIH A;  3TQO A;  3GAN A;  1M6T A;  4WJ0 A;  1ZU4 A;  2RSE B;  4K1O A;  4MVZ A;  3U2L A;  1T6Q A;  2MYS A;  2XM4 A;  2PX3 A;  3FXH A;  4C3D A;  1WGW A;  1O3U A;  4CDY A;  1OQC A;  5EGY A;  2Q3T A;  3K1H A;  4N06 A;  3AG1 C;  2XS8 A;  3Q6M A;  1MMN A;  2W9Y A;  3KPH A;  4J7T A;  1VTM P;  1F1M A;  2Q9C A;  3O10 A;  3US6 A;  3JCU Q;  2HKV A;  2LK4 A;  2JX0 A;  1YJG A;  1ZW2 A;  3HJC A;  5K0I A;  3DAG A;  2VH3 A;  2A6E F;  1FMV A;  3C8G D;  2LCH A;  3IPM O;  3WHN A;  4AE4 A;  2PNO A;  1MMA A;  2AWC A;  3DAF A;  1J8M F;  4MW8 A;  4ER9 A;  2KW3 C;  1M2V B;  3K33 A;  2XLO A;  4AE4 B;  5FCL A;  2IYL D;  3RF3 A;  4JZA A;  1T6U A;  3ASN C;  4LER A;  3EHM A;  5DLJ A;  4G7O F;  1D1A A;  2J9B A;  2BE5 F;  5COG A;  4Z9H A;  2J0X A;  3LAY A;  3HKK A;  3FMS A;  1BBH A;  3JRM O;  4OIQ F;  1QZX A;  1RKC A;  1JR8 A;  4I3M A;  4CSA C;  1TKN A;  3UGO A;  4IGG A;  3E70 C;  3H2U A;  1OR2 A;  4CS9 C;  3MX3 A;  2KSF A;  4PJJ A;  1ZU5 A;  1OCO C;  1YYX A;  1ZHZ A;  4QDL A;  3JT1 A;  3AG4 C;  2R7U A;  4ULW A;  3J06 A;  3H65 A;  3RYL A;  1Z3I X;  2XL8 A;  3EG9 A;  2UUI A;  3L8I A;  4ULV A;  4XLN F;  4BEM J;  4MND A;  1HMD A;  4YJW A;  3QVZ A;  4F4B A;  5L0F A;  2WVN A;  2OU6 A;  2YLD A;  2Z15 A;  5L0J A;  3VAY A;  4G7H F;  2TMV P;  5HV9 A;  3NDB B;  3RIP A;  3M4C A;  1B68 A;  3AJM A;  4L6R A;  3DKA A;  4E18 A;  2AWY A;  2WB7 A;  4DBR A;  2MHR A;  1K04 A;  5IY5 C;  1L3P A;  3S0X A;  2KQ9 A;  1GGQ A;  3ZSU A;  3FOP A;  4XEF A;  3U5S A;  1K40 A;  1T01 A;  2UUH A;  4EHP A;  5DS5 A;  1CPR A;  1FFH A;  2XLD A;  1RKE B;  3U9M A;  2XXA B;  3GEE A;  3NMI A;  4PR9 A;  5A6B D;  4QI2 A;  5F28 E;  4K0D A;  2AVK A;  1H6G A;  2PF4 E;  1QVX A;  4JRZ A;  3DJU B;  4IAQ A;  4JCH A;  4KNV A;  1PCX A;  4HFF B;  3L1M A;  4JE9 A;  1CGO A;  2YL1 A;  1TWG A;  2WZL A;  1Z63 A;  2X51 A;  2F22 A;  3ZWI A;  4A4A A;  1LPE A;  5BQG A;  2EIJ C;  2OJE D;  5B1B C;  3VM6 A;  2YLI A;  1C02 A;  1ZHT A;  5JS5 A;  3PHF 2;  4J30 B;  3T6J A;  3FDQ A;  5KYY A;  5AGF A;  2DB4 A;  4MVM A;  2J8W A;  1TR2 A;  3S90 A;  2BC5 A;  3DE9 A;  3LES A;  4YK5 A;  4YT5 A;  3CQZ A;  4MTG A;  3S29 A;  3UGP A;  2YL7 A;  2GA0 A;  3I5Q A;  1PD0 A;  4FX5 A;  2Q9A A;  4O79 A;  3ATP A;  3HNL A;  5D91 A;  3G50 A;  1U89 A;  2H8A A;  3LS0 A;  1O5H A;  1YDI A;  2YVK A;  3W2W A;  2R7T A;  3K6B A;  5EHH A;  1D0Y A;  1A7V A;  2R7S A;  3LS1 A;  1VYK A;  4EBK A;  3RQE A;  3T4R A;  3G4X A;  4C3E A;  4QI0 A;  1MQV A;  2EIL C;  2LFD A;  3JRT A;  1LI5 A;  3LNM B;  5KYW A;  4XLP F;  2P7V A;  4OD5 A;  3UMK A;  3RH3 A;  1OCZ C;  3T6B A;  5L3Q A;  5F5F A;  1CGM E;  1T9K A;  2M4E A;  2DI3 A;  5HSW A;  4G7Z F;  3DM9 B;  1GQA A;  2CNW D;  2HJM A;  3K1I A;  4D4X A;  4AK9 A;  2I8B A;  3B0U X;  1AUE A;  4RDA A;  4N6C A;  3GWL A;  4DXW A;  4HFK B;  1FMW A;  4O6Y A;  4J7Y A;  4XPW A;  2HV7 A;  1LM3 B;  5DS6 A;  1EKY A;  3EQL F;  1MND A;  1V74 B;  3VF0 A;  2R7V A;  2EIM C;  4NTF A;  3ZC4 A;  1EA8 A;  5DS4 A;  3OEO A;  3SXZ A;  3POV A;  1BR4 A;  3DM5 A;  4YN0 B;  2C03 A;  2CGE A;  2L9J A;  2CCY A;  4M63 A;  4EUK B;  2OG2 A;  1MNE A;  2Y3D A;  2A1D D;  2J9V A;  3LLK A;  2NSG A;  1A7D A;  3WG7 C;  2KYH A;  2R9R B;  5JSL A;  4FAP B;  1Z5Z A;  4R32 A;  4XEV A;  2YRF A;  4XQ1 A;  5GPG B;  3AG2 C;  4JKV A;  3O39 A;  4WGY A;  5CI8 A;  2W4B A;  2DGJ A;  4JUR I;  3RVZ A;  3TOL A;  3EPV A;  3K1I C;  3U8V A;  4B6I A;  1ORY A;  2R02 A;  3W8H A;  1LS4 A;  4BJT A;  5BUO A;  3C8Z A;  1FAP B;  3SP1 A;  4ZLC A;  2NUT B;  4P9F A;  3ZIB A;  1V55 C;  1VOM A;  1D0Z A;  4JEB A;  4JTA B;  1YZC A;  4EIY A;  4UDV A;  4JW1 A;  1U0B B;  1NZE A;  2QUP A;  4Z9J A;  4CS7 A;  2I15 A;  1QPU A;  3OWT A;  2JPU A;  4BJ1 A;  1D0X A;  1E86 A;  1AVO B;  1V54 C;  1V4A A;  2EPN A;  3AQC A;  2HMZ A;  3EFO B;  4JIO A;  3WAQ A;  1M57 C;  2L6H A;  2ZXW C;  1R4T A;  1RJ9 B;  1S05 A;  4C7O B;  3RQF A;  2LSE A;  2J7P A;  3S28 A;  4W8K A;  2LQG A;  1W2W A;  3N24 A;  2J7P D;  3CZ6 A;  4NQF A;  3SXY A;  4CS8 C;  2ZXR A;  1HMO A;  1J8Y F;  1A0B A;  1Z6A A;  4PAC A;  4BJ5 A;  4CS9 A;  2Q00 A;  2R25 A;  1YZA A;  1SR2 A;  4OIP F;  3RVY A;  3ZVR A;  4PJN A;  2LD6 A;  2OQM A;  5A6B A;  1YAU O;  4ANJ A;  1G4U S;  2QNL A;  3N2Z B;  1SF8 A;  2PP4 A;  5JRA A;  1SYQ A;  3V5Y A;  2W45 A;  3EGD B;  3T6G B;  1ST6 A;  2OCC C;  3EHN A;  4MVS A;  3EH2 A;  1ZVZ A;  3EZI A;  3U3F A;  4CSA A;  1Q0K A;  2XLE A;  3DD7 A;  3W2V A;  4CBE A;  5B3I A;  2ZXP A;  4MQ9 F;  3DJN B;  4LDK A;  4DVY P;  1EQ1 A;  3UR3 C;  3M79 A;  3FVY A;  5JLI A;  1YYJ A;  1HE1 A;  5DQT A;  3SYN A;  5A6K A;  2HV6 A;  4JJF A;  3X1O A;  3S27 A;  1VB5 A;  4AL0 A;  5JT4 A;  2H7B A;  3TUL A;  3X2Q C;  1S7Z A;  4IB4 A;  1D1B A;  3PCV A;  3NYM A;  3RFY A;  5AC5 A;  3ECS A;  2ETS A;  2PBE A;  1E2X A;  3EH1 A;  3FAJ A;  4IAR A;  2VCB A;  2DYR C;  1LE4 A;  1OKK D;  4DJ9 A;  4P6I C;  1OW7 A;  1Y6D A;  2IXN A;  2VCC A;  3JYH A;  5EK0 A;  3V5X A;  3QMK A;  4PJL A;  1QKR A;  1NG1 A;  1FTS A;  2Y3B A;  4D4N A;  1OXK A;  4E0H A;  1RMV A;  2O9X A;  2A0U A;  1BR1 A;  2D4U A;  3L0I A;  4U5F E;  3RKO F;  2J0W A;  2P1A A;  2WZG A;  3V7O A;  1Q0G A;  2ZXO A;  2NG1 A;  4MW3 A;  3S9O A;  1TFK B;  4K7B A;  3NMK A;  3GM1 A;  1O87 A;  3JYY A;  3R2P A;  2IXM A;  1MMG A;  4H4K C;  2KK1 A;  2XLH A;  5T3W A;  1ZHY A;  3TJ5 A;  3M4B A;  4MVO A;  2JD3 A;  2KGO A;  1I4Y A;  2HUJ A;  2NSF A;  3A11 A;  5L0H A;  3S84 A;  5AC4 A;  3KYJ A;  2IBF A;  1NSG B;  1NU7 D;  5KYX B;  1OR3 A;  4IWB A;  3EFO A;  3EGX B;  1JOG A;  3I4U A;  5A6A A;  2CW0 F;  2V26 A;  2R7Q A;  3U2M A;  2J45 A;  3HNJ A;  1JRA A;  3EJN A;  4KC9 A;  3F47 A;  3ZQV A;  4I1O B;  3DMD A;  3NG1 A;  4U5E E;  3SXM A;  2XLM A;  4P9T A;  3HNK A;  1HE9 A;  3VYW A;  1BZ4 A;  3C8G A;  2XLW A;  3SNH A;  1TWH A;  1YLM A;  4EKW A;  1PD1 A;  5L0G A;  3MFN A;  5L3V A;  3GOR A;  5L0C A;  1E83 A;  3C63 A;  2R05 A;  1JPJ A;  1WAS A;  1BR2 A;  3KL4 A;  4KNW A;  2XXA A;  2A0B A;  2AP3 A;  4O6N A;  3BRJ A;  4IRU A;  3G4Z A;  4U5H A;  4CIP A; 
#chains in the Genus database with same CATH homology
 5L0H A;  4W8P A;  4E18 A;  1ZW3 A;  1DOV A;  2IBF A;  4K1O A;  5FZT A;  5L0D A;  4E17 A;  4ONS A;  4DJ9 A;  2HSQ A;  1RKC A;  1TR2 A;  3S90 A;  2GWW A;  1SYQ A;  4EHP A;  1T01 A;  1QKR A;  3T6G B;  1ST6 A;  4IGG A;  1RKE A;  3H2U A;  1ZVZ A;  1L7C A;  3VF0 A;  1RKE B;  2GDC A;  3H2V A;  1DOW A;  4P9T A;  3MYI A;  4PR9 A;  1U89 A;  1ZW2 A;  1YDI A;  1H6G A;  1XWJ A;  5L0G A;  1U6H A;  5L0C A;  3TJ6 A;  2B0H A;  5L0F A;  5L0J A;  2LQG A;  3RF3 A;  3ZDL A;  2X0C A;  5L0I A;  3TJ5 A;  2L7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...