1ZWIA

Structure of mutant kcsa potassium channel
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiA02
4PJIB 3QWRA 5E0QA 1HQ4B 3E1F1 5MHSE 1NGPH 3QHZL 4NZTH 1E4WL 2FECL 2YXMA 4CW1B 3MRLB 4HGMA 1E6OL 3C9NA 2XY1A 5HDLA 4HBQA 3DUSB 4OFYD 3X3FL 1QYGL 3QRFM 3QQ9C 2ZNWA 4CN1A 4V1DA 4LVHC 3ROOB 3QULA 4R4NC 4YHMH 2ZWLT 4OLWH 2NY3B 3S37X 1ZHNB 4DGYH 2EDBA 4JFEE 4JRXD 2XWJB 3FQRA 1MCPL 4KQ3H 3RNQB 1FYTD 2K7QA 4EEEA 1J1PH 3GNML 4X6DA 1QSEE 2BNUA 3UTSE 4ZNEE 3W9EA 3EYUL 3VH8G 3CCHB 2ZOLA 4IRSB 3U9PL 2XXCB 4QRTB 4D0CB 3QHFL 5DD0H 5TE7H 3H9SA 3OQ3B 1HI6A 4WNQB 3HMXA 4I3RL 4MHHG 5I18H 4Y2DD 1FFNA 1T5WB 4PRDA 4MB5A 4F9PC 3IJYA 4MA7L 3WN5C 4DN3H 3QPQC 5MEPA 4JKMA 2C3VB 4WEBL 3THML 4IS6B 2NY2B 2JB5L 2V5MA 3UO1L 3DV4A 2E7CA 4UZGA 4N8CH 3UC0L 5GGTL 1CE6A 3D69A 3DMMC 3MLTA 2SEBA 1HCFX 2PTTB 5EO1A 5GGVL 2AJVH 3HCVB 5IIEB 15C8H 5IW1B 4AMKH 1QSFB 3L3JB 4X7SH 2I9LB 5BOPA 5I30H 2YPLA 4IJ3C 3PUCA 5J11B 1DUZB 1HQRB 1JWUB 1FIGH 1JZ4A 2VWEC 5I16B 1U8NB 1YEJH 1BD2B 3RWIB 4YHZH 4LDEB 5KTEL 2DKSA 3MUGA 3DIFA 3TJHC 1CG9A 4KJQC 4PBXA 5EU6D 3HG1A 4HWZA 1G6RA 4M3KB 4MQXD 3RUGE 3B2UC 3DI3B 3GMRA 2QTEA 4M48H 4OLVL 4RNRB 5D5MA 3MACL 4RWYH 4F9PA 4PUBH 2YZ1A 3WN5A 2HJKB 4NO3A 4D8PA 1OP3K 5DLMH 4CVXB 5DJCB 3BRDA 3VXRB 1C08B 5DO2D 4YXLL 2HA1A 1H8NA 3FQUB 4MQTB 1U95A 3CZFA 2W0FA 2AABL 2PXYC 1MCSA 3DMMA 3KWWB 1MH5B 3LQMA 4KHXL 5ISZE 3NZHL 2IQAA 3CVHB 4X4XA 1R24B 3FHQA 4I3SL 3TIEA 4C58B 3VFMB 2C4FU 2ESVB 2FD6H 4F7MB 4HIIA 3ULUH 2XWTA 3MV9E 4PGBA 1F90H 1NBQA 4TYUA 2ITCB 5D2NC 1JPGA 2XTJB 3I2CH 4WI5A 2N4IA 4GSDH 1MCHA 3HC4L 1U8PB 3PGFL 3DX9B 1YQVH 1XR9A 3V52L 1FNGB 2H3NB 3V7AG 1RZIA 4JRYA 1EVTC 3O0RL 4QYOA 1YY9D 1I8KA 4ZFOL 2HLFC 4OQ1A 4XI5D 2FEDD 2EYSA 5CEZE 3ARRA 4JKWA 1RUAH 2FJHB 4NBYB 5FEBA 5EUOF 4ORGB 2NY3D 2AV7B 5MEOA 1Z3GL 3EDKA 1E4KC 1U8IA 1BF2A 2D7OA 2VLRD 2PXYA 2Q3ZA 5C0IA 2Y6SD 1LQSR 2AGJH 2AJ3B 3FTGB 3BP6A 2FX7H 2YUXA 3HC3L 4DEPB 1U3YA 2DQJL 2BY0A 2H2PC 2YD1A 5MI0C 3VFGL 1TCRA 4NGHL 1YEFL 1YZZA 5E7BA 4QHKJ 5ABDE 3VMNA 2XRAL 3KXFE 4Z9KB 2IWGA 1K5NA 3SDDC 3VE0A 1F02I 2VITA 3G6DL 5D2NA 1GVIA 1BZ9B 1RV6X 3EO0A 3ULUC 1A1OB 4OZHB 5KSAC 3LPGA 1IAIL 4R97B 4P9HL 4BFBD 1KFAH 4PP2A 4JFPB 4BZ1H 5D71H 1Q0YL 2CLZA 2DJSA 1IAKA 1T20B 4OKDA 4XVSL 2ORBL 1W72H 3ZKQD 4LVOB 3U0PA 4KZDL 1JN6A 4RSVA 1RK0B 3O2WH 5F9JB 5BZDA 3RP1A 1QSFD 4QT5B 2VLME 2K3TA 3V4PH 1WTGT 2MCG1 4P3CH 1E4KA 1AGFA 3WL9B 3HR5A 4KRPC 4POUB 4LLMB 2N7AA 1LP9B 4KK6D 4XBGB 4OGAD 5T1DL 4H20H 1S8DA 4D0DB 1MWAH 4GRLA 3PG2A 2DQTL 3RRQA 5I17A 3WS6C 5JW4Q 1RD6A 3O3EA 1RIUH 2J5LB 4XWGL 1ZA6A 1YPZA 1NMAL 2R1YA 1LP9F 4JPKH 3SDDA 3MV8B 4DGIL 1CCZA 1F8TL 3HB3D 3P9MB 3QIBD 1U0QA 4WUKL 3QFJA 1NEUA 3O6LH 1Z9OA 1UGNA 1JI1A 1XGRA 5KSAA 2VLKB 4ZTOH 3ESVF 1BBJB 3NFNA 4YXHH 3MC0A 2Z8WC 4NQDE 2VAAA 1P1ZB 5CJQL 2R8SL 3B5HA 4JO1H 4D2NA 2BC4A 4CU6A 3OXRA 4JVUA 3NTCH 4G80B 3GSNA 4JR9L 3U1SL 1G1YA 5HGBB 3QXTA 4H8WC 5HY9B 5FECA 1JGUH 3ARWA 2DD8L 2H26B 2YSSA 3L7EB 3D85B 4OF7A 1MCKA 1CFVL 4LQFL 4XMKH 2K9UA 1B0RA 2CKBH 5D1ZD 5JQ6L 3DTXB 5IKCB 2D31A 2EE2A 4YQXH 2XZQH 3HNSL 4MDJB 3WS6A 4K71B 3BH9A 1RZJL 2R0KH 3SOBH 1U3JA 4R8WH 4R3SA 5L2KB 1N3NB 2WZPD 3DSFL 1A5FL 1IRAY 4U4BA 1CBVH 3DYPA 3LH2L 3S35L 1QHOA 4U1HA 5C0EA 2YBRB 3VXOA 2HT4D 3L3IB 5E6YA 4PS4H 3LEVH 1OOAA 3HRPA 3MBEC 3MRIA 3FO1B 4A2MA 4JRXE 1S7UA 4P5TB 1R0AL 2IG2L 3PWVA 3QQ4A 2QADB 2WANA 2LTQB 3KLHC 3F7VA 3OR6B 2IH1B 2OK0H 5JMOC 2AK4D 4CGTA 3ARBB 4QRSA 1GPOL 3TV3L 1V8HA 1K3IA 2A74A 4PLJC 4QKXB 5ESQA 3UZEA 3CFKA 3H42L 3RWGA 4R26H 4DAGH 3MMEA 2HVKA 4J2XA 5INDB 3VGGA 1FNLA 4I18C 4Z0BL 2FL5B 5IVXF 4X83A 5E00A 3FT4B 5EOQL 5CSBA 3CH1B 4OD1L 3ABZA 1LD9A 1VACA 4MXWH 4NM4L 3ZE1F 5I73B 1JZ2A 5ICZA 3PWLB 1JMZA 5J1AA 1ZHLB 2DMBA 4PIRF 1KB9K 1M71A 1KT2B 5KZCD 2YR3A 5D7KD 3MA9L 4OFKA 3T09A 3OAYK 4HDIB 1I1RA 4NOBA 3G6AB 2WWMD 3O4LB 3NCMA 3MBEA 1P7HL 1PG7W 1A7OH 1FFPB 5HDBF 4YK4B 4K9EH 3EFFA 1VPOH 1IEAA 5J12B 2MCPH 2IJ0C 1AGDA 1BEYL 2OR7A 3LZFL 5EU6E 1GOGA 4JM2B 2VKWA 1CR9L 4LGRB 4EI6B 3I6LD 5GISL 3GMLA 1FVCA 5T1LB 3L5XH 4KRNA 3L3GB 4LSSL 1MCCA 4EQ2A 3LMJL 5HD8C 4I18A 3TCXA 1UXWB 4P2RD 1C12A 1MOEA 5IEHA 3D2UA 2BNRB 2NNAA 4NQTA 3BWAA 2CKBA 2VH5L 3QUXB 5LBSH 5F9OH 4LL9A 1I9JL 1DE4A 4G6AC 1TZIB 3C6LB 1TVBA 4ACPA 3ULVF 1JYWA 5C09E 5E6ZA 1VKXA 3SGEH 3K2UL 5T3ZD 4ZS7L 4IRSC 4YHYC 1HEZB 3TBTB 4HCRL 5HTSA 1AH1A 1T1XA 2F15A 1S7SA 2D7QA 1U58B 1JL8A 2ADGA 3BEVA 2VLJD 3GSOA 3TT3L 3BYTA 4PJIA 2A1WL 4WV1A 3H0TA 4KK5D 3ALXA 4AZ8A 3CVHH 4WY7H 4NZUL 4M02A 2VABB 2NY2C 5HHOB 3CLEH 4CW1A 4K9EC 1S7RA 4P2QB 4Z7VB 1Q0XL 5CEYA 4NKOB 3MFGB 4LAJH 3RWEB 4H5SA 3OKMA 2CGRH 5HI3D 2W0LA 3RVTD 2ICES 3KAAA 1CK0L 1SJXA 3NAAL 1J12A 3KPSD 4RGMB 2VTFA 3UYOD 4Z7VF 3LCYA 1ZHNA 5D93C 5AAWA 5JHLH 3VWJB 4HULB 3TYFB 1KCSL 1B2WH 4D94A 2BVPB 5A3IC 3GUTB 4U6TA 2QLVB 1TJGL 3O6FD 3Q0HA 4P5TD 3CCHA 3CXHK 1ZSDB 4LQ1A 1G0XA 2QADD 1K6QL 4QRTA 2IQ9H 5FM4A 2DQEL 4YR6B 4WNQA 4H1LB 4F3FB 4B50A 2YUVA 1SMAA 1X5ZA 3MRGA 3LIZH 4LSTH 1OAUH 4TVSa 1IE5A 2D0FA 4IS6A 2YZ8A 2ARJQ 2YA1A 2Y36H 3GI9H 2Q8AH 4EDWH 5KOVC 5IMOB 1RUQH 3B9EA 4LMQE 1KEMH 3WDHA 5C0JA 4TOYH 4F8TA 5D6DC 3MLWL 4PJAA 3T0VA 1LO2L 3HCVA 1VEOA 2DI8A 3OB0K 4JREC 3U36B 2I9LA 1DR9A 5D4QA 4OI8A 1ZLWH 3OXSB 1HQRA 5C0RL 1JWUA 5A1AA 3D0VB 5KSBB 2CJUL 1G7JA 4LHUA 1KIRB 5I16A 3WO4B 3VXNB 1EVUA 1U8NA 3T0EB 2BFVL 1G7HB 2XTJC 3DARA 3G5YA 4HKZB 1BD2A 5AAMA 4X9BA 2EIDA 1K2DB 3BXNA 5KSBF 1AQKL 5FYJE 2NCMA 1QG3A 3EYSL 1R3LA 1S9YB 4S1SL 2DQDH 4P5KB 1F4AA 3B4NA 4JFDE 2DTSA 4WFHE 1J05B 2O5XH 5EH1A 3MREB 4H26B 4M1GH 5D9SA 4JFQA 4QOKB 4I4WB 4WEUD 3VA2C 5H35A 3HN3A 2HJKA 4LP5A 4YDIL 3WFHB 3PQYD 1YNTB 4OCNC 4ONFH 5DJCA 1WCQA 4GUPB 4O5LL 1C08A 4Z7UF 3VXRA 2DYPD 3DVGA 5HPMA 1MJUL 5CD5D 1TPXC 4URTB 4U1GB 3H9ZA 4TRPH 1E4XL 1MRCL 2R0WH 2BCKA 3KWWA 4LSPH 4HFUL 4LPCA 3CVHA 4PJ7E 3WIIL 4CJ1A 4FFZH 2F9BT 1BF8A 1C5CL 3RL2B 2PYEB 5KN5A 5E2TL 2HTLD 4QCIA 4DEPC 2DQUH 4ZD3H 5DMJB 3QCTL 2X4QA 5AEAA 3NFPA 1GGBL 5GGRB 3QQNA 1BWMA 1CLYH 4OB5L 4NQEE 3KPRB 5JW5A 2E27H 4YFLF 2ATPB 3WLWD 3GB7B 3VD9A 4DVBB 5KVEL 3K4ZA 1L0XA 4CMMB 1GZQB 4R97C 1CXLA 3GIZH 5I8KL 3VFNB 4NSKB 2BY3A 2HLAB 2YN3A 1R3IH 3IETB 1MFDL 2F53D 2WUBL 5E24E 5JXAL 5F6IB 4LVOC 5EUOE 1HH9A 1XR8A 1TQCC 1UA6H 2PR4L 3CFDB 1AGEB 3HE7C 2FJHA 5A2IH 1TJHH 4EUPB 4FHBD 3IKKA 1MCWM 2CUIA 1UJ3B 4J3UA 2AK1H 3A0OA 3W0WA 1A6VL 1S7VA 2AJ3A 3BT2H 4RA0C 4WWKD 3FT2B 4GXUM 4TSAL 1WITA 1CLCA 1WZLA 5EU3B 4O58L 4TVPD 4X6FB 1A9BB 3O3BB 5CZVL 3L3DB 5F96L 5IJVB 5HGDB 3BEWB 2AK4E 4DVRH 2F5BL 3OGCB 1TNMA 4PJ8C 5F88A 3L3OB 4ZYKB 3QDGB 5IROC 1F6LL 3U7AA 4N0YL 4PREB 5JMRA 4AEIH 2X05A 3RGVC 3VW3L 3T65A 3BW9B 2CO6B 3MX0A 2YC1B 3FO0H 4OZHA 3OG6B 3OWEA 3VG0H 1YEKH 3R0MA 4ZFFA 4TUJB 5EC1B 5FO9A 5DQ9B 1DL7L 4E0RA 5DK2B 2AEIT 1EA9C 4LOUD 1QRNB 5IQ9A 1RK0A 1JWSB 5IBUB 1QFWL 3HE7A 4QT5A 4LLDA 4DJMA 4PJFE 3MYJB 4LLMA 2V2XB 6FABH 4AG4L 4XBGA 2DN7A 4HUNB 4ONOA 3DXAA 1MLCA 1YA5A 4RMTA 1KOAA 5F3HB 1XGYL 4KQ4L 4PTTA 4QO1A 4PJ8A 4NP4H 5H37H 1I85C 4Y4KD 3RGVA 2OTWB 3MRPB 3WFDH 2ICWB 3QWRD 2PKDA 3AS2A 4TTGA 1LEIB 5EBWA 1MFEH 2HH0H 4K7FA 3MNVA 4K3EL 4P2RE 1BBJA 1WFTA 1D9KB 4MXVF 2GITA 4GXVH 5C8JB 5CINL 5I6XB 1LEKB 1P1ZA 4NO0D 3JWOH 4N0UA 3ZKXB 2XIDA 1NFDB 2CDGB 2Q76A 2BNQD 3I9GH 4M7LT 5GGUB 1JHKH 2LTQC 3KNBB 3QNZB 4HUXA 5T3ZE 5HY9A 1Z9LA 1KNOB 4ZPTB 3ARBC 3MXVL 3TEUA 3D85A 2WBKA 5TQ0H 1AXSB 3MTRA 2IFFL 1AFVL 2CD0A 1FNFA 1OQXA 1ZKAA 4ODTL 5CBEA 5IKCA 4GAGL 2F8OA 2UY7A 2VLJE 4FQQB 5FCSH 5L7XH 4MDJA 5F7DB 4YNYB 1WUNT 5DJ2B 5E94B 5IV2B 2M8XA 3MRBB 2AJSH 1UB5B 4UV7L 1I3UA 3MYZA 3K74B 4EIGB 4XBPB 5I73C 3I02B 2N56A 1PSKH 1I85A 4ZTPL 4RRPG 5JPNB 2XKSA 1QBLH 1OM3L 4F7EB 2PW1B 3EYFB 1R3HB 3L3IA 1QUNA 4ZOCA 3KR3H 1HINH 3SKJH 2VNCA 1NC2B 3FO1A 1A1MB 3G6JB 4R7NB 5KS9A 3OJDA 3GMOB 4R7DA 4FQIL 1R3KB 4GG8B 4K8RL 4LCYA 5J12C 3IF1B 2GTWB 1EH9A 4R90H 2GSGB 1MSPA 1CFNA 1KJ3H 1N64L 3C8KB 3E8UH 3TO4B 1FFRA 3PWNA 4JM2C 3ARBA 5SX4H 3QYCA 3JWOC 1SYSB 3ARUA 1ZTXH 4Q74A 1J11A 3BESR 4F15B 4NKDB 5CWSA 4KKBD 1T6WA 2NX5D 3L3KB 2FL5A 3WSQL 1MCBA 4XPGH 5AD0A 1R5VA 3ZE2E 1GAFL 1OWRM 3CXDL 1XF3B 4G7YL 3PWLA 2VDRH 5SWSA 3C6LC 4H1LH 4MJ6B 3JWNC 1HHHB 3OTTA 5BJTB 4XPFL 3VFPA 3CUPB 3QPQD 5HHMB 4NNPL 3OKYA 4MNQE 3JTSA 3OKEA 3HPLB 5C0CE 3WKML 3TF7C 3G6AA 3G5ZA 4I1NB 3SCMD 4NZRL 4AQ1B 5GJTH 3S3PA 1RZKL 2H8PB 2WBWB 3O4LA 4ETQB 1UKQA 4JKKA 5KANI 2FX8H 3GBMH 1TJIL 5BO1L 1EUTA 1FFPA 3DMMD 3HZVB 4LLQA 4UINH 2QHLA 5TPWL 3A6CL 3IDGA 1XFPA 3PWUB 1X6NA 1BOGA 1UQSA 4AT6B 2BVEA 4I9WD 5DUMH 4P3DB 2OJZH 1LNUA 4JM2A 3QHZH 4X6BA 3QEQA 4X6CA 4U31A 4JN2B 5GHWH 2P46B 3OB8A 1QYGH 1WQVT 2A77L 4L4TB 4ODSH 4Y19B 4BQ8A 4RGMC 1SBSH 1U42A 5JIPA 4W81A 3PQYE 2I24N 8FABB 3VWJC 3LKNA 2X70B 3B2UD 5FGRA 5DD6B 1TZIA 1TVHB 3P4MA 4NKIL 3ZLQC 1IGCL 1KPVB 1HEZA 3TBTA 2CKNA 1E4JA 3MCG1 1Y6NR 5J4MA 3L95B 3TGXA 5HYIA 3T4YB 1FNAA 2CUHA 2H32H 1QR4A 1U58A 2FHFA 4QXGH 2X1XR 4RBPH 1AO7E 3ES6B 4BZ2H 1JWMB 3V4UL 4LSUL 5EZOL 1B88A 1BQHB 2BVYA 2EYRB 4W6WB 4XWOC 3GBNL 4OLXH 1T22B 4IMKC 5L88L 4DKDC 5IHZB 2R0ZH 3RWEA 3QDJE 1Y18A 4X9HA 4MCZB 3IDXH 4WENB 1O7VA 1U3HB 2P48B 3QUYB 5FDWB 1OLLA 1BBDL 4L1HA 5I15L 1MQKL 3VWJA 1EMTH 3TYFA 3WO4C 4Z7OF 4R2GD 2CLVB 3PHOB 1IEBA 3T0EC 2NR6C 1XH3A 4NOFA 2NY6D 4OZGF 1FO0L 1UM4L 1A22B 2AEWA 2P24A 4C55A 2BP3A 3TYGH 2ADFH 3TO4D 4YR6A 4Q9RL 3IFOA 4CVZB 4H1LA 3RDTD 1OP5H 2FATL 3QCUL 4EUPH 5IB1B 3O8XB 2ICEB 4HQQH 5DSCB 4OQTH 4XX1E 4QRRE 4LPYA 2P8PA 1P5VA 2P8LB 4XNMB 4NRZA 2LVEA 4YAQA 4GRLD 1L4IA 3HAEH 1AY1L 4M43H 1A3RH 1OAXH 4NO5B 5E2WL 2RCSL 5IMOA 2NZIA 4IMKA 4Z95H 4CJ0A 5C2UB 1XEDA 5E2UL 1T2QH 3ARXA 3LB6C 5GIRA 3OGOE 3CIQA 4EVNB 3FT3B 3GIVB 4OD2A 4KKLD 1UC6A 2WQ8A 5KSAD 5BW7C 1WGOA 2RAMA 3O2VH 1BM3L 4YLQT 1KIRA 1NQBA 1QNZH 1GSMA 1ZA3B 2QR0A 3RPIA 3T0EA 4HKZA 3HMWL 5TE4L 1K2DA 3X12B 3HC4H 1H8OA 2GI7A 3OZ9L 3MLYH 5TF1L 1DLFH 4J4PC 5MENB 1A7NH 3V52H 5F3BB 4XBEL 5F1NA 1NFKA 4GW4B 1J05A 2XPGB 4LU5L 4CMHB 4KRPD 1HYSD 2BVQB 3O0RH 5CIPH 4GRWF 5F6IC 4Z7UE 3EOAB 4HKJB 4FZ8L 2GK2A 3NA9L 4G9FD 1S7TA 3WFHA 1YNTA 4Y19D 4GUPA 2BHZA 2H32A 4OCMC 1A6WL 3B6SB 4P2OC 3MGTB 4OAWB 1IAIM 43CAA 1KN2L 1UJ3C 1XT5A 3DV6B 4FQJL 1Z9MA 3GI8H 3MJ6A 1IC4H 3WXVH 2GTZB 3T0WA 2B1AL 3RL2A 4CU8A 4V1DE 3HC3H 5TDNA 2BJMH 4P5MB 4X9GA 2VJXA 5GGTA 1MCJA 4NN5B 1A7RH 1MEXL 1SMOA 4JZNA 4AEHH 1CICD 1S7WB 2D03H 1AD0B 3P30H 3ZDZE 4L5FL 7FABL 2VZ1A 5K9KA 3G6DH 3LRSB 1M6OA 1GC1H 3BIKA 4X6DE 4XCCH 1MCRA 3GK8H 3MZTA 1F3DJ 1RULL 3HTLX 5F1SA 5HGAB 5EBLA 3T1FB 4CMMA 5HI5D 5CFHA 4QWWD 1YJDL 5EG6C 3QRGH 3VFNA 4EN3D 4J4PA 3U9UA 1IAIH 2YA2A 3IETA 3MV01 4S1RH 3REWB 4YHLL 1VERA 4XAKD 5DD1H 2LVCA 3EJYC 3H9SE 5AUMB 4Z76B 1Q0YH 4ONHB 4P23C 2BRQA 2W0PA 1AXIB 4XVSH 2XI9A 1ORSA 2JJSC 43C9A 2BZDA 2PO6C 1LO0L 3GGWB 3O41B 2IH3A 4P2OA 1IGML 3MJGX 3QUYD 4H0GA 4QRPB 4OQTA 3BAEH 5C07D 3S3JA 1UJ3A 1G7PA 1LDPH 5CKGA 4XZUB 5EDXA 3HAEA 1NAML 4Y0GA 4PB9L 5T1DH 3WXWL 3Q5OA 2GCYB 1JYNA 4ZSOB 5EU3A 1OTUC 1A9BA 4V2CB 4Q7DA 5IJVA 2HJLB 5C0ND 4PJAF 4ZFZB 2YPLE 3VD3A 1NMAH 5F7UA 2YD9A 4LCCC 2P5WA 5FO7A 1INDH 4DGIH 4ZYKA 2ATKA 3CNKA 3DUUB 1RZ8A 2RB8A 3BW9A 5IMMB 2QKIB 2BXZA 4HH9A 2YC1A 5E9DA 5L8JB 3C2AL 4OLZL 3C08L 4MD0B 3F58L 3KJ6H 1D9KC 1IAOB 3PGCB 4XAWL 3QUZC 3WKNA 5I6XC 3GMNA 3HG1E 5FUOL 4X4YB 1GC1C 4PLJD 3BDXA 4WU5B 2ZJSL 1AD9B 5CJQH 4P23A 1F3RB 2R8SH 4HWUA 4XPHL 2RR3A 2L4OA 5FYJL 2JJSA 2PO6A 4G42B 1EHNA 5CMAB 2R2EA 3INUL 1UM6L 3WNLA 2E9WA 4ZODA 5FYKH 4P9MH 5IQ7H 3WNOA 5CIPA 3MYJA 3QZWB 2NY0B 4ZFOA 2V2XA 2R9HD 1CFVH 4HPOH 3NFSH 5H37G 1VA9A 4XMPH 3LD8B 5FGSA 3TFKD 3UZVB 1FL6B 3MUJA 4P0DA 3FCTB 1EIBA 1T7VA 4YBLB 2C3WA 3MQIA 1H5BB 1FLRL 5T5FL 4LCCA 1U9KA 5C08D 3H3BC 1HCVA 1ZVYA 5B22A 2ADIB 2LFGA 2VWEE 4LCIL 5IVZB 3LHPH 4X98B 2ICWA 1NCBL 4KK8C 5GS0H 1ACYL 2YRLA 4EOWH 1BMGA 1LK3L 1UCTA 3S35H 1C5BH 4IRJB 1D9KA 5CD3A 3CAFA 4NHCH 4NKMB 3QUZA 1LEKA 3SKMA 1MCLA 2XG5A 5AWNL 2W92A 4K7PY 1I1AC 3WUWA 2OR9L 3QEUB 4JRYE 2DIAA 4OCRH 5K9QG 3N1QC 3P9WB 1NFDA 4C83B 5GGSY 5JA8B 2R2BB 4I5BB 4JM4L 5GGUA 1BFOB 4OLUH 1NC4A 1UM5L 4O2CA 2XQBL 4ZPTA 1NGZB 2VXSL 3VGFA 5IWLC 4HT1H 1PYWA 3ILQC 3ZKNC 5CJBA 5DHYB 1YNLL 2NY1B 1NJ9B 4XPBH 2VXUH 3NCEB 2LE9A 2CQVA 3OKLB 4F15C 3M1BA 1U8KA 4FQQA 4Z5RB 2VZTA 3N85H 5IFAH 2DQFB 4UILL 5E94A 2C1PA 4Z0BH 5IV2A 3RWDB 3IDJA 4UDUB 1H3PL 2PF6A 4F37K 1SHMA 2DI7A 5BQ7A 3MXWH 3I02A 4NM4H 2J1KA 2DLFL 3HFMH 3DO7B 3DO3A 5D2NE 4PJ5A 5ALBH 4JZOB 2DBLL 4UQ2B 4F7EA 3SJVB 5ITBL 2JJWA 3DBXB 1G84A 3E0GA 4WGVB 4XPAL 2PW1A 2J4WL 1SVCP 4JDZB 4MGXA 3NVQA 4JPWH 3HNTL 3V5DA 1FE8H 4GG6A 3FB6A 1S7XA 3G6JA 1I1AA 5GS0C 3WFEL 1R3KA 4GG8A 3QH3B 1FN4B 3AU1A 3IF1A 4XCYA 3HNVH 3L5IA 1NEZB 4OF5A 3SGDI 5J3HD 4PJ9B 4BJLA 1KXVC 1JNNL 2V5TA 3TJEL 5IWLA 1CR9H 1ZT1B 1N6QL 4LHUD 2IBZX 2BOBA 1PEZA 3BJ91 5JHDD 4U33A 2GFBA 1VADA 5D7JB 4MQ7B 4XP5L 3BDYL 5TGBB 3IFPB 4EBQL 1CLOL 1MI5D 3HZYA 4HUVB 1TLKA 4U6XB 1UKSA 4IM8A 5D1XA 1KIPB 1YPZE 4HUWA 4KV5F 3HS0B 4NHUA 1MFAH 1I9JH 4MJ6A 1MRDH 4I48B 1WIUA 2CUMA 3QFJE 1WBZA 3HPLA 4HXAH 3ULUE 1IQWL 3CU1A 2AEQH 1I1FB 1RZFL 1Q9KB 4HJGA 5TF0A 4OGXH 4HBCH 4PJXB 3S96A 2H41A 4HCRH 4YE4L 1O5DT 5EA0L 3VRIA 3HZVA 1YUHB 4M03A 4OZIB 2WIIA 3BDBA 3PWUA 4AT6A 5L2JB 3MOBL 4PJXF 4NCC1 2XKNA 3MNWB 3Q1SH 3TN0C 2EZ0D 5E7FA 1RVFH 2X89D 5BRZB 3MLXH 1GRWA 5JOFB 1BGXL 4JN2A 4KVNL 1VFAB 2WBJB 1JUFB 5DJZB 1HNGA 2XZZA 4MNGA 2YHGA 3ECBA 3QNYB 4L4TA 1IGJB 5F8QC 5EU4A 4NYLB 2VRAA 3QAZB 1U3HC 4RGND 3NAAH 2R1WA 5ACZB 4QHUB 3GJEA 2P7TB 3NGBB 5I0DA 1GYAA 5EZLA 3IDIB 2X70A 4ALAH 4U1KA 3M8OH 1IAMA 5DD6A 5ECJE 4Y4HB 3VCLA 2R2HB 4UBDD 5DC4B 1KPVA 1G9ML 3UJTL 1HSBB 4WHDA 2ZCLL 4C4KO 2DQEH 4ELKB 4F7CB 1JRHH 2DM3A 3O8XC 3W0WD 1JPSL 5LQBL 4AJ0A 4HC1H 2BVOA 1JWMA 2UYLB 4Y1AA 1CFTB 3CDGB 4S0TD 4OLEA 1KCLA 4HUMB 5FA3B 4YDVB 4QRUB 3TN0A 5IK3B 1T22A 2EEDA 2Z91A 5IP4A 4HFWA 1T04B 3EYQC 5DJXB 5IHZA 5DJ8B 1GGIH 1NGYB 1F58H 4K2UL 4QHKI 3WUZA 4MCZA 4Z6AT 5C6TL 3L5WB 1NCDH 3D39B 1IKFH 4D0BB 5LCVH 2YD7A 4Q9CA 4Z7OE 4HIHA 1XF5B 2UY6A 2GJ6D 3Q6FB 3G9VA 2UVFA 2UUDH 5C7XL 1JZ7A 2NYYC 3PHOA 5C07E 5C9JA 2PUQT 5DRNA 2BFVH 4XNXL 4EUPG 4O2FB 1JCKA 2V9RA 3BI9X 4LSDA 2DM2A 2C3GA 2FLRT 3BGFB 3MO1B 3HE7D 2IANB 1MIEL 1U92B 4LARL 4KZEL 4PFEA 3MLRL 1OSZB 4U49A 5CJOH 5DQDL 3X13B 4CMHC 3O81A 4FFYH 4NFDA 1PEWA 1QTYT 4U7KA 1FFOB 5F7WC 3TP4A 1P69B 3TVMB 2IPKB 4A6YB 4XNMA 2P8LA 1EFXA 5D7JD 4UOW0 3DXAD 4HCRA 3W9DB 1NUNB 3UJJL 3S5LA 5B8CC 1QQDB 4MJIA 5I74B 1OSPL 1MCWW 3OAZH 4JAMA 1JE6A 4PJ8D 3T2OA 2JIXB 4Y8AA 1AJ7L 5DHVH 3WS3B 4J6RH 1C5CH 4DFHA 3GIVA 4EVNA 1DUYB 3ARGA 4Z7NF 1UH3A 5GRJH 4KTEL 4NN5C 3RVWC 3DRQB 3QCTH 5JW3L 5FOBB 2E7LC 1GGBH 4ZPVB 1T03H 4JE4B 5IBUG 3D6GA 3VXUB 1I8MA 3RI5F 2FBJH 4IOFD 2R56H 3DGGA 4DN4H 2WUCH 1CD0A 3X12A 1WFUA 2HMIC 1GGUA 3OKKB 5KVEH 1CD9B 5I8KH 1UZ6F 4QXUH 4PP1C 2BVQA 5D7SL 1FPTL 1QR1A 2KPNA 3V5KB 4HKJA 2WBJD 5JXAH 3PWPB 1X4ZA 2Q86B 1ZT4B 1KTKE 4PJIE 1T21B 3VRLE 5B8CA 2EDLA 2HFGL 3MGTA 4OAWA 4S1DD 1RQ5A 4XP9H 3DV6A 1JGDA 1BJ1H 4MAYC 2MMXA 1A6UL 3H7BB 2GTZA 1MVUA 1XZ0B 2OTPA 4BSVA 2UWEB 4UAOB 3D87B 4TSAH 1OD7A 4HS3B 3SO3B 3IVKA 4K07A 1QFWM 4O58H 4DQOL 2DM4A 1KBGL 3WDIA 3MZGB 4WUUD 4NPYA 2JCCB 2KUTA 4R4FH 3BSZH 9CGTA 4XNYH 3C09B 5C0GB 2DLEA 3O9WB 5HGAA 1CXIA 3IS1X 2EEBA 1MFCL 2DQIH 4OM0H 1X44A 4KK9C 5AUMA 4Z76A 4BA8A 4ONHA 3EYOB 4ODHH 1RUPL 3T3PF 2X4OB 4RZCB 3VFOB 1I1YB 3PL6B 2Z8RA 3QEGH 1RUKH 3FB7B 2W65B 5LGJA 2Z31B 4N8VA 1QFWH 2V9TA 3DX6A 4RMQA 2NY0C 3U7WH 1A0QH 5BMFL 4MAYA 3RU8L 5F1IB 3FZUC 4XZUA 3BKJH 5SWSD 1L7IH 5ICYB 4ZOAA 3VGEA 4AG4H 3U4BL 3TIDB 3LD8C 4JZJB 4PJAE 2GCYA 3AAZB 2QHRH 4YBLC 1BQSA 4KHTH 1H5BC 5TDOB 2IAND 4RISL 3AFLA 1NGWB 1XGTA 4ZOEA 4RAVA 5DHVA 5JDJA 2P8MB 5BOZG 4KQ4H 1QBML 1JNHB 4MCYB 3DUUA 4WI7A 1QZ1A 1BD2E 2E7BA 5ALCL 3VFRB 4IRJC 2IMMA 4KJYB 3ZSSA 4K3EH 4XNUL 5DRXB 2PN5A 3QEQD 3RY6C 3KDMA 4PGCB 5IESL 4B7LA 3SDCC 4WU5A 1AD9A 1CU4H 1SEBA 3V6OC 3ZKSD 4RA3A 3A67L 4APQB 5E6IC 3DI2B 1Q1JH 3RFZC 3FMGH 2J6EL 3EFDH 2AJYL 3LDBB 1NBYB 4Y4FC 1D5XB 3VXRE 1E27B 2GQHA 4PJDF 4JO3L 3LS4H 5K59F 2BSSB 1M05A 1ZHBB 1M1SA 2IFFH 1AFVH 4DZ8B 1RAMA 1WWBX 4N0FB 4UT9L 5EPMB 3AREB 4ODTH 2DICA 4KI1A 5DHXB 2G9HA 4R4BB 4W6XB 5D7IB 5DMIL 2EDDA 3UJIH 4F7PA 1H5BA 4EI5B 4P4RA 2VDKL 3GKZA 1IMHC 4DTGH 1OF2B 1QLEH 3STLB 5IGXL 2AQ1A 4OCYL 3FRUA 4LLVA 1DBML 5FGCB 1DEEB 3VRJB 4IRJA 1NUDA 2Z4QA 4NKMA 3B9AA 3RY6A 4JG1L 3F5WB 2HKFL 5I1EH 3GSVB 5F93C 2L7JA 5HHNA 4YHKL 4OCSH 3SDCA 4G3YH 4UOW1 4Y88A 4PRPD 3V6OA 4C83A 1XIWD 4HZLA 4IBLT 5E6IA 5FKAB 4PJ9C 3QEHA 1N64H 1NGZA 4Y4FA 4AK1A 1OTSC 1BVKB 4LLUB 4JRWA 3OKLA 4MWFA 1VGKB 4OIAA 2X2YA 3N1PC 5IBLD 3W0WE 4NT6B 4GBXC 2X4UA 1YYLL 2DBJA 5CJ5A 2CIIB 3RWDA 4JB9L 3RZWA 3BH8B 3QWOA 5ADOH 5LGKA 4O00A 1Z6JT 4HS6B 4F8QA 2D0HA 4G7YH 1BQHG 5JTWA 1S78C 1KB5B 1BAFL 1SYVA 5I8EB 2ERJB 4JZOA 1BJMA 1T3FA 3QDMB 4OD3L 4P46B 5HHVL 3D9AL 5BZWB 3VFTB 4ZDHA 3BE1H 4XWOD 3GSWA 4OZHE 3F62A 3EOYG 2V7NB 3ET9F 3EZ8A 4NZRH 1IKNC 3S88H 4OV5A 2HJFA 4DOHB 1HHIA 3BZEB 4L1DA 3HC0B 2LV4A 1D6EA 5GRUL 3SPVA 4OFIA 1GH7A 3MRQA 3NPSB 5J6HB 5TPWH 3U0TA 4FG6C 2EDYA 3A6CH 5IOPA 3EHBD 2OXGA 4FQCL 4FNLH 4YPGB 4DKFL 5E70A 3SE9L 5ID0B 5I1GL 4MVBD 3UYRL 1S5IL 1FYHB 4NUJA 4YO0A 1ZT1A 1ITBB 5DR5L 4NQSA 4RIRB 2VLLB 5GPRA 5JIIA 1LK2A 3QAZC 4GBXA 5TGBA 4V2BA 3IFPA 2AAVA 4M6NL 3DXAE 4WDIA 4HHAA 4HGWA 3NGBC 4U6XA 1LO4H 1KIPA 1NLBH 1XCTB 4Y4HC 4WU7A 1NGPL 2EDHA 5T33L 3WIFA 1BLNB 4I48A 1V7NH 3IU4H 1IGCH 4A6YH 5KG9B 1IKNA 2XY2A 2AJXH 32C2A 2DAVA 2YMXH 1F11B 1YUHA 4OLWL 3IDNB 3LB6D 4OZIA 1FGNL 4DGYL 2WP3O 4N0UE 3G9AB 2GJZA 1FV1A 5L2JA 5HYEA 4N90D 4OZ4B 3V4UH 4KQ3L 5EZOH 3BKYH 4ZMAT 1J1PL 2AQ2A 4KDWA 4WW1B 3VI4F 1DVFB 4D9QE 4TUOB 1LVEA 1VFAA 2KQMA 5L88H 1WAAF 3FFCD 5DJZA 3T0DA 5K9QI 1DLHB 1L6XA 2C4FT 2GK0B 1RMFL 2F58H 4GAYB 2J8UB 1JF1A 2W9LA 5DRZB 5I18L 2P5EA 1T1ZB 1LILA 1AGBB 2P7TA 1QFPA 3UTTB 4M62H 2P4AB 4U7SA 4ODBD 4DN3L 5ERWB 2AXGB 3U30B 4Y4HA 2ZNXA 1YY8B 1H3VA 4ODXB 5FYLH 1EGJH 2R2HA 4NN6C 1Q9WB 4X80H 3U83A 4N8CL 4HSQA 4AQOA 2DF3A 3BGFC 2FIKA 4Z78B 4QHMA 1HSBA 4Y5VA 2GT9B 4LAQL 5JOEA 3V0WH 5ETUA 4KUZH 4P2OD 1BWWA 2HTKC 4ELKA 3C8HA 15C8L 4AMKL 3QCUH 1T7XA 4X7SL 2DLGA 5IB3B 4ELMB 2QQLH 5I30L 1RJZB 2X5PA 3TVMC 5KS9E 5I76B 5LWYH 2XQYG 4YBQC 5I1KL 2V2TA 3N1MC 2QSCH 4GG6F 5FA3A 2E7MA 2VUOA 4KDTC 5IK3A 5T3XL 2FR4B 1W0WB 4UMGA 2OTUA 2EIZB 1YEJL 3GMPA 5DI8A 4S10A 1T04A 2X7LB 4UT7H 5DJXA 2RCSH 5E2WH 3WLBB 4YHZL 5DJ8A 5DZLA 1YMMB 2P5WD 4CNIA 2DLTA 2DQGL 1JYVA 5E2UH 3KJ4B 1MCOL 1X5KA 2V7HA 3ARPA 4U6YB 3L5WA 4FTVA 3UTPD 5H2BA 5E9DD 1F4XL 2DRUA 4KDVA 3EIFA 3DETD 3NACL 1JNLH 3JWDH 3ZHLA 1PZ5B 4JLRB 1JGLH 3Q6FA 4RWYL 4PUBL 4G6MH 4JG0H 2HWZH 3EJYD 4JY6B 5FK9A 1C16B 3HZMB 4POZD 4L4VA 4P23D 4E41A 5DLML 1EERB 2EXWC 4O2FA 4PR5A 2XTLA 2UZIH 1P6FA 5SWSE 5I1JH 4PRHB 1ACZA 2PO6D 2OL3L 3T4AA 1BJ8A 3E6FB 2JB6B 1NLDH 1U92A 3LN9A 1U91A 1Z5LB 3X3GH 3O4LE 1YDPB 3I6GB 2FD6L 2Y5EA 1FFOA 3ULUL 4A6YA 4NQVB 2YRZA 2AV1B 1F90L 3NA9H 5F6HJ 4N5ED 3W9DA 4KDTA 3V4VL 1WIPA 3IFNH 4K23H 5B39A 5ESAB 5GS1A 1HN1A 2VN7A 5FV2A 2Z0BA 1CLZL 4GSDL 1FAKT 5F7LB 3QEQE 4NQCD 1ZWIB 4X6CE 3EOBB 3QUKA 2JIXA 3ULSA 1YQVL 4LEXL 2HRLA 5CP7B 2ENSA 4UAOC 5SWQB 3MJ7B 1DUYA 3DURB 3LKOB 4IOSD 4EDXA 3TCLB 1M7IA 5IMKB 3QUZD 1IL1B 5FKPB 5FOBA 1F5WA 2B1HL 1YC7A 2AERT 2OQJB 5ID1B 3VXUA 4M5YL 4PJCF 1T7WA 7FABH 1BPVA 1RUAL 3F7YB 3C09C 2FJGB 3O9WC 3QZWG 3KYKH 1YYMH 4LEOA 1NC4D 3OKKA 1OAZL 5FAAA 4KKCD 2AGJL 4PRIB 3ARYA 2PETA 1K8IB 2HG5A 1JGVH 2FX7L 4P99A 4YHLH 3BO8A 1MQ8A 1D5IL 4L8DB 3FAXA 4J3SA 4L8SC 2Q86A 1ZT4A 5GS2H 1OW0C 3FQTA 3PL6C 2Z31C 3CSPA 1MAJA 1LO0H 5JA9A 1N8ZB 1FZMA 5BS0A 4YFLI 4XGZA 2CRMA 3BQUC 3RX7A 2AI0L 1OARH 1XZ0A 3WV0A 4ORZC 1N59A 2UWEA 1FP5A 1KFAL 3LPFA 3ARDA 4LDOB 5JW4N 4HS3A 4BZ1L 5D71L 4KMLB 3H3KA 1EXUA 4HH8A 1W72L 4FFVD 2JCCA 2VQ1B 1II4E 3UPRA 2Y7QA 1KULA 2XKUA 3O2WL 3F7RA 2DB8A 3MLUH 4PJGB 3O9WA 5HYFA 4M3JA 3CC5B 1D3CA 4RAUB 4PY8J 5TDPB 4XAWH 4HWEH 2NXZB 5FA4A 3ZKND 4H20L 1J8HA 1B0WA 1MWAL 2DKMA 2VE6A 4PJGF 1YMMD 4L8SA 1FZJA 1RIUL 4RFEB 2X4OA 4AENA 1OW0A 3CK0H 1T1YB 1JI2A 2Z31A 2APWA 5L0QC 3LDBC 3CFJA 3UPCA 1DN0A 5INCB 4G8GB 1CE1H 5D1XD 2Y4SA 1FJ1A 3O6LL 1WFOA 1V05A 4WFED 5F1IA 1ND0A 2DWDA 3BQUA 2DJUA 3NCFB 4ZTOL 4HIEB 4YXHL 3AREC 3AAZA 3VGBA 2W9EH 3X11A 1H0DB 1YN7B 2PNDA 4JO1L 5TDOA 3LS5H 1QVOB 3W2DH 4EI5C 3LKSA 4NFCA 3BVNB 3I85A 1NGWA 1FLRH 3DVFA 3NTCL 3MROB 3M45A 3PP4H 1NEZG 2IAMC 4N0CC 5JZ7C 4HX1A 1JNHA 4MCYA 3OAYH 1JGUL 5GRVL 1TQBC 5DMYA 3VFRA 3VXSD 1ACYH 3X14B 3QNXB 4O9HH 4XMKL 2CKBL 3STBA 2Y06H 4IEFB 4YQXL 4X7TA 1MVFA 2NY7H 5AWNH 5D72H 2R0KL 2NLJA 4R8WL 2APVA 4PJDE 2YD2A 4JM4H 3G5VB 3PDOB 3LOWA 4YH6A 1D5XA 4XTRC 3CSBA 4PJHB 1A6TA 1CBVL 1HOCB 1YN6B 2BSSA 3UTZB 3GM0A 2MTPA 4LHQB 2Q6WB 2Z92B 2ZUXA 1K8DA 4N0FA 5CHNB 3AREA 1OVZA 3KYOA 3MNZB 3UXFA 4PS4L 3LEVL 4UB0L 4UILH 5T1MA 4N90E 2X9WA 4EI5A 3VFVB 1H3PH 2O93L 3E6HB 3STZB 1MJJB 2IAMA 3STLA 1Q9LA 1G7MB 5I1CL 2OK0L 1L7TH 3PWJB 4Y1AD 4P46C 3RKDD 1DEEA 1I8LC 2B2XH 3KPPA 1WICA 5C2BH 3TN0D 3P4OA 4R26L 4DAGL 3TPUB 1D5BB 4XB8A 1OHQA 5A2KH 3LPWA 3GSVA 1T0NA 3GMMA 4X6EA 4C54A 2WINA 3NBNA 1FNSH 4GKOA 4ZUUB 4X4MA 5T1KB 1EV2E 5L8KB 3OKNB 4MXWL 4Z7WA 1FSKB 3PJSA 2Y1VA 3H8NA 5I1DB 1JNNH 4FP8H 3VXTA 4NQUA 1V5JA 4S1QH 4X9IA 3BPNB 4LFHG 1FNHA 1TFHA 1ZOXA 4NT6A 2G2RB 3PHSA 2Q20A 1A7QH 5C0FB 3BDYH 1MHHA 1A7OL 4WFFD 1T0MB 4AEFA 4K9EL 4MSWB 3UBXB 1C5DB 3BZFA 1HWGB 3L9RB 3PP3H 4F9LC 2P5WE 1SBBA 4MD4B 3VG9B 4YHOH 3SE8H 4JVPA 3QDMA 4P46A 1EFXD 1OAYH 3VFTA 1I8LA 3UTPE 3L5XL 1AIFB 5E9DE 1IBGH 3UAJC 1FG2A 1IQWH 4AH2A 4MJID 2V2WB 3C5SB 3EYQD 5ILTH 2YD8A 3BZEA 4FXGB 1P2CB 4HV8A 4ZQKB 1K9TA 4JFEB 1CDCA 1RIHH 4HKBB 1T1WB 3P3YA 1UEMA 1GOFA 1ADQH 1YQ2A 3BRGC 2ICCA 3ARGD 5LBSL 1K4DB 1QSEB 2CR3A 5F9OL 3UTSB 5KSUA 3FQWA 3I50H 4LF3B 3FOMA 1ORQA 3TM6A 2QQKH 4RIRA 2VLLA 3MV7D 4WO4C 2AXJA 1HWHB 1HH6B 3SQOH 3BRFA 1SJHB 5C0AA 3WMSA 1MHPH 1CL7I 2WWKO 5LXGH 1LHZA 4PYHA 1P9MA 2Z9TA 1PAMA 4M7LH 1KIQA 5M95B 3CVHL 4WY7L 3GSQB 4F9LA 4PJBB 2E9IA 2F54A 5FF6A 5I1HH 1RHHB 1QSZA 3MRDA 1G9MH 5DVKA 1NCNA 4S2SB 5GSRA 3UJTH 2CGRL 1KLFA 4KGJA 1PVHA 1MCQA 2ZCLH 5KW9L 2FWOB 2DI9A 5JHLL 1NFDE 1B2WL 5GZND 3AXLB 4Q58C 2BDNL 4IIQC 5F7EL 1UXSB 1QFUH 1N0XH 1DLHA 1KJ2B 4K2UH 3MOQA 3T3ME 3KJ4C 5B38A 4WO4A 1BVLA 2IQ9L 5DRWB 5DRZA 5C6TH 1KLUB 4G8IA 1T1ZA 4MJ4A 3FO2A 2HMID 3E3QC 5FB8A 3QI9B 1ZLUH 3RUGF 3LIZL 4LSTL 4CRPA 4AM0B 4GRMB 3MLZH 4K3GA 1L0YA 2VR5A 1CS6A 3GI9L 2A38A 5M7QA 1Q9WA 4OGYL 1PY9A 5ISZB 1XGUB 2OMNA 3BMVA 3IXTA 2AJZA 4PJ5E 3SQBA 5GRVK 5D1QB 1DZBA 1U93B 4TOYL 1NKRA 1PQZA 5F1OB 4Z8FH 5DDHB 1LMKA 2MHAB 3B9KB 4XHJD 4GG6E 4PG2C 3NIGE 3ALWA 4ZUSA 2BERA 1RJZA 5I76A 1G9MC 4MXQC 5DVLA 3RNKA 5DTFB 4M7ZB 4JY4A 4PV9B 4DKAA 3DX8B 4FXKA 1CGWA 1Q9OB 2EEAA 4IIQA 5EU5A 5GGSA 3MRNA 4I0PC 4UDTB 4OIIH 5EOCH 4LRNL 4Y16B 3IXAB 4RMRA 5B4MC 2HFFA 5D7LA 2IBGA 4LSVL 3KPLA 1I7RB 5FYKE 3PDGA 3D3VD 3SDXB 2O5XL 4WIQA 1KIUA 4M1GL 5DVMA 4X4ZA 1PZ5A 5J6GB 4HKXB 3ESUF 2AXFB 4JY6A 3S4SB 5A40E 4P48A 3LKQA 3UX9B 2F74A 1PLGH 4TRPL 3VH8A 2O5ZL 2X44D 3E6FA 3DGCR 1I7UB 4LSPL 3ZHKA 2YPKB 1QSED 3V6ZB 1AC6A 1Z5LA 4FFZL 4OCWH 3KPQB 4WHYG 4J23A 4PG2A 3A6BH 3FZUD 2DQUL 1FPTH 5F44A 3KXFB 1BIIB 4ZD3L 5DUBB 3HLAA 5E2VL 4YIQA 3W11D 4PJEA 1ZLSL 1CLYL 1H15A 1R5WA 1N2RB 2XNAB 1NGXA 2R23A 2E27L 1U8OB 3V6FB 1F45A 4I0PA 5HYJA 1ZWIA 2IALB 3ETBF 3G08B 3P9LB 5CZXC 5ADPH 3CFBB 3GIZL 4MNGE 5SWQA 4L4TE 4MZ2A 3LKOA 1R3IL 4WHTB 1BJ1J 3N0PB 2NXYB 1KBGH 5FKPA 4YC2B 1MREH 4W6YB 2ITDA 2OQJA 4WTXA 3SDCD 1UA6L 2UVEA 3QXUA 5JXEC 5C0BA 3F7YA 3O3UN 1TJHL 5E6ID 2FJGA 4L3CB 5CILH 5HJ3B 4L8CB 3P77B 1CXEA 4MS8D 1MFCH 3N06B 4KRLB 4Y4FD 5DJAA 4Q97A 3SY0A 2ZOKA 2NXZC 1Q94A 1JNJA 4LK4A 1EEUA 4UQ3A 4L8BB 4HK3N 1UG9A 4DVRL 4L9LB 4Y1AE 4M00A 5ICXA 3QIWB 4AEIL 1N8ZA 3RWHA 5C0DB 1I8IB 3PXHA 3FO0L 4NQDB 3RU8H 4J3OC 1IARB 3HRZA 4YHNA 4JPIA 1NGQH 1YEKL 5DFVD 5AYUH 1GL4B 5L8LB 5ISZD 4KI5C 5IB5B 1EUUA 3TA3B 3IS0X 5I2IB 2EECA 4RISH 4TSBH 2NTFB 4UUJB 1AR1C 3SDAC 1DQDL 5FDYA 4ZUWB 5JXEA 1FAIH 1KYOJ 1WZ1H 3MV9D 4TTDD 1GXEA 3V0AC 1T66D 1FL3A 2C7UB 3JUYA 4P4KB 4KJPC 3MCLH 5ALCH 1FZOB 4XH2B 4NKQB 1NMCC 4RAUA 5TDPA 6FABL 4XNUH 4WFFE 5EBMB 1H3XA 3LRHA 3MRHA 4RFEA 3V8CA 4JDTH 3RAJH 2EXYC 1K85A 4GBXD 4GQ9H 3KGRA 5DQJB 4NP4L 1CD1B 4G8GA 4Z7QE 4MJIE 4GKSB 2YUZA 3WFDL 1MFEL 2HH0L 5IMLB 3FKUS 4UV4H 2GAZB 3BYYA 4UT9H 1AKJB 4GXVL 4JRXB 1NUGA 1IQDB 1FYTB 1H0DA 3R06B 5DMIH 1QVOA 3JWOL 3IKCB 4WCYL 2Q3AA 3BVNA 4X5XA 2CRYA 2AXHA 3I9GL 3MROA 4LCWA 3SDAA 1JHKL 5A43C 1KG0B 5IGXH 3MA7B 1BHGA 3W5MA 1DANU 1QA9B 3ULVL 5I1AB 5TQ0L 4BFIB 3X14A 1VFUA 4N68A 3KLAB 5E8EA 1ZT7B 3DVNA 5B3JF 4W4NA 4K8RD 5L7XL 1FO0B 1A1NB 2XZCL 4LKXA 2AJSL 3P0GB 3BUYB 4MA3B 3P73A 1VFBB 2VIRB 4QRQB 3KPNA 5FYJU 2OZ4H 1ZLWK 3PDOA 1IC5H 2P5ED 1E28A 4JQIH 1U8MB 3FQXA 1JGEA 4PJHA 3ZDYE 2XOTA 3UTQB 5A2LH 3VI3E 4ZFGH 4X0KB 3MR9A 3BPNC 4B41A 1X5AA 3GKWH 5J06A 1OCWL 1E0OB 1JV5B 1QBLL 2Z92A 2O61B 1KELH 1A4KA 3QB7C 5IB2B 5CHNA 3MRKB 2BY1A 2YK1L 3S37H 3O3AB 1HINL 3SKJL 5D8JL 4JQVC 3WYRA 1U36A 4JB9H 2ED7A 5DURD 1QLFA 2D7TH 1MJJA 3BZ4B 5EU6B 4X8JA 2BSED 1KJ3L 3LEXB 3E8UL 3VG9C 5DMKA 4U6HB 1BAFH 3PWJA 1EAPA 3QUMB 1ZTXL 3D9AH 3CGTA 4ODUB 3LKPA 4NBZB 4F37F 1J88A 4PRBB 2MOVA 4HJ0D 5GZOD 4PY7B 3VXQB 5GRUH 4XPGL 5T1KA 3WNNA 3C60D 3CPLB 5KSVB 2EO9A 4FTVD 1KJ2H 1RK1B 5JPMA 3IGAA 4FQCH 4GFTB 5I1DA 2VDRL 1ZGLM 5I1GH 4HUUA 3UYRH 1S5IH 3QIUA 3VWKC 1ZGLP 3BP4B 4WI3A 4KROB 4XCFL 5DR5H 4L4VD 3OR7B 4E41D 3T77B 2HT2D 5I1IH 5JO5A 2MPAH 4ZUTB 4CKVX 3VMPA 1AHWC 2FX8L 3TNNB 5IVNA 2D2OA 3NCYP 4LGSB 4M6NH 3O2DH 4UINL 3C5ZC 1J0IA 3OJVC 4J1UA 3L9RA 3GSXB 5DUML 3O11A 2OJZL 4I0CC 1CWVA 2HT3C 4OUOA 5T33H 2H6PB 5EIIB 3FFDB 1D5MA 1S9VB 1K4CB 5GHWL 5D2LA 3D3VE 4GKZA 3BN9D 2V2WA 3C5SA 4ODSL 4FXGA 1SBSL 4M1DH 3RHWK 1HXYB 3ZSTA 1ZK9A 3TBYB 4HKBA 5DJ0B 1WSST 1T1WA 1FGNH 2GHWB 4BSWB 1XF2B 1AKJD 3U7YH 2VLRB 3O45A 5DEGB 1ULVA 3OAUH 1A9EA 1JF6A 5CSZA 5FO8A 4LF3A 1BP3B 3VWKA 4WW2B 3EGSB 3ZE0F 2RGSA 2OZ4A 5MEQA 2CK0L 2RFXA 3RJQB 5A2JH 1PZUB 1RMFH 1AHWA 4Q6IC 1SJHA 4WW2F 4NC2B 3IT8D 3CH8A 3BWUC 3EOTH 3QI9C 3C5ZA 5I75B 2X4PB 3NCCB 4QXGL 4BZ2L 4ZAKC 3TO2A 1J87A 4PJBA 4F80A 4OLXL 4FQHB 4U0RC 5DVOA 3RVUC 4BH7B 4DGVH 1RHHA 5D1QC 5J13B 4S2SA 2R0ZL 2E7HA 3U2SA 4IMLB 1JZ3A 4LAQH 5BS0D 4XNQB 3B9KC 3IDXL 3VXMD 4G8EA 2C5DC 3HPJB 3LKRA 3OF6D 3AUVA 4E42B 3AC0A 3F12A 3V6OE 1EMTL 4N0RA 1IM9D 3WIHL 3ARDD 5I1KH 4C56A 4ZO7A 5ANMB 4NJ9H 1HHGB 1JFQH 4UTBL 2VISB 5DGQA 5T3XH 4I3GA 3OJ2C 1HKFA 4G6KH 1UXSA 2IPUG 4Y16C 3RBSA 2FJFA 4JY5L 1KJ2A 2VZUA 2DQGH 3GO1H 3PIQA 4Z7WF 4JFDB 3TYGL 5K93A 1GCFA 1MCOH 1FG9C 2ADFL 5DMGC 1V3LA 2Y25A 1KLUA 4Q6IA 3B2VH 2ZUUA 5JUEH 1F4XH 1RZ7H 4RMWA 5JR1H 5LG1A 1NBZB 1NCAH 3NACH 3QIBB 4HQQL 3QI9A 4PRAB 4OQTL 4BKLB 5HI4C 3AM8C 4Z77A 5BV7B 1J8HD 4O2EB 1CFSA 1CDBA 1UEYA 4JFFA 4GRMA 4AM0A 4J8RA 4ZAKA 5I8OL 4Y5YB 4WI6A 1FZKA 4M43L 1A3RL 3NPZB 1OAXL 3O2DA 5EUKB 1XGUA 4Z95L 5C3LD 4PJ7B 5D1QA 1FL5A 2OL3H 1T2QL 4OGZA 5DDHA 3RI5K 1OT1A 2MHAA 5C09D 1S7QB 1JPFB 4NFBA 3LSOB 3B9KA 5CGYC 1FH5H 3JSSA 3BQUD 3RTQC 3IDYB 3MRCA 4KROD 4PJ7F 3O2VL 5SX5H 4ZXBD 4HK0B 1ZGLA 1DQJB 1QNZL 1P7KA 4UU9A 3V7MA 2ZUSA 3ARFC 2BSRA 5D1ZB 4P2YA 3V4VH 1Q9OA 3OMZA 4YBHA 4XCNB 5J8OA 4OM1H 4UDTA 4N9GB 4PGEB 4Y16A 1CLZH 4M6AA 2FX9H 1Y0LB 3IXAA 3T04D 5JORB 1HXMA 4FQXC 3MLYL 5EFIB 2GKIA 1DLFL 4MZ3A 1WK0A 1A7NL 4LEXH 5EO9B 1I7RA 3ZO0A 4FS0A 3SDXA 5IB4B 4OT1H 5EUOB 2VL4A 1NL0L 3P11H 5J6GA 5C9KA 4YC2C 3AM8A 1RJLB 1DEDA 3S4SA 1MHEB 2B1HH 4XMLH 3T2NH 5FUZH 4M5YH 3F6IA 1SY6H 2A73B 5EWIL 2NZ9D 3BX7C 1DQMH 4O4YL 1WC7B 1QFHA 3U4EA 5JDSB 1OAZH 2XWBA 3BKMH 3GI8L 1U8QB 3KPMB 1UWEH 1IC4L 3PGDA 5F9WC 3WXVL 1KCVL 3KYNA 1TENA 2QQNH 3EAKA 2EC8A 2GUOB 2X1WL 2BJML 1D5IH 4Q2ZA 3RTQA 3L6FB 5F89B 2AK4B 2X1PA 4QNPF 3HA0A 2X4TB 3MGOB 4KJWC 1A7RL 4DW2H 4AEHL 4OZIE 3WBDA 3RWCB 2D03L 3P30L 3ARFA 2XNAA 3CVIL 2E9JA 4GAFB 4MDIA 5MERB 5ITFB 1NH6A 4IDJH 5AZEL 1GC1L 2YKLH 4XCCL 4K55A 2IALA 5ESVA 3PHQB 3GK8L 2IAMD 5JZ7D 5IVOA 2D9QB 3CFBA 2AI0H 4FQXA 4XHQA 4U1IB 3QRGL 4DWHA 1BX2B 4XVTH 4S1RL 2PCPB 5DD1L 3Q6GL 4IDLA 4L3EA 3IJSB 2NY5H 2PW2B 3TA3C 2P5EE 2W9DH 1LE9A 2X9XA 4JFOB 4MJ2A 1I3VA 2VDQH 5KZCB 2CMRH 2R4SH 3C6SB 3SGDH 3NCYS 1GZPB 1OGAA 1WBXB 2PYFB 4YGAB 4L3CA 1NCWH 4L8CA 4P4KC 3BAEL 2ZG2A 4NRYB 4H88L 1LDPL 1RIVH 2FO1A 1I3RB 4HGKC 4ZUVB 3DECA 3GJFB 4PJFF 4KTDL 5FYJD 5HDOA 2MQ3A 1FCCA 3OBAA 2OL3A 4MYWB 3OKDB 4M61A 2UZXB 2C3HA 4JFDD 4WFHD 3EUUA 4CDHA 4LLYB 5KANG 4G5ZH 1INDL 5I8CA 3KLSA 2JJVA 1CDUA 2FIRT 3B3IA 2A6KA 5C0DA 1I8IA 2EYTB 3FQNB 3PNWB 4P2RB 3AS1A 3BPCB 1UWXH 4ENED 3KJ6L 4PB0H 4DZBB 3NN8B 3KYMB 1NDGA 1IGYB 4FTVE 1HHKA 2I07A 3QUMH 4JGUA 3TA3A 3JV4B 2HN7A 2D0GA 3T8XB 2F8XC 2FLBT 5SWZA 4ZUWA 1MF2L 3N1FC 5FYKL 5ACLA 4P9ML 5IQ7L 4NWUH 3IAQA 4L4VE 4E41E 2FO4A 2NY5C 4P4KA 3SE4C 4NQED 2ADJB 2BSTA 2VLJB 4Y2DC 3CJJA 4HPOL 5EBMA 5A16B 1IM3B 2XN9A 3NFSL 3CFCH 1SY6A 4QTIL 1CQKA 4XMPL 1L6ZA 1HDMA 1V7MH 1CL7L 1HKLH 4DKEH 1W8OA 1D5ZB 5EIVA 3UBXG 3PV6A 3ZT5A 4YJZL 5C0AD 1WZKA 2A6DB 4OFYA 2DWEA 1LE5B 4JVWA 2C1OA 2OLDA 2FECI 3IFLL 4R96A 3LHPL 2X1OA 1TDQA 4OZFB 4TULH 5D6CA 3IDUA 5GS0L 3KPSB 4PJEF 4EOWL 5HGHA 1C5BL 2GAZA 4NHCL 1R3JB 1EEZB 2OXHA 1IQDA 3P4NA 1FYTA 4LLWB 3R06A 3D18B 4UB0H 3UAJD 3MOAH 3DRTA 1X7QB 3H2WA 4OCRL 1CXFA 3O6FB 1UB6A 1J0KA 1MLBB 2EDQA 1KSRA 5EZJB 1XCQA 3FB8B 4OLUL 1P7QD 3WEXB 4NN7C 2V5YA 3VXUE 3LN4B 4MQXC 5I1CH 2A9NL 4G9DB 4HT1L 4TPRL 2NTSP 4BFIA 3SE4A 4FRWA 5B3JE 4XPBL 5IVXB 1W72A 2W59A 1KCUL 3FO9B 2VXUL 3KLAA 4NNYB 4Y2DA 4JGJA 1ZT7A 1U8JB 4HIJA 4NCDA 3N85L 3U46B 1W2KT 5GJSL 2IF7A 5IFAL 3KHOA 3QR2A 5DO2C 4X7EC 1O7SA 4MA3A 3QJFA 1VFBA 4QRQA 3HE6D 3T1WA 4YFDB 1VEMA 3JV6A 4CN6A 4ODVH 1ED3A 3MXWL 1U8MA 5CJXC 3HFML 2HFEA 1MWAA 5DJYB 5IHUL 4X0KA 3ZE2F 5ALBL 1JV5A 4RQQA 4JDVB 2O61A 2GSIA 2CR6A 3BMWA 4FFWD 5BS0E 5IB2A 3VXME 1KEGL 5DFTA 1ZEAH 2NY4D 5E08H 3MRMA 3O3AA 4LBEA 4JPWL 4JFYB 3GRWH 3QCVH 1FE8L 5GSVB 2NW3B 3ROLB 2UWEE 4UT6H 3D0LB 2VXVH 4MJ5B 5IG7B 3CDFA 1MJ8H 5E5MB 3J7HA 3BZ4A 5EU6A 3JBG7 3LV3B 3HNVL 2JCCE 2IADB 3LEXA 1P4LA 2DTMH 4U6HA 1H3GA 4E5XB 3QUMA 1B3JA 2VMFA 1YY9C 4LKCB 1S9XA 3DX7A 4XI5C 5E2JA 2FEDC 1QKZL 4PRNA 4PRBA 3PQYB 1OB1B 2WW8A 3WHXA 4PY7A 1J8HE 2EDEA 3B43A 2DYPB 4MA8H 2NY3C 3K8LA 5IBTL 5EN2B 1RK1A 2Y6SC 2FYYB 5ENWB 5CJXA 1MFAL 2VUYA 3K80A 1R5IB 1MRDL 5FM8A 1FDLH 2UV3A 3RX5A 2VN4A 3RWJA 4HXAL 3D1MC 4OUUA 3OR7A 2WMPA 2AEQL 3T77A 5BV7H 2VDOH 4OGXL 4X9FA 4HBCL 2NW2A 3O4OB 5E8OB 2DMCA 4HW6A 1M7DB 1F3JB 1H3WM 5I75C 3DNKA 1ZS8A 1DCLA 3VFWA 3DWTA 2BVUA 1BLNA 2D7MA 3BJLA 3O6KL 1HQ4A 3GSXA 3QO0B 3Q1SL 4U05A 1CVSC 2ARJB 4G43B 4NM8L 2H6PA 4RRPA 1RVFL 5CBAB 5EIIA 4OLYH 3MLXL 2F53B 5IFHL 1RU9L 1P84J 3MRLA 3ZDXE 2IMNA 3DUSA 1E6JH 3UTOA 4ONGH 4NDMB 2OM5A 4I0PD 4CUCA 3ROOA 1X5IA 3SKNB 5KW9H 1HXYA 2W60B 3TBYA 5J11C 4XVJH 4ALAL 3VXPB 2VLRA 3S4SG 3M8OL 5DEGA 5JW4M 1CGYA 2XWJA 3RNQA 3M17B 4KK6C 3ZE0E 4OGAC 1IGIH 1OAQH 4WWKB 3EGSA 2BDNH 5F7EH 4PG9B 5HGGS 4IRSA 5C0BD 5CEXB 4QLRA 5DUPL 3MLVH 4D0CA 3RQ3A 4L29B 1N5AB 3HB3C 1JRHL 3QIBC 5D70H 4QRRB 2G5BB 2X4RB 2X4PA 5JQHC 1MNUH 4HC1L 1T5WA 5BV7C 4O02H 2LQRA 4QEGA 3GRWA 3HI1B 3ZYJA 1CGUA 3QP3A 4Y5YC 2C3VA 1LEGB 1JHLL 1BIHA 4BH7A 4OGYH 3S34H 3QA3B 1YECH 1GGIL 1F58L 3UDWC 5DFWH 4KGLA 4HUKB 3ARTA 2A0LC 5IFJB 1MIMH 2AJUL 3NIDE 4IMLA 2PTTA 4UOJA 5DEFB 3IDMB 1KLGB 1NCDL 1TTGA 1IKFL 2GEEA 4MNQD 5LCVL 5C0CD 5IIEA 1LO5B 2CLRB 5IW1A 3L1OH 3IDYC 4YXKH 1QSFA 3L3JA 5F7MC 4J3TA 1DUZA 4MAUH 3S9DB 4X4ME 2ENYA 5ANMA 2XT1B 4ERSH 5D1ZC 4Z7WE 3FN0H 3RWIA 3G04B 2V9QA 4GQPH 4LRNH 4WTZG 1JYXA 4PGDB 1VFMA 3BIAX 1P53A 1FVDB 3GMQB 4LSVH 5CJOL 4Z7UB 5EOCJ 3GHEL 1NBZA 3QIBA 4FFYL 4DFIA 1TVDA 3AB0B 4PRAA 5HYQB 4RNRA 2ZP0T 4BKLA 4Y4KB 2BVTA 3HUJF 4O2EA 3KPOB 1G0YR 2HT4C 1EJOH 3AS0A 4B0MM 1OTTC 4CVXA 3GJFH 4BQCA 5CZKA 4ETYA 4P59H 5I71B 3FQUA 3NH7H 4NO0B 2O5ZH 3QDME 3EDDA 1ZVSB 4CAGA 1MH5A 4V1DB 2BNQB 2MJWA 1S7QA 1JPFA 5D6DA 1R24A 3LSOA 3QULB 3WD5H 4M7JH 2ZSWB 4J6RL 3FONB 3VFMA 3OV6A 5EO0B 3ZTJG 5LAXB 2ESVA 5GRJL 5D2LF 4F7MA 4HK0A 4MD5B 1JTPA 5TE6H 3VD7A 5E95B 5E2VH 5MP6H 3FQRB 1ZLSH 1G7IB 1T03L 2VYRE 2JELH 4X6DB 5D1ZA 2ITCA 4XCNA 1AO7D 2FBJL 2R56L 4DN4L 3VJ6B 4PGEA 2WUCL 3BP5B 3CSYB 1PW3A 2VKXA 3ZDZF 1X5JA 3SDAD 1U8PA 5IM7B 3DX9A 2EICA 1FNGA 1HI6B 2YUWA 4X6DF 2H3NA 4QXUL 4JFZH 3QDJD 5C0AE 4FXLA 3IJYB 1MHEA 5MEPB 1BZQK 4JFHD 2FDBP 3T0BA 5DS8B 3NMEA 2EXYD 3DV4B 4ORGA 2AV7A 3IRPX 4XNZB 2NMSA 4XP9L 1WC7A 5JDSA 2F54E 1CE6B 1IZKA 3D69B 3TZVD 2SEBB 1U8QA 3RBGA 5DZNA 5EO1B 2VB5A 5I9QB 3C2SA 4QNPE 5GQBA 4PPTA 3FTGA 2GUOA 1X5YA 3QSKB 2YPLB 4KVCL 3MGOA 2J5LC 5LVEA 3CX5J 3RWCA 4R4FL 3BSZL 3RZCD 5MERA 5CLTA 1BZ9A 4QRRD 4XNYL 3MUGB 2NX5B 3DIFB 1CG9B 1A1OA 1PDKA 3TBWB 4HWZB 1I9RH 1G6RB 2DQIL 4OM0L 4WI4A 2AQ3A 1INEH 3WFBL 4JFPA 3GMRB 1CYGA 2PW2A 2P42B 3MODL 2B5IB 4JFOA 4ODHL 1T20A 3AY4C 4K7PX 2X40A 4LASH 5E99L 1H3TA 3WN5B 2IGFL 1WBYB 2DLHA 3C5JB 1Q8MA 3QEGL 5E5UB 4D8PB 1RUKL 3SCMB 1DQDH 5F9JA 3MJ8B 5D5MF 1WTLA 1U95B 3U7WL 2QBWA 1A0QL 4NRYA 3WL9A 3DMMB 2IQAB 3BKJL 1L7IL 1LP9A 3NABH 3QIUD 4KK5C 3GJFA 3TIEB 4D0DA 2QHRL 4P2CG 4A2LA 4HIIB 2XWTB 4K71C 4Q0XH 4MA1B 4RGOH 2QQQA 4KHTL 4PGBB 5LGHH 4M7KH 3ZKMD 1F13A 3SKOB 1BQLL 2VZ3A 3SE3C 3MV8A 4WI2A 4KKAD 4W68A 5HI3C 3RVTC 3P9MA 5IROA 3FQNA 1B4JH 3PNWA 4QTHB 4FQPA 3BPCA 1KCRL 2Y72A 4WFGD 1XR9B 3KLDA 3NN8A 2VLKA 4CBPA 3KYMA 4R6UA 3MRFB 4HF5H 4Q6YA 5D7LE 4QYOB 4YWGH 3MBXL 1CU4L 3JV4A 3AY4A 3E3QE 4WCYH 3T0AA 4RMUA 1NANI 4FN0A 4P5TC 1Y6KR 1Q1JL 2EYSB 4V1DD 4G80A 1FQ9C 3FMGL 3EFDL 2QADC 4NQXB 1XAUA 5HGBA 1X5GA 3NCJH 4UI2A 1PG7X 1C1EH 4I13B 5MEOB 2H26A 3LS4L 3L7EA 2LAGB 4Y89A 3ULVH 2PXYB 2ADJA 1DBKH 5A16A 1IM3A 2ZZUT 3P0YH 3VWKD 3DTXA 5E8PB 2N1KA 3O6MH 3UJIL 1TCRB 2XZCH 2X4SB 1X4XA 5L2KA 1N3NA 1BFVL 3H9SD 5EOTB 3VE0B 4DTGL 3SE3A 2VITB 4PJEE 1QLEL 4ZO9A 3C5ZD 1MCDA 3EO0B 1AI1H 2QSQA 2PTUA 3KPSA 2FEEI 1OCWH 2DDQL 5HYJE 3QG6B 2YBRA 1HHJB 2EIEA 1R3JA 4UIKH 4KC3B 1X9QA 4PP2B 3EDFA 2YK1H 5I1EL 2DJ4A 2CLZB 2B20A 4OCSL 4R2GB 1MAMH 5D8JH 1IAKB 4G3YL 3VDBA 1X7QA 4YK4C 2YN5A 4LGPB 2NY6B 3QQ9D 3ZL4L 4P5TA 5EZJA 4P3WA 1JN6B 3WEXA 4R4ND 5DGRA 4M6MH 3LN4A 5BZDB 3OR6A 5I19H 2IH1A 4IRZH 5C0BE 2YPLD 3RDTB 4LNVA 4C56D 5IVXA 3FO9A 3HR5B 1RHFA 2F5AH 3OAZK 5ACMA 2B4CH 1U8JA 1OLZA 5INDA 4GRLB 5I17B 3O3EB 3ULVC 5MI0B 1KXTB 3FT4A 3HG1D 3DLQR 3CH1A 3H3PH 4TVPH 5ADOL 3GFUA 4XPTH 4JPVH 3QUXC 5B21A 1SEQH 1VGEL 4YZFE 2C26A 1ZHLA 2HTLC 4FMFA 2JF1A 4ZO8A 1YPZF 4JDVA 1KT2A 4ZAKD 1XGRB 5KSAB 2R39A 3BE1L 3NFNB 4XCFH 4HDIA 1A8JH 2VAAB 2EH8H 3O4OC 3S88L 1G7LB 2NW3A 3ROLA 3KHQA 3ULUF 4ZO6A 4XT1C 4MJ5A 2BC4B 3WLWC 3SBWC 3WNMA 3F8UB 4P57B 3VFUB 2Y07H 4BQ9A 3GSNB 1DDHB 4PTUB 4TQEL 1YEGH 4OF8A 4FNLL 1V3KA 5FECB 4E5XA 2FNBA 2YSSB 4EI6A 2R29H 4Y2OA 5T1LA 4KRPB 4JCLA 3L3GA 1B0RB 4G9FB 4X8XA 2A6JB 3QXDB 3V7AE 1UXWA 2DYPA 3TJHD 3BH9B 4UTAH 4KJQD 1TZGL 4R3SB 1NBVH 2BNRA 1LO4L 2YXFA 2B4CC 3QHTC 1NLBL 3QUXA 4JRYD 5B3NA 4WWKC 2ZUQB 3C6LA 1E4XI 1V7NL 4KXZI 2EIBA 4G8GE 4RWHA 3IU4L 4QXTB 5C0EB 3VXOB 3LQZB 1N7ML 2CK0H 4A6YL 4NNXB 3UBXI 2AVGA 1CICB 5E8OA 5LKNA 1M7XA 3MRIB 2AJXL 1AP2B 3ILPB 3N9GL 4B53A 2YMXL 2RHEA 3SBWA 2PXYD 4KI5E 3QQ4B 1RURH 1OAKH 2I27N 3BKYL 3ARQA 4LCWE 5HHOA 1NAKH 2VABA 3RTQD 4EN3B 5CBAA 4QRSB 2F53A 4CVUA 35C8H 4BK5A 1YNKH 2QEJA 4JFXB 4P2QA 4Z7VA 5ESQB 3CFKB 3ARFD 4NKOA 3RWGB 3MMEB 2HVKB 1T6VN 1GIGH 4LOUC 2F58L 1H3UA 1XF1A 2HKHH 2Q8BH 1MUJB 3NIFF 4TN9A 2O5YH 4JFHE 4NWTL 1DBBH 4OZGB 4BUGA 4FQXD 5I0ZA 4XC3H 5T3XD 1LD9B 1VACB 4M62L 5DC9B 5C07B 1KYOK 3WIHH 5ICZB 2DMKA 2BVPA 4LSQL 3GUTA 4L3ED 4K3HA 2LU3A 5J1AB 4UTBH 5FYLL 3V9FA 1EGJL 4PJHE 2HLFD 4X80L 4PG9A 4JY5H 1X4YA 1ZSDA 2ZCKH 2L0DA 4HLJA 3V0WL 3I3BA 4KUZL 4L29A 5GXBB 4F3FA 2HP4A 3AMLA 2G5BA 4Y4KC 2QQLL 1IEAB 4OTXH 5LWYL 5C6PB 5K33A 2QSCL 3FB5B 2ZG1A 3HI1A 1CVRA 5FIEA 4F58L 1KXQE 5I8OH 1VFOA 2H2PD 2C3XA 2AS5M 4U1GC 3GMLB 1FVCB 4UT7L 3QA3A 3F6LA 3SDDD 1JHTB 4YDKH 5DEFA 1Y6MR 4I18B 2OP4H 1KLGA 3QFJD 4KAQL 1C12B 1ETZB 5IEKB 1LO5A 3ULUD 4JO4L 3U36A 1CGVA 2NNAB 1JNLL 1KJVB 3JWDL 3OXSA 3BWAB 4M6OH 1CF8H 4FQ1L 3D0VA 1JGLL 5KSBA 4G6ML 4JG0L 2HWZL 3JTTB 3VXNA 3JXAA 5FXCH 4CL7A 1CGSH 1G7HA 3G04A 1VKXB 2UZIL 4YX2H 5I1JL 1A7PH 5SWZD 3WNKA 3DVIA 2I5YH 4GRWB 3RVXC 1HZHH 4PGDA 4LNRB 1NLDL 1T1XB 4NBXB 1X6LA 3HUJE 1S7SB 1S9YA 5C08B 1ZANH 4P5KA 3X3GL 3MGAA 2ADGB 3BEVB 2OR8A 3T08A 3EDJA 4Y4KA 3MREA 4H26A 3BGMB 4QOKA 4I4WA 5AZ2H 1NL0H 2XN9D 4WV1B 1I3GH 3H0TB 3KPOA 2VDLH 4G6FD 2DQHH 3DPBA 5JW4R 3IFNL 4K23L 3FL7A 5EWIH 4WFGE 1ONQB 1S7RB 4XNZC 4Q9QH 4NO0A 1DBAL 4JHAL 5CEYB 5DYOB 4PJIF 1ZVSA 4O4YH 3VRLF 4H5SB 3OKMB 2BNQA 2GY5A 5I9QC 1DFBH 5D2LE 1KCVH 2ZSWA 5F7FA 3FONA 2PYEA 5EO0A 1MFNA 5LAXA 5K9JH 4L3AA 5BW7A 4MD5A 3SDYH 5GGRA 1G7IA 3FN3A 4LIQL 3K3QA 3KPRA 3CVIH 2CDFB 4KKBC 3VJ6A 2ATPA 2AP2A 3BP5A 3GB7A 3CSYA 4LSRH 5AZEH 2E6QA 3KYKL 4YHYB 1YYML 5DD3L 4DVBA 5IM7A 3WIHA 2WSKA 3CSGA 1GZQA 1HSAB 4NSKA 2HLAA 1JGVL 1P4BL 2YPVH 3Q6GH 2B5IC 4F7TB 5H94B 1IZJA 3MRGB 4AIOA 2OBGA 3SCMC 1YEEH 3CFDA 1AGEA 5DS8A 4HIXL 4PJBE 2DM7A 1S5HB 4EUPA 4OZFG 2EDNA 4ZOBA 2R4RH 1CIUA 3LN5B 3JV5A 1CN4A 5C0JB 1FORH 2MQ0A 4KY1L 4H88H 4PJAB 5L6YH 1OARL 4K3DH 4U6VH 1SJVA 3FT2A 5LJYH 4KTDH 5D93B 3BZDA 4MA1C 4X6FA 4C4KT 3O3BA 1G7JB 3L3DA 4LHUB 5HGDA 2EH7H 3BEWA 5GRXG 3AS3A 3OGCA 5JHDB 3MBED 3ARSA 4C56E 3G5YB 4AYFA 3L3OA 3QDGA 4PREA 2NX5A 3MLUL 4I77H 4YPJA 1F6AB 3BXNB 3TBWA 1C7TA 1MI5B 3KLHD 1R3LB 4HWEL 3WE6B 1FRGL 4TUJA 5EC1A 4U1MB 3FOLB 4JFQB 5D9SB 5CGMA 1T4KB 5EU7C 5DQ9A 5H35B 3ZKXC 5DK2A 1WBYA 3C5JA 5D5ME 3K2MC 1QRNA 3CK0L 1I9IH 4OF6A 3N50A 1JWSA 5HPMB 3SCMA 3DVGB 4JFFE 5D96B 5TQ2H 3D2UD 3MJ8A 1MF2H 4BQ6A 4M8VA 1CE1L 2BCKB 2DS4A 1XMWA 2VDML 5KN5B 1KN4H 4QTIH 4JREB 4QCIB 1JPTH 1KB5L 2W9EL 1CL7H 5E4EB 2X4QB 2YEZB 3LS5L 3W2DL 3NFPB 3SKOA 5F3HA 3PP4L 5JW5B 1U8HB 2EE6A 3QG7H 2X4NB 3K1KC 1VENA 3IFLH 4QTHA 1A6ZB 3K46A 2OTWA 2LAAA 3MRPA 4RGNB 1LEIA 4PLKC 1T2JA 4HMEA 4O9HL 5KVMC 3GSNH 4NUGH 2XZAL 2JTDA 3MRFA 5C8JA 4Y8DC 4R2GC 2Y06L 2NY7L 3SDXE 2NY6C 5D72L 4LHJB 1HH9B 5GGQH 2CDGA 1A47A 4I8DA 5E5RB 3ZT6A 1XR8B 4BQBA 5HD8D 4NQXA 3KNBA 3QNZA 1TPXB 3TO4C 5CUSH 1KNOA 2IBBA 3RDTC 2A9NH 2I9TB 4TPRH 3TH2T 1AXSA 1KCUH 2EDJA 3W0WB 1J0ZA 1S7VB 4G6AD 2YWZA 2CDEB 5DWUL 5E8PA 4GRLC 4HAGA 5GJSH 5F7DA 4YNYA 1IT9H 5DJ2A 4IRSD 3MRBA 1F4WH 1UB5A 2X4SA 1F3DH 2YD3A 3RIFK 5F7KC 5EOTA 4XBPA 4OBRA 3PE9A 4IOIB 5F88B 25C8H 3T65B 3AMKA 1UZ8B 1L7TL 5IHUH 5JPNA 4RX4A 4KKLC 3VDCA 1HK6A 3QG6A 1HHJA 2B2XL 5C2BL 3RIAF 2GJ6B 1KEGH 1MELA 3EYFA 2NY2D 1R3HA 1TTFA 3TPKA 4ZFFB 3V8OA 1T89C 4H8WH 2F19H 5T3XE 5FO9B 1CZ8H 1NC2A 2RJMA 1A1MA 1WZMA 1S9KC 2YS4A 4R7NA 4OZHF 1FNSL 4E0RB 3GMOA 4L3EE 5IQ9B 2PTVA 1TQCB 2GTWA 3MJ9H 2GSGA 3HE7B 3C8KA 1IFHH 4LLDB 3TO4A 1OGAE 3RDTA 3S36H 1UVQB 4FP8L 1SYSA 4S1QL 1HYSC 5A3ID 4MNHB 2FB4H 1BD2D 5L9DH 1LDSA 4NKDA 1OY3B 1QKZH 3DXAB 1MLCB 1A7QL 1MCEA 2HRPL 3L3KA 4XX1G 3HKFA 4XP1H 5IBTH 5DC0A 3BN3B 4PTTB 1XF3A 4PJ8B 1YC8A 2ZUQC 3W81A 5IT2L 4YHOL 1K3ZA 3RGVB 3SE8L 1HHHA 5BJTA 3CUPA 5EBWB 3R8QA 4K7FB 1OAYL 3MNVB 5I66B 4HG4J 1IBGL 1W0VB 3VXRD 2GITB 1A7BA 1CICC 2H8PA 1G7LA 1T89A 1PBYA 3B5TA 2C4XA 3V5HB 4ETQA 5F7NC 5ILTL 3ZYZA 4N0UB 1OGTB 2A0LD 3WNPA 3U0WH 1CFBA 3NOIA 1RIHL 2Q76B 4P57A 3VFUA 1DDHA 4OI7A 1ADQL 4PTUA 5HI5C 5FHBH 3O6KH 4HUXB 4QWWC 2G60H 4EN3C 5SWZE 4OCXH 1DQQB 4P3DA 2ESVD 1EDQA 4X7DC 1JZ8A 3I50L 4NM8H 4H0HB 5IFHH 1RU9H 2QQKL 4YHIB 2B0SH 4WVRA 2R69H 5HHXH 3UCRA 4UNTA 5CBEB 2XTJD 4G9FA 1TETH 4KWUA 2A6JA 4N9OB 2VSDA 3QXDA 4Y19A 4EKXA 3SQOL 2XN9E 1MHPL 1RUMH 1RFDH 3QUYC 5LXGL 8FABA 4GRWH 4HEPG 3WCYA 1QBBA 4M4RA 3MV11 4C57C 4M7LL 3P4LA 4U3XA 3NCBB 1TVHA 1FGVH 1QPPA 2YOCA 4QXTA 4XP4L 1FIEA 3G5XB 3LQZA 1UYWH 5I1HL 1OTTD 3RHWF 2XG4A 4NNXA 5C0NC 4GMTH 1CICA 2Z93B 3S36X 4WUUB 3SGKC 5DUPH 5FCUH 1AP2A 3ILPA 3L95A 3T4YA 5KS9B 1NMBH 3OJDB 5F97E 1A6AB 1J1OH 1FYTE 4O51B 4R7DB 5F70A 4LCYB 1PKQB 3ES6A 1CFNB 3RA7L 3T2QA 3UP1A 2Y23A 4WHCA 3PWNB 4EN3A 2EYRA 1BQHA 3HZKB 4MLSA 3W82A 5KS9F 1JHLH 1IGFL 4JFXA 1QFUL 1N0XL 3MJ9A 1PX4A 3TH3T 2VXTL 5DT1H 3NIFE 2AJUH 5CWSB 4YDJB 1QHPA 1CDJA 1MUJA 3GM8A 1U3HA 1A2YB 4OZGA 2YD6A 4OV6F 3QUYA 1R5VB 5AD0B 5FDWA 3MLSH 12E8H 2WM0A 5C07A 2WQRA 2M2DA 5KBNC 4GMSL 3M07A 2R9HC 2OYPA 3BD3A 5EZIH 4QF1B 3MLZL 5SWSB 2CLVA 1F2QA 5IHBA 3VFPB 3TFKC 2YD4A 2I60H 3JTSB 3OKEB 3W39B 2VC2H 3G5ZB 3CMOH 3SGKA 4Z8FL 4CVZA 4LLQB 2JKXA 3GHEH 5IB1A 5J57B 3O8XA 4LMQI 2ICEA 5DSCA 3IDGB 4WV1C 3FN9A 2DIBA 4DUXA 1BOGB 1UQSB 3FB5A 2FHBA 1WWWX 2QL1A 1LNUB 4X6BB 3TBVB 3QEQB 4NO5A 4KKNA 4X6CB 1F4HA 4OIIL 5E8NB 5EOCL 2VZSA 1VCAA 3MV8D 5EORH 5TFSH 1JHTA 4DCQB 1KC5H 4JM2F 1ETZA 5C86A 5IEKA 4G7VL 3RGVD 1NFIB 3FT3A 4X6CF 1EZVY 1KJVA 2VLKD 1X3DA 3LKNB