1ZWIA

Structure of mutant kcsa potassium channel
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
molecule keywords monoclonal antibody, heavy chain
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiA02
2AV7A 1T1ZB 5MERA 4OF0A 1QZ1A 4Y2DC 3UTTE 5IVNA 5TPWH 5KVMC 2IH1B 3ARDB 1RUQL 1UWGH 5I74B 4AEIL 3GBNH 1OAZL 4K2UH 3MRPA 5B4MC 4UOW1 1YNLH 3SDXB 1F3JA 2NY0C 2Q8BH 4ZUVA 3MRNA 4L8SB 5F7YC 2KH2B 4PJFF 1D7FA 2K9UA 1BD2B 5D5MA 2XTJD 4QTIL 3T1WA 2P43B 2Q6WA 3M17B 1AD0B 2VO5A 1TVHA 4FQIH 3WD5H 1M7IB 2HTKC 1DR9A 1S9WB 3X3GL 3RX7A 3VCLB 3INUL 2YXFA 4JEGB 4OLUL 1J88A 7FABL 1P84K 4DCQA 5A2IH 2AK4D 2AJXL 4WW1B 3QHZL 1HINH 2UUDH 5IHLB 4S1DC 3O9WB 1F58L 5F7DB 2A83B 3OKMB 3HUJE 4J8RB 1YNKL 2OSLB 4P57B 3OL2A 1OM3H 4N1HB 2AI0L 2GK0A 2VYRE 3F62A 4YXLL 4KWUA 5KSBB 3GSXA 5DD5L 4GW1B 1AO7A 1AQKH 3LHPL 4QF1A 2HT4C 2DI7A 2OR9H 3KPNB 3U0TA 3CFBB 4O4YH 1TJIH 3F7VA 3GMMB 4GFTB 3O8XD 2Y9RT 4PRBB 3OKDB 2E7HA 3G5VA 4JRWA 3RWJB 1P1ZA 3MOAL 4APQB 4O02L 4P3CH 3QNZA 5CSGA 4Y2DD 4F7MB 4MCZB 3MJ7A 4FXKB 2UWEA 4OLYL 1YN7A 5JIPA 4HUUA 2YPLB 2EDXA 4Q6YA 1MIEL 1ND0A 3QCTL 5HGBB 3VXUB 5J7CC 2ZOLA 2RGSA 2AERT 3NZHH 2QSCH 4U0RB 1R5VA 2HA1A 4H26B 5EIIB 3ARFC 5MEQA 3RP1A 2DMKA 3GSOA 4UDTA 4G6AD 4U1HB 3RKPA 3U9UA 3TJHD 4HWEH 2AEPH 1HOCB 3GEWB 4OFKA 4WUUD 3T77A 1P4LB 4L8BB 1WTGT 4E41E 4P4RB 3K7UA 3BMWA 4WTZA 1CFVL 4WW1A 2CXKA 4JM2C 2DDQH 2GJ6A 2D3VA 3V4UH 2PR4H 1A7NL 4YBHA 2OZ4A 1CLOL 3DVIA 2JCCE 5KZCB 4OIIH 3NCYS 4PY7B 4JDVA 4U0RC 4Y4HC 1JZ7A 1JTOA 4HH9A 5KVEH 1FJ1B 2FSEA 5I8EA 3H7BB 3JWNC 3HB3D 3KPOA 3P4LA 4ZS7H 3V7MA 1RZKC 1MJ8L 3LRGA 5GJTL 3AXLB 3FQNB 4HF5H 3VI4E 4CVXA 1MCSA 4LEXL 1NGYB 1HSAA 2OBGA 4ETYA 1TXKA 2HT4D 4I3SH 2IMNA 4P59H 3G08B 2H9GB 4U1SA 4X5LA 3S3JA 1F4XL 3WUWA 2YK1H 4OB5L 2X70A 1TZHB 4X83A 5DJYA 1VACA 1IGYB 3HS0B 2WIIB 5FYJH 4JREB 1JGUH 3HPJB 1TMCB 1ZT4A 4X5XA 1F3RB 4D0CA 3ARED 1BFSA 4H88H 3UTOA 4C58B 4O2EB 2AKRB 3FQRB 4QRSA 5FCSH 4QHKJ 5KANI 4Z5RB 2LTQB 4HJGB 5HI3D 5C0AE 2I27N 4QNPF 3ULUF 4FN0A 1DBML 4UT9L 5DTFB 3RZCC 4HDIB 1HEZB 3TM6A 3HZYA 5JOFA 3LAFA 1I8MB 1LO5A 2RAMA 3CFCL 2FD6H 1FLTX 2OTUA 1NGQL 1JFQH 4LQFL 2VLJB 3IU3A 2VXSL 1YMMA 1FH5H 1FZOB 1QLEL 3QH3A 3CAFA 3VFRB 1PFCA 4R7NA 4TVSa 4JZOA 5GRUL 4NKOA 3MCLL 4G8FB 4NRZB 5B21A 3L6FB 1FGVL 5ID1A 4ZO6A 1GGBH 1I9IL 1I1RA 2R56L 2ZCHL 3QWQB 4P49A 1IVLA 5LXGH 3D39A 1ZGLP 3I75B 3RGHA 3RZCB 5F3BA 4R9HA 2WK2A 1DBJH 4TPRL 3VG0H 2A1WL 1PVHA 5EC1A 5D6DA 2HT3D 1K4CB 4WFGD 5I19H 4PRDB 5DJ2B 3RFZC 3VFUA 4WHTA 4LPXA 1OAXL 4OUOA 4ORZC 1F97A 5FA3B 1OCWH 3KVQA 5I1IH 3QIBD 3WN5C 3GKWH 4I13B 3FT2B 1AI1H 3P73A 3RVWD 4Y16B 4ZFGL 3CFJB 1V3MA 1OWWA 1DQTA 3TNNA 3VFVB 1JWSA 3K2UH 4RNRB 3NVQA 2AK1H 2DQCL 3REVB 3VE0B 1UJ3A 4GSDL 4HCRL 4G6ML 3C6LA 5EN2B 3RIAF 3QIWD 1BZ9A 1EO7A 3BPOB 2KQMA 5D2LE 1S7TB 1UACL 1ZEAL 4LVHB 3WLWD 1KIRA 4CW1A 3EGSB 1AHWA 5E2WL 5GS0L 3GSXB 4FQHB 5I9QC 4MWFB 3PV6A 1A6ZA 5ICXA 1X7QA 1I1AC 3L5HA 5JTWA 2P8PB 1U8LA 4G6KL 3CX5J 3CLEH 5CZVL 1OD9A 4M5YL 3QDGB 3M8OH 1DL7H 4YK4B 4TULL 4QRRE 3GMNB 2EIZA 2PR4L 4MNGB 1ZS8B 3IGAA 3W9EB 3B5HA 3BPOC 3PHSA 1U41A 4LVHC 4IS6B 4QLRA 1OAYH 4JJHA 1QACA 1JGEB 5B3JE 4F7PA 2EDEA 1IGCH 3NFPB 3WKNA 1CE6B 5DMIL 4PS4H 1IAIM 4NM4H 5ESVA 3UTZB 3I85A 2WLZA 2IBGA 4N0UB 2C4FT 3C5ZA 2ZOKB 2V5YA 1FL5A 3LCYA 1WWCA 4JLRB 4GO6B 3MXWH 2OL3L 3LQAH 5JHDD 2VERN 1KJMA 3W82A 3G5VB 4Z7VB 3L5XL 3QNXB 3VWJA 5BS0A 3EKCA 5MEND 3ULUL 4RGOL 3RZCD 1C5CL 4XPHL 4S1QH 2X41A 1G7IB 1U9KA 4BUGA 2X4QA 3QNYA 5D7JC 1N3NB 5AG9A 2IC2A 4RFEA 4PJCA 2E9BA 4KPHL 3N06B 2H32H 3RWIA 4XX1G 4RAHA 2BNRE 1I9JL 5D7LE 2OP4H 5GRZA 1YEEL 4ONFH 4HV8B 1F4YL 3MV7A 4GKSA 4OCWH 2NZ9D 4TOYL 2ZPKL 3A0OA 4GT7A 3T4AA 3U46A 1U0QA 2VUOA 1N0LA 4JFQA 2HFEA 12E8L 2IPUK 1N5AB 2FD6L 2APBA 2C7UA 2ATKA 2R69L 2IWGA 3M07A 2F9BT 1E4KC 2LVCA 5T5NF 1UEYA 4YBLC 3BZEB 4I5BB 1T0NA 4FP8L 4HIJB 5DK2B 1X5LA 4DKFL 4QRPA 4M8QA 3RNQA 4ZFFA 2PXYC 1G7JB 4U05A 5TGBB 3NA4A 1I7UB 4NQXA 4M6ML 3IDYB 2EH8H 3UJJL 1A7OH 4ZG1A 4W6WB 2BSTA 2P4AB 4YXKL 3MRMB 1RURH 1IM9B 4UILH 4L29B 3KPRB 2R4RH 3FRUB 1G7MB 3WL9A 4QXWA 1J0YA 1RU9L 4KVCL 1N6QL 1ETZA 1FNFA 3KGRA 5E2VH 2DQEL 1NFIA 1P2CA 1EXUA 2H2SC 2AABH 2DD8L 2FX9L 5I8KL 2N4IA 4KK6C 3AM8A 1B0GA 5F6IB 1IAMA 3WN5A 1QSEA 4Y5XA 3DETC 4LHUD 2W0FB 1VGKA 1DBAH 4DN3L 1C5BH 3VGFA 3LRSB 2DYPB 1BZQK 2BRRH 1MNUL 3DX8B 4PJEA 1OT1A 4TSCH 3SO5A 3O3EA 5E6ZA 3ZLQC 3LB6D 1RZ8A 4FQHA 3V6FB 4G8IA 3VI3F 4FG6D 3MYZA 4MAUH 4N5UA 3W5MA 3EJZD 3D39E 4NKIL 3S3PA 3SKMA 5DLMH 5H35B 3RY6C 1GIGL 3HMWH 4P46B 1R3KA 2ICWB 1C16A 4YFLI 4FQCH 1DQQB 1KGCD 1UXSB 3LKNA 1UM4L 1NSNL 3MZTA 5IFHL 3BZFA 1KYOJ 3AMKA 4RNRA 4UOW0 4NN7B 5JW5A 1KB9J 2BVYA 1YJDC 4Y4FB 1QLRA 4KUZL 2W9EL 1GZPA 4YXLH 4I3GA 3KYMB 3MRDB 3F7YA 1B6UA 1K4DA 3I6LE 3RY5A 1KJ2B 1BD2A 5D5MB 1GGCH 2Z93A 5GQBA 4PRIA 3HAEG 4OCXH 4PPTA 4H1LB 3BPCA 3TWCH 1A22B 4NZTL 1FGNH 3C2AL 4JHZA 1MREL 5IVXE 1MJ7L 2APWA 4WGVB 3DSFH 3IJHB 1K4DB 2HMID 3MUGA 3T3ME 3TVMD 4Q6IC 1QFPA 1WUNT 5JXAH 5D70H 3U7AA 1FP5A 1ZANL 4JY4B 5SWZA 3B2VH 1FN4B 1MIEH 3SEPA 1KFAH 4M7JH 1MAML 1NANH 3PWPD 4KTDH 4ETQB 3OTTA 3IGAB 1DQQA 1JHKH 1EVTC 4PJXF 4FQLH 1RY7B 4EN3B 1KTLB 3UYRH 4FQ1L 5E1AA 3O3BB 1P4BL 5AYUL 1FFOA 3O81A 3V0WL 4Y5YA 4HKZB 1E28B 3VWKD 4MJ6B 1CICA 3JXAA 4MGXA 4WY7L 1HEZA 5BW7C 5F9OH 1VFMA 2OTPA 3IETB 2D9CA 2NTFB 4OFPA 2DQHL 4Z5RA 3RZWA 5B8CB 1QVOB 3S88H 1HILB 4MLIA 1IGFH 1KCRL 3DNKA 3OJMB 5F3HB 2AGJL 1AGCA 3EZJB 1CL7I 12E8H 3T0EE 1CF8L 2VLJA 1I1YB 1A0QH 1IGYA 1IAKA 1CZ8L 4EEEA 1MFNA 4Z7VF 5I1CH 2V5MA 2X4PA 2Z91A 3TPUA 4MD0B 3N9GH 1IKNA 1YN6B 1T89C 3QHFH 1NGYA 4UU9A 4O9HH 1CXIA 4XPTH 4D94A 2BSED 3CDCA 1RVFH 4OGYL 4G5ZL 1F5WA 1IAOB 1NEZA 3QWRD 3SBWC 5IB1A 5J1AB 2FYYA 5IVZB 3W9DB 3C6LC 1VHPA 4ZOAA 4B53A 3RJDA 1IEAB 2ZUUA 3U2SA 4HS3A 4UMGA 3DIFA 3CDFA 3KDMA 1I7RB 1R5WA 4KROD 1Z0NA 3NOIA 4NNPL 2EC8A 4X6DF 4ZXBB 1QFUH 5I8KH 3ZE0F 4GW4A 4R4NC 2P5EE 4ZXBD 1KPRB 3MLZH 1K85A 2FL5B 1DE4A 4RMTA 4CVXB 3QUYB 1OAKL 1U8QB 1U8IB 1CVRA 2BRRL 1HWGB 2KQNA 3ARDD 3PGDB 5IT2H 4HLJA 4KV5F 4XNZC 2R2BB 4LSUH 4LVOB 4MAUL 5FK9A 5GGSB 4HUNB 4KKCD 1J8HA 5KSAB 4DN4L 1J05A 4L8SC 3CDYA 5E7BA 1NAMH 4F3FB 1RAMA 2NR6D 3ARYA 1GGBL 1I9IH 4PTTB 3E3QE 2AXGB 3TJEH 1GC1H 2CIIA 4WEBH 5DEFA 1XIWA 3MA7A 2F19L 4F15C 4R6UA 4M61A 1T7WA 3QUXA 5SX4I 4R90L 3DXAB 3FB8A 1HN1A 3BFOA 3X12B 4I2XB 4D0BA 2YUWA 1NJ9B 1ZXQA 4N0FA 1RIHL 5DD0L 4CADA 1NC4A 2CO7B 2KL6A 3O9WD 2FBJH 3QRGL 3FTGB 2MPAL 4GBXB 4OFYA 3CZFB 1ZA3B 2HTLD 3R0NA 3E6FB 3E2HC 3MA7B 5ICYB 4Z7QF 3UC0L 3P4NA 3Q2CA 3WE6A 3V95A 2WBWB 3FQXB 4X9GA 5E00B 1S8DA 1S5HB 4JAMB 1BGXL 1BF2A 4PJ9D 1EMTL 4Q9RL 5CUSH 4PB9L 5JDJA 1QBML 2HKHL 5DJ0B 3RAJL 1NCBL 1SYVA 5LWYH 3T65B 1ZEAH 5F7KC 4FQLL 4KK9C 1QUNA 2VDPH 1EFXA 5E2WH 1AGEA 3SY0A 2VLJD 1UH4A 3EOTL 3MX0A 2X1PA 2B4CL 4KZDL 4XC1L 2DAVA 3EFDH 2AS5M 4ODVL 1D5MB 5M94B 5F89A 2DDQL 2UZIH 1MCCA 2QSVA 3Q6FA 5DD3H 4R2GB 1ZLUH 1W8OA 2DIAA 1DQJA 4EXPX 5FUZL 3U7WL 2GI7A 3MLUH 1MH5B 3FFCB 4XBPA 3BSZL 3NMEA 4NHUA 1NUFA 3TA3D 1ORQB 5IMKA 3VGBA 4PREA 5C0BB 3BHBB 3VCLA 3N1GC 5GGQH 1B90A 3OB0H 1Z6JT 5I76A 2VZSA 2EYRB 4GQ9L 4LGSB 4R0LB 2I60L 4X9FA 1AHWC 4I9WE 3U30C 4B7LA 4PJHF 2Z8RA 3DUSB 4LU5H 2DQJL 1FNGA 3BPLC 5AWNH 1ZK9A 3MNVB 2PF6A 1NANI 2PW1A 1IGIL 4U6HA 4I3SL 1A9BB 3N9GL 2H6PA 2DQIH 3CCHA 3C60A 5CILH 1AIFB 4ZPVB 3MYJA 4XNQB 3RVTD 3VH8B 2VZVA 3ARFA 1KB9K 4S2SB 4Z78A 1FQ9C 5E8PB 3K46A 3O9WC 3BVNA 3KPNA 4HK3J 4JR9H 5TF1L 4RQQA 5CJOH 5CGYD 2VR4A 5KVDL 1JHTB 5FYJL 3QYCA 4U49A 2EDTA 4XP4H 1J05B 2YC1A 3BD3A 4XGZB 4MDJB 3C60C 4N0CC 4HWBH 3P3YA 4KPHH 4RGMC 1NGWA 4NQTA 4UV4H 1H5BC 3IDMA 2BVOA 4JFED 5C1MB 4M7KH 1WT5C 4NNXA 5IEKB 5HYJB 1KPUA 1DDHB 35C8H 2FCBA 5SX5H 2OP4L 1IM3A 4RX4D 4G8GA 3W0WB 3LEVH 5DD5H 5EUKB 2YSSB 3O45A 3QFJA 1G7LA 1F8TH 2OR9L 4I8DA 3QDMA 1CICB 4ZFZA 4OBSA 1GL4B 1X6NA 4AMKH 3L7EB 2OTWB 3BW9B 1Q94B 2P44B 3NA9L 4YGAB 5LGHH 4LSUL 4KJYA 1M71A 2GEEA 1KXTB 3WHXB 5T3ZE 2R1YA 2FJFB 1MCOL 2LTQC 3TFKD 4F2MB 1SJVA 3RWIB 3GO1L 1ED3B 3RPIA 1LO3H 3P4MA 4WCYL 1G1YA 2FEEL 1T2QL 2XFXB 4JG1L 1DBJL 1BLNB 2DTMH 4PJIF 2Q8BL 2WWMD 2PO6C 1GC1L 2O5XH 3RBGA 1KIPB 3VI3E 3ZMRA 1U3HC 4QYOA 1F2XK 4R0LC 3KPQA 4DW2H 4KVCH 5IM7B 4Y4FC 4QXTA 4HUMB 2AEQL 3MJ8B 1AC6A 2C4FU 3MRJB 2O26U 4YQXH 5FOBA 3GJFK 5GISH 3V0AC 3WO4C 4TNWK 4WI2A 7FABH 4UU9B 4P5MA 5EPMA 4U33A 1VEOA 2I9LA 5C0RH 2R0ZL 1SYVB 3HTLX 5F70A 1J1XH 2OXGA 2YPKB 5ESQA 4P23C 4GG6E 5IVXB 5GXBB 4HS8L 3BPNB 4MNGA 4ZSOB 4JFZL 3JVGC 3OXRB 3MLWL 3G5XA 1QLFA 4E41A 4LCCB 1HINL 4PGEA 1RV6X 4LEXH 2J8UA 3BH9B 2BC4B 3HMWL 2VLKB 1QQDB 5FO7B 4AZ8A 3WO4B 3HNVL 4GBXA 2NTFA 1JRHI 2Y5TB 3CC5B 4LMQE 5EUOB 4MXWL 4CADB 4CW1B 2VLRB 5BJTA 1NGXA 3QIWB 2YMXH 3H42H 1JGVL 3F65A 4U2YA 5FCUH 5JUEL 5JR1H 1UWXH 1JF1B 3MUJA 2BSSA 2W9EH 3RIAK 1I1FB 1NL0L 3GRWA 5IG7B 3ARFD 4M5ZH 2ZUVA 1INQB 3PP3K 5GZOC 5FHAL 1HHJA 3TNMA 4D3CH 3MLPA 3JTSA 4X4ZA 1P1ZB 1ZTXH 5ANMB 5DEGB 5T1DH 1A6PA 4HPYL 5E99H 2GJ6E 1GGIH 5B38B 5BCAA 2BSSB 2QKIB 4V2CB 2FHBA 5CAYB 1CT8A 2YZ1A 1QEWB 1PLGL 3CFCH 1BVLA 2GJJA 3UO1L 3CVHH 3QIUB 4ONOA 3DBXA 3P77A 4PJEF 5CKAA 1W2KT 2R9HC 5GGVH 1DEDA 1LEGB 3NZHL 1T83C 4QHNB 2WUBH 3BP6B 4AL8L 3LPGA 4F9PC 3BDXA 5L2KE 3TIDB 3L9RB 3MRKA 3PGCA 4JFHE 1T5WA 3CLFH 3FB5A 1QOKA 1E6JL 5KOMC 3HZMA 4HFWA 5ACZB 3NACH 4JRXA 3SE3C 4MD5B 5IF0A 4LLWA 1F4YH 4OCWL 1QG3A 2IAMA 4ZS7L 2BC4A 3IF1B 5KSUA 5CP3H 5MENB 4YIQB 2XQBH 3JV4B 4NKDB 2PKDA 2XIDA 1J5OL 4IHOA 1ZHKA 2QSTA 3FO1A 5E6ID 3BGFC 5IHZB 5D7LD 3SKJL 4FQJH 5CJBA 1MVFA 3S97C 1U3HA 4RGND 2CRMA 3EHBC 2CIKB 5L6YL 1IC5L 3BVNB 2FGZA 3WS3A 4X98B 5I1CL 5F1NB 3WNOA 1V3JA 4X7EC 2ADGB 1FC1A 1LE5B 4P59L 1VESA 3LIZH 8CGTA 3HNTL 4ERSH 3HPLB 3PWVB 1J8HD 4O9HL 2YPLE 3EYFA 4HJJH 4OGXH 4NO5B 4E5XB 4YHNB 4HKBB 4JFFA 4LAQL 2HVJB 1G7JA 4LQ1A 5FAAA 1F6AA 3BGFB 3C08H 5LJYH 2CRZA 4WFHE 5CP7A 1I8KA 4D9LL 1Y18A 3NFPA 4LSSL 5F7MC 4YR6A 8FABA 4KJWC 5K9JH 2R0WL 3IAQA 4QXGL 3VRIB 4MJIE 2ATKB 1LWRA 1CFNA 1D5BA 4YK4C 2YD8A 2C1OB 3FRUA 1XGUB 3F12A 3KPLB 1C5BL 1L7TL 3S36X 4ZD3H 5IHZA 1T7ZA 4IRJA 2XZQH 5IB3B 5F72S 1I1AD 4CUCA 3A6CL 3GDBA 1ZHBA 5D7JA 2XY1A 1FGVH 2HT3C 1PD6A 4DVRL 3BN9D 3QXDA 5T5FL 2EIDA 4ZS6C 3LKRA 3UPRA 1IGCL 3LPFA 5AD0B 5GSVB 4HGMA 4CDHA 4KI5F 3W2DL 4UQ3B 3IXTB 3LKQA 4ZYKB 3ZZ1A 2NY0B 4OF5A 1JIBA 5MHSD 1I7RA 1R5WB 3GBNL 4JFDA 4FABH 2W65B 3PGCB 1MRCH 2HFFB 1NGZB 5C9JB 1U8PB 5DZOA 5E6IC 3S36L 3FCTB 1OCWL 4RMUA 3KLHC 4KHTL 4CJ1A 1H3TA 1CGSL 2X4RA 1NDGA 4IRSD 2G5BB 5FO8B 1KACB 3QDGD 4GXUM 5DRZA 3BH8B 5I76B 3TZVD 4X0KB 5I1LA 3UBXG 5E6IA 1CT8B 2VZTA 4R90H 1GHFH 2IQ9H 3V5DA 1AY1H 4HC1A 1TLKA 4NHUB 3B3IB 1WBXB 5DJZB 4HC1H 2FB4L 3V0VB 1INEH 1C5DA 1KJMB 3L3OB 3EFFB 4ZOCA 2V2WA 3JWOH 2HJLA 2VXUL 3I2CH 1GPOL 1DP0A 1IJ9A 5GS0H 4HEME 1IL1B 1RUAL 1KFAL 4M7JL 4PJHE 1REIA 1EZVY 4L3CA 2B39A 2UVFA 2ZNXA 4G8FA 4NRZA 4XX1E 4AL8H 3MJ6A 3DURB 4JVUA 1T22B 4LPYA 1KLUA 5DJ0A 2R2BA 3QCVL 3S37X 4G42B 2F54E 3QULB 4M62H 3BKYL 3QH3B 3VFRA 1QFWM 1BZ9B 3HFMH 2IG2L 2NY5L 4NOFA 2ZUXA 1FZJB 3CVHA 2CH8A 1K8DB 1WFUA 4JFPB 4NM8L 4OLWH 3J8F7 1DSFL 4Z76B 1KBGL 2DJUA 4PG2A 3PV6B 5ICXB 2VQUA 4PS4L 3SKOA 1LO4L 1RJYB 2B1HH 1S9WA 3WKML 1WEJL 3MBXH 4NC2B 5JHDE 2EC9T 2H1PH 4P2QE 1RIUH 2AJYL 1X5IA 4EN3D 2DD8H 2FX9H 3I50H 3M17A 4BSJA 1LD9B 2Y6SC 3QCTH 5D7IE 1FO0H 2VC2H 3IDIA 4FZEL 2ID5A 5FDWB 4P23B 3ECBB 5L2KA 3ULUH 1CN4A 4PIRF 3K1DA 4YDVA 3VD7A 3TGXA 3P0GB 4PJDB 5DT1L 3ROLA 3WIIL 4NQVB 1SY6A 3N85L 3LQAL 4WW2F 3KYMA 1P5VA 4KMTL 4LCCC 3HA0A 4Z7QE 4ZYKA 1WWBX 4JPKH 1NC4B 1GXEA 1J11A 4RGOH 1DJSA 4Z7WE 4Y4HB 5FO9B 4AIOA 2VNCA 4TOYH 5FK9B 5GGSA 4NN7C 4Y5YC 1QSEE 4NQCD 5CZXD 4LSSH 1B4JL 2XZAL 1NAMB 3HG1A 4O5LL 4MQ7B 1MHHA 2Q8AH 4Z0XB 1Q8MA 2NX5D 4BJLA 4X6CB 3IDUA 4QWWC 4LHUB 2R23B 3WNPA 3QJHB 3MOBH 5IWLA 5D9SB 3AB0C 1F8TL 2J12B 1DTUA 3D25A 3O3BA 3ZL4L 3QCUH 4K94L 2AJUH 1U8HA 5FHBL 2VLLA 5IBLC 3IRZA 4PRPE 1EEZA 4LNVA 3WIFA 4LHJB 1NFDB 3EO9L 4M00A 5EZIH 3DJ9A 1LO2H 5IBTH 2JCCB 5C09A 3B2VL 3GO1H 5E2VL 3LS4H 4WFGE 3UTSA 3MO1A 4JZJA 4RA0C 4L9LB 5C71A 5BZWB 4NN5B 1URLA 2X89D 4GH7B 4KKAC 4L3EE 5DVMA 1AIFA 3H6JA 1F2QA 4NDMA 4L4VB 5CHNB 5DZLA 5E2UH 4KXZH 3P30L 1GGUA 1OSZA 1I1YA 4PBVC 3QEQA 2DQEH 3RWJA 2BNQB 1DEEA 1H3PL 1G7PB 5ESAB 4XVSH 4MMZC 4AH2A 1VACB 3RNQB 4LP4A 4G7VH 4MNQA 4M4PA 5ACZA 4ZQKB 3HR5A 4NT6B 5DURD 5EO0B 2NPLX 2VDNL 1EDQA 5HGHA 5F7HA 4HWBA 5KG9B 1IAKB 3AREC 4YZFF 5HVHB 2MQ0A 3GSNB 2AQ2A 2ZCHH 4U1NB 2CSPA 5HDLA 4P5KB 4Y5VC 1EBAA 2AEWA 3GMPB 2YD9A 1QBMH 2HKHH 3ES6B 3RL1A 5JMRA 3GSUA 5FEBA 1ZT7B 1L6ZA 4ZOBA 1H9VA 5F3HA 3K1KC 4TPRH 3BE1L 1FL3B 1V5JA 4U6XB 1ORSA 4MAYA 5HGHB 3KXFB 3Q5YA 4I77H 1TPXB 1BBJA 3ARTA 3KXFD 2E9WA 2WUCH 4PRID 5F7WC 3IJSB 4KJPC 5IFHH 1HCFX 4GKZA 5D96B 4JGJA 1AGBA 3FOLB 4D9QD 3GKWL 5ILTH 2YUXA 4MXWH 3CFIC 4LLDB 2ZUQB 3WFHA 4JO1H 5IBLD 4WFFE 1UKSA 4U7MA 1IC1A 1UWXK 2X9WA 3MREA 4BH7A 3MUY1 3D9AL 4OFVA 1HQ4B 3WNKA 2HJKA 3FHAA 5DS8B 4X0KA 5IFJB 3VWKC 4QHLB 1J8HE 1S9VA 4YDKH 2KZ1B 3OR7A 2LVEA 2Q87A 3E6HA 1OL0A 3B5TA 3C8KB 3OAZH 1LE9B 4ZAKC 4OIBA 2GKIA 3UYRL 5T3XH 5DT1H 4JN2B 1ZS8A 1GH7A 4JR9L 1YEIL 2NY5C 3BEVA 3UTQA 5SWSD 5H35A 3HR6A 2J4WH 2LQRA 3KJ6L 3VXQB 1OTUC 3T2QA 4UIKH 1UG9A 1KCRH 5E94A 4OCYH 2E7LC 1I8IA 5KSBA 1K6QL 5GZND 5C6TL 4MAYB 1H0DA 3GHEL 5C2BL 2NY6C 3GBML 4LFHD 1FFRA 1E4JA 5DMIH 3SDDC 3T1FB 5IW6B 1ZWIB 3BWUC 5GGUB 1KB5L 4JN1H 2P5WD 3FB6B 3KNBA 3HC3H 3PHOA 4WV1A 1J5OH 2ENSA 1N3NA 4AMKL 3SDXA 3WUWB 3ZKQD 3GSQA 1EIBA 4NCC2 2GSGA 1UKTA 3SE8L 4YC2B 2X1WL 1QO3B 1WIOA 3O6KL 1CU4L 3ORJA 1H8OA 5E5RB 1CLYL 5IFAL 3BMVA 4XBGB 3VXSE 1W0VB 3U6RA 3TBTA 3HRZA 4HT1L 4W4OA 3FONA 5CEXA 1EX0A 3WIHH 1MOEA 4P99A 3T1FA 3QEQB 1LILA 2BJMH 1BQLL 3QEQD 3BKCH 2A74A 2BCKB 5IMLA 3VJ6B 1FNHA 3A67L 3F7QA 5MEOA 3CSYB 3VFTA 43CAB 1FFNB 4HIJA 5E2UL 1EJOH 4M9PA 4WENB 2A0LC 3GHBL 3RY4A 3ISWA 3OR6B 5HPMB 3W9EA 1YYML 3MNZA 2YUZA 5GGTH 2DQUL 4KGLA 4QHKI 1JUFB 3QJFA 1U92B 2B5IC 4FP8H 4BQBA 4HMCA 1WGOA 5CEZD 4OLVL 2F74A 3GI8H 2HRLA 2I25N 4MXVE 5DD1H 2KUTA 4WI9A 3MCG1 1CXKA 2EDYA 1HHIA 5JOEA 2Q7YA 4R4BB 4I0CC 4GAJH 3RL2B 5HDQH 1RK0B 1FHGA 1B88A 3DHJA 2A73A 4EVNB 3MLWH 4JCLA 2X40A 4JDZA 5INDB 2W07A 1PX3A 1AJ7H 3IAPA 1QSFD 4X9BA 1YMME 3EW3B 3MXVL 3PABB 5IK3B 2A74B 3RVXC 5FDWA 2HVKB 2NY4C 1MY7A 1M05B 3QI9D 4KRNA 2F54B 4N8VG 5J8OA 3TO2A 2AABL 1IAIL 2JJWA 4Z9KB 4WO4D 5FCUL 5KJRL 2X10A 4ODSH 1B4RA 5EUOF 4ESKA 2AXFA 5IW1A 1W72A 2AQ1A 4O51A 4C83A 1NDMA 2PYEB 4HEPG 3GMLB 4F7PB 4GAFB 5JHLH 2WANA 5F1IB 2X4TA 4EZMA 5DD0H 2PXYB 4Q6IA 3BZ4A 4OCSL 3BEWB 2IQ9L 3HN3A 3FB6A 1MHEA 4PJAE 4NQED 4JLRA 1KENH 2B2XL 3DRTA 1INEL 1KG0B 4Q9CA 1Q72H 2VH5L 4FA8A 4G9DA 3IDGB 3H0TB 5I75B 3IFLH 4MA1B 3TVMA 1RK1B 1CTOA 5ESVB 3V6ZB 4XVTL 1S9KC 2I5YL 3ULVC 3VD9A 2A0LD 2EYTA 4PY7A 3S5LA 1JNHB 3S37H 5D6CA 3QG6B 1N59A 1CXHA 4NQCE 3CGTA 3QUYC 3KHOA 3QFDA 1T1XB 3S7GA 2CO6B 3ARGD 3D2UD 3UCRA 3PDOA 5HHMB 5JOPE 4ORGA 4DK6A 4ODWA 5ISZD 1OGAD 2I9TB 5SWZD 1XAUA 5HHQB 4MNGE 3ZE2F 3NCBB 4NO0A 1AD9B 1WWAX 3N0PB 3SGDI 1E6OL 3NABH 1X5JA 3F8UB 4NNYA 1BOGB 4XCNB 1MREH 3E1F1 5D6DC 4P5TD 1NCUA 2VISA 4BSWA 2DIBA 5C0DA 4UDUA 1YEFL 3O3UN 3LRSA 5CJQH 5IR1B 2AJYH 5KS9A 4CN6A 4HKBA 1IGIH 3V2AR 4XCEB 4ONGH 4CNIB 1DEEB 3VDAA 1DLHA 1L7IL 5IM7A 5ERWB 2VDOL 4PTUB 3TO4B 3KYNB 1WBXA 1JHKL 4PLKD 4Q9QL 4LARL 3PXHA 4X6DE 2BVPA 5IFAH 5JXED 3DX6A 1WV7T 4IOFD 4N5ED 1G9MC 1R3IL 3C8HA 3EO0A 3LIZL 3MGOB 1J0HA 3OKEB 3KLDA 4X99B 1U8KA 1MIML 4K3GA 4JFZH 4R8WH 1YPZB 5ID1B 4RGNE 1T66D 4Q0XH 5D7LB 3MC0A 2BNRB 2QEJA 1MHPH 5CGMA 1W72H 1S7QA 4NC1C 1HQRB 3KPOB 4X4ME 3AS2A 3RVUD 1FG2A 1KT2B 5D96C 3C6SA 5EBWA 2UZXB 3QWOB 4QOKB 2P1YA 3D25B 5DFTA 2PYED 3TT3L 3RHWF 1S7UA 2VDQL 5CEZH 4XNYH 1YEDA 2VABA 3DTXB 4XZUA 2EC9U 2NX5A 5DMGD 1QBLL 5HI4D 5CWSA 3QB7C 4QRRA 4PY8J 1MY5A 5BRZD 4NQEB 4LSQL 4BKLB 5HGAA 5I1DB 3MV8D 5DI8A 5FGCB 2EEDA 5SWSE 2BCKA 3OB0K 5IMLB 2BY1A 2H41A 4YFDB 1GGIL 5LGHL 3MRRB 1T2QH 3KS0H 3FN9A 2BNUA 2DQTL 2EYSA 4GXVH 1LVEA 1NCWH 3QI9A 5CHNA 5KVFH 4N90D 2O5XL 3QEHB 4WUKH 3GGWA 3SE4A 3D18A 3VFMB 3UO1H 2W60B 3HC0A 3HE7B 3NIGE 1QO3A 1F4AA 2J8HA 4APQC 4JPWL 3UTSD 4PTUA 4QNPE 2ADIB 4M6OH 5CP7B 4NQVA 4IRSA 1HH9A 5ELIA 3E3QC 2ZJSH 3P4OB 4W68A 1Z3GH 2NY3D 3U4BL 5T1MB 3MSPA 4L8CA 3BGMB 2AXHA 1JWUB 1Q9LA 3EAKA 2XQYK 5J6HA 2CRIA 1N8ZB 5DVKA 1MRFL 4JO4H 1K2DB 1SM3H 1N5YH 5IMKB 3T3MF 3ARGA 3D2UA 4Y89A 2BVQA 3JV6A 4OZ4B 1XZ0B 5LCVH 4IRJC 3RX5A 2B7DT 3QUML 2VDRL 1HSAB 1JK8B 3PHQA 4B7IA 4POYA 1KENL 2B2XH 2I07A 1DQDL 3LV3B 5ABDE 2E7MA 1FYTB 5DDHB 4R26L 1VFUA 2EIZB 5FF6A 4GAYA 4HX1A 2E8ZA 3PDOB 4M1DL 5D1QC 4ORGB 3AGVA 2X1XR 4ALAH 1UADC 3B4NA 4XMLH 1A14H 4HH9B 3EJJX 5BV7B 2VTFA 5ESQB 2XTJC 1MLCA 3UXFA 4WEBL 3B9KD 3MV7E 5AZ2H 3DV4A 3VWJD 4J3TA 3BE1H 1JV5B 4MWFA 4HXBL 5I1LB 5L9DL 2CKNA 1Z5LA 2GY7B 4PYHA 4TVPL 2Y36H 3E2HB 3AS1A 4OUUB 4GG6A 1PZ5B 1S9YB 2Z0BA 2ED7A 1DLFL 3QRFM 4IOSD 5JUEH 2IGFL 3JV0A 4YHYB 1QR1A 2GAZA 1I1FA 5TDPB 3WKMH 4JO1L 5CMAA 4J3XA 1H15B 4GG6B 2ITDA 2DOCA 2Y4SA 3DVNA 4XRCA 4XWGL 2R1WB 3Q1SL 4XCYA 3DUUA 4XP6L 4JREC 3X12A 3WXWL 4HKXA 3WHE1 1A1OB 2JLLA 4EUPH 5DUML 4HH8A 3DGGB 1S9XA 2XZQL 1UXSA 3LKNB 4CMMA 2V7NB 5GS0C 4JCMA 4YBLB 2Z35A 2FJFA 2AXGA 4CVUA 2GTZA 1D9KC 2IH3A 5D2LF 5HHOB 3CUPA 2FATH 1D5XA 4N9OB 2A9MH 1XGTA 2IAMD 4LLVB 3G6JE 3KPTA 4ODVH 4P46C 1FDLH 1CXEA 1SEQH 1QPPA 4BA8A 1BAFL 3S35H 1KPVB 3A6BL 4NP4H 4X4XB 1WISA 3BPNC 4XNUL 3QPQC 4M48H 3I3DA 5GS1C 4XP9H 1CFQB 1X3DA 4OCYL 4NKMA 1IC7H 1M7IA 1D6EB 2Q8AL 1CFBA 3MBEB 5CBAA 1UVQB 1FFQA 4XNYL 1FRGL 2KKQA 2H3NA 3RUGE 3PUCA 1CK0H 1CD0A 3VXMA 1L9MA 4OGZA 5L6YH 1RUPH 1AQKL 4WIQA 3O6ML 3VFGL 1QFOA 4PLNC 2F58L 4K94H 1T04A 5I17B 1KB5A 3NAAL 5FV1L 3NH7L 1AGDA 5EULV 3BN3B 1MHCB 3VJ6A 1BM3H 4N0CD 3TIEB 3X11B 1S3KL 1KC5H 4IMKC 1NDGB 5IBTL 5AG8A 4PRHD 3ARQA 1JRHH 3F58L 3OAZK 1PG7L 4HK0A 1NFDF 1NBYB 3HRZB 3VXOA 1D6VL 2EE2A 1MPAL 3JVGA 1TZIA 1TZHA 5IMMA 4ZFZB 1NBQA 4WNQB 5GPRA 5IJVA 1FNSL 4GRLB 3QR2A 4RGNC 4R3SA 4GAGL 3SCMB 3N1FC 3ZDZF 3HZMB 3SCMD 2R0WH 3K3QA 1ZVSB 1XIWC 3ZE1F 1XMWA 1FZKA 3WLBB 1FCGA 1U3ZA 1TZGL 2H3NB 3IYLW 2BVEA 3AXLA 3TFKC 4JO4L 1F45A 3C6SB 5DMYA 5SWSB 4WHDA 2Q7NA 4TTDC 5HGDB 5DJAB 1KULA 1F3DJ 2YRZA 3TBVB 1QKZL 4P46D 4DZ8B 1RZJC 2Y25A 3L3HA 2HRPL 3ZKXC 4L8DB 3ARPA 1B6DA 4KDTC 3SKUD 4LBEB 4FABL 1E4XH 3EIFA 4NO2A 5D1QA 2YOCA 1OAUH 5HHOD 2YSSA 3HE6C 4X7FC 2DTML 3TBWB 2GFBA 4KU1A 2ICCA 3CH8A 2DLEA 1QNZL 2G5RA 4NNXB 5BOPA 1H3XA 1BJ1J 4NQSA 4I18B 4KI5E 3DMMB 2ZKHH 4JY4A 1T89A 2G9HA 2G75B 2Q76B 3C9NB 3MLSL 1MCPH 4H26A 1IFHH 4OQTL 4OAWA 2R1WA 4RISH 2J5LB 5FYKH 3OHXB 3SHSA 5AAMA 2X4SA 3D9AH 3NCCB 4HUWA 1N6VA 3U36A 5HDOA 4MA8H 1RIVH 5I71B 1VPOH 4JKWA 5L88H 2C3VB 4WTXA 1NMCC 1WITA 2W0LA 3W11C 4HD9A 4NQDE 1I1AA 5DUPH 1HZHL 2PYFA 1KCLA 1F4HA 4TUOA 1Q0YL 2APVA 2VXUH 5JNYA 3AREA 1A7RH 2AK4B 4HS6A 5T3ZD 4IRZH 4P2OB 2ITCA 5EPMB 2IANB 2F5AH 1LDPH 4L3CB 4OZFG 1EFQA 4BFGA 5DQDH 4XHJC 1BQUA 4OLWL 1L6XA 1RZ7L 3OKMA 1KELH 5F7DA 5D1ZC 4X6EB 1ZLWK 5EZIL 5DD6A 3SJVD 3ULUC 2HLAB 2P24A 1UWGL 5HD8D 5CJ5A 1WEJH 4K2UL 4YDJA 1C5DB 5JW4N 3IDNA 3C8DA 3MLRL 3TNNB 1OGAE 5ISZE 2GK2A 3VG0L 4ZQKA 2X4NB 3O8XB 2VR5A 3HI5L 2DQDL 3BH8A 4PRNB 4K3HA 4AQOA 3CK0H 1BZ7A 3QUXD 4PD4K 3ULSA 3T0XA 3U82B 2H26B 2CIIB 3BDYH 3O4OC 2J8UF 1SY6H 5E95B 2R29L 5IG7A 5C09E 4KK5C 1Q38A 1EEQA 2UUDK 1J1OL 1BJ1H 2ADFL 4G8EA 3TPUB 3B6SA 3ULVE 2EDDA 5GJSL 4Z95L 2AJSL 3MR9B 4HT1H 3SDCD 3P0YH 1UZ6E 4ZFOL 5CSBA 4PG9A 3O2DH 3EBAA 1S7UB 5FB8B 5TDNB 3RPIB 5FO7A 5GSRA 2F74B 2DM2A 3TP4A 4Z6AT 3HRPA 1YMMB 2V9QA 4PJGE 3T2OA 3O41A 3D39D 3NIFE 3GHBH 4KKBC 4JDTL 4R97B 3SDAC 1I4FB 1QD0A 4OZGE 4LLQA 1YYMH 4AENB 3LHPH 4WDIB 1XGRA 2B1AL 4WTZG 2IALB 2NY1D 3H7LA 3PWLA 3ARGB 3D2UB 3KLAB 4RAVA 4FXLA 3T4AB 1N7MH 3DO3A 4JFHD 5E1AB 3T8XB 1WAAF 5DURB 5E8NA 2YD2A 4GAJL 4LNRB 5KN5B 3RWDA 3ZDXE 3AMLA 2D9QB 1YQVL 3GI9H 1E4XL 1NBZB 4UDUB 4XGZA 1OQOA 3HKFA 2YPVL 4PG9B 4NM4L 4QYOB 3C5JA 4JJ5B 4PJ5A 4PRHE 5TPWL 5EZOH 1LO2L 5C3TA 4DVBB 2DJ4A 4BUHA 4QWWD 5T3XL 1J8KA 3O2DA 5K93A 2V2TB 2ICWI 1H3PH 1U3HB 5L2KB 4BQ9A 4AIZA 3MFFA 4KZEH 5TQ2L 1XGQA 1BEYH 2OR8A 5HVWA 3MV9B 4RBPH 5CS7A 3RWDB 4IHOB 2JJUA 5M95B 2OM5A 3IFPB 1AXTL 3LOWA 5EZLB 1S7XB 4U0QB 1A7NH 2X4NA 3IKKA 4RAVB 3AAZA 1QSFB 2BVTA 3A6CH 3SDDB 4RZCB 3JUZA 1MRFH 5CFHA 4S1SH 1CFVH 4OZHB 2B5IB 3UPCA 3BI9X 4TVPD 3OQ3B 4J3SA 3FO9A 4CVWA 5BVJA 4Z7NE 5D1ZD 3JUYA 3BUYB 5EG6C 4JGUA 2GJZA 4YHOH 1UZ8A 3HZVB 1A9EB 2D7QA 4PR5A 4KKBD 4L3EA 1EHLH 1FCCA 2V2XA 2ADJB 4ZFOA 5LKNA 2KBGA 2X1QA 3QXAA 2R1XB 1MLBA 5CEYA 3H9SE 2HH0L 2R0KH 1CG9A 1CLYH 4F7EA 3UX9B 1RZ7H 3QUXC 4ZTPL 5LBSL 5SX5K 5SWQB 1HYSC 2BNQE 4WUUA 4HIEB 4AQ1B 2BJML 2PO6B 3GSWA 4Z0BH 5DEGA 25C8L 3MJ7B 3BN9C 4FXKA 4KTYA 3TCLB 2Q3AA 1MJJA 3FOMA 4KGJA 3RNKA 4UUJB 3WFHB 3IAGC 4F57H 3CFBA 3CSBA 5CJXC 4JKLA 4L4JA 1T80A 4YNYB 4J7RA 4RIRB 2WLYA 3QIBB 4YHIB 1TQBC 3LY6A 1GPOH 5T1LA 2G5BA 3SGKA 4RWYH 3BDYL 2W1NA 2BSTB 2EE9A 1BFOB 1CICC 5C8JA 4NUGH 2VR9A 4Z77B 4NJAL 3L5XH 4NQSB 5IESL 1GZQB 1ERNA 1NGZA 3PABA 5IK3A 4KMLB 4KKLD 2FH6A 1A8JH 4TTGA 2WIMA 3SDAD 2NW3B 3IXTA 3LKQB 4P5TA 3TZVC 3RUGA 3O2DL 4G43B 2A9ML 3PP3H 3CZJA 4EN3C 1N5AA 5L2KD 2DWEA 3DARA 5CP3A 2VL5A 4V2BA 5K59F 3AREB 1UYWH 1PG7W 2J8UE 5KSAA 4YHKH 4HS3B 1FZOA 4AK1A 5C3LD 3TBVA 5GS2D 1T0MA 3ARBA 3X3FL 4RFNC 5D7LA 5E8DH 1G84A 5I1IL 3QDJD 5IV2B 4ELKA 5IGXH 4YAQB 3QUYA 3FAXA 1NEUA 4JE4B 5DWUL 43C9A 3U79A 1P7QA 4JN1L 4NBZB 2Q3ZA 3EO0B 3MGOA 5HJ3B 2RIKA 1FVEB 2HP4A 3QISA 4DTGL 4H1LH 4LASH 1KV3A 1Z9MA 5IW1B 3NTCH 3L3GB 5BXFB 4I2XA 4Y4KB 2WSKA 1ZMYA 4W6YB 3TPKA 2W0FA 5GGRA 5BQ7A 1EAJA 2YK1L 4OB5H 4UILL 4I18A 3BD5A 5KVFL 4XC3L 3EOBA 1XCQA 5CGTA 1S7RA 5FGSA 4XVTH 2YRPA 3RIFK 5EZOL 5JHDB 1VEMA 1H0DB 2VE6B 1CFQA 1HHKB 4HHAA 4QGYA 5LGJB 3N1MC 1FG9C 4Y5VA 2CLZB 4MA7H 4POZD 5JQHC 4OZIF 2VSDA 1KLGA 1G1CA 5KAQF 3PHOB 1EVUA 1WVZA 5FYLL 4UT9H 3VXSA 4QEGA 3MV7B 3PGFH 1NGQH 3DUHA 3LZFH 4F8QA 1MWAL 4XCFL 4A6YB 2X7LB 4EI5C 2O5YH 3OMZA 1Q9WA 3SQOL 1CVSC 2BERA 4S11A 4HFWB 5DUBA 4K7FA 1FC2D 1NKOA 3ROLB 4FFZH 4Y5YB 1LP9B 3O6LH 2IQAA 4XPFH 3VGEA 1TJHH 4J6RL 5TDPA 3GBLA 4W6XB 2XXCB 5FM8A 1XR8B 1M7DA 5CLWA 1C5CH 4XPHH 5DVOA 4U7KA 3DUSA 3C5ZD 5E8EA 2APTA 2BRQA 3BRGC 3PDGA 4WFEE 1CE6A 3IKCA 4HKXB 2H8PB 3SOBH 3QIBA 1FAIH 4HLZH 4CN4A 2HMIC 3QDJA 5GRWA 1G7QA 2ZKHL 2XV6B 4BZ1L 1AI1L 2UWEB 2AJ3B 4Z76A 1P5UA 5CSZA 4KDTA 5EO9A 5CJXA 3RGVA 1HHJB 2DI9A 3FRPG 1WZ1H 2CDGB 5BZDB 1BBDH 2ZOKA 3ZTJG 5EOQH 1TPXC 3LV3A 3IXAB 5IB5B 5L88L 4Z7WA 5EBMA 5DF0A 1Q72L 2VH5H 3RWHB 4OQ1A 5JO5B 3U7YL 3V6FA 4OCMC 4F9LA 5CD3A 4KAQH 1AE6H 4R4BA 2Q7YB 5DMKA 4MNQB 5I2IB 3B9EA 1S7TA 4LVEA 2R69H 1GAFL 2CKBL 4D8PB 1MI5D 5D2LB 2FJHB 5E2TH 4NOBA 4LCUA 5ALCH 1C16B 3BUYA 1OOAA 1ULVA 3DOSA 5KG9A 3C5SA 5JQ6L 4X8JB 4LLYB 4H20H 1ZV5A 5FYKU 3PHQB 3PQYB 4P2QA 3E6FA 1R24A 1II4E 4Z7VE 3FAWA 4YXKH 5CD3B 3JV6B 4OZ4A 4PUBH 3BAEL 4ZAKD 4HZAA 3GGWB 4P5MB 1RI8A 5TDOA 4ZAKB 1S7VB 2FZ3A 4HMEA 5E8DL 2Z31A 1CK0L 2XWTB 1WCBB 4GRMA 3LMJL 3UTTB 3VGAC 4MVBC 3AS3A 3GIZH 1CD1A 3CK0L 3KYAA 4QXTB 1N5YL 2BY0A 1LK3H 3RVUC 1X5YA 4LVNB 1DFBH 5D7JD 2AJ3A 5EU3A 4KTEL 1EV2E 3TCXA 4XBEH 3L7FB 3O4LD 4PV8A 4Z7UA 4Y16A 2IH1A 3ARDA 3MACL 2P5WA 2BHYA 1G7MA 3SBWA 2P7TB 4GW5B 2ZUQC 3DI2B 4LIQL 3MJ9H 5HI4C 1XR8A 3GIVB 5DJ2A 3SE3A 1EMTH 2NQCA 2X4UB 1A3RH 1I9JH 3MODL 3H9HA 4GLRI 3RAJH 3PGDA 3PG2A 4HX1B 1I3GH 1LO5B 3KPSD 1J7VR 3MLZL 1Z2KA 4HXAH 3BZEA 1CFNB 2B20A 4OTXH 3D0LB 1B0RA 2K7QA 3O3EB 3VWJC 4JZOB 4O02H 3WXVL 1P4LA 1WZMA 2NW3A 4BZYA 4OCXL 3ZKND 3OJDB 3SE8H 1HKLL 4GRWE 2LU4A 2EO9A 3G5YA 3C2AH 4HV8A 1CU4H 3U7WH 4OV5B 3C60D 4UT6H 3WFDL 4XCEA 4EOWH 1I3RB 3Q1SH 4PRPA 4XI5C 2ZG3A 1S7VA 1EHNA 1QYGH 1JHTA 1OW0A 2QSCL 1ND0B 1T7VA 4RA3A 2R4RL 4U2ZA 3WCYA 3FB7B 2AKRA 1BWMA 3VWJB 3KPRA 3MA9H 3TA3A 3FO1B 2V9TA 1FVDB 5I15H 1C7SA 4J4PD 3DGCR 1JPFB 1IZKA 4QRTA 2VXQL 1ITCA 5FYLE 5KVDH 1Z3GL 3U4BH 5KS9B 4R0LA 3MLYL 3G9VA 3DURA 4K23L 1JI2A 4XVJH 4L5FL 1X5FA 3OGCA 5IUSA 3EJZC 3VH8G 2MNUA 5T1KB 4P48A 4WI5A 1A21A 4Q58C 4HIXH 1HNFA 3VRLF 2XZCH 2YR3A 5K9QG 5GGRY 5A40E 1HE7A 4YXHL 2NY4D 1R3HA 1CF8H 2YD7A 3QUMH 4H0GA 1MHHB 5ID0B 3QWOA 4LLVA 1FFOB 3OGOE 4U3XA 1BIHA 2P5EB 5FYJD 4XB8A 1D5MA 3VFGH 2A6DA 4NSKA 4GUPB 1FIEA 5DYOB 1EK3A 4EI6A 2KDGA 1X4XA 3GJFB 5JW3H 3FN0L 1R5VB 4P3DA 5FM5M 1EEUA 2YKLH 1T21A 4K9EC 1SJHB 2RJMA 4Q74A 4ZTOL 4Z7UB 1WFOA 3PWJB 4QRTB 4WV1C 1S8DB 1VGEL 3QHTC 4PGBA 4P23D 4L9LC 1S7WB 4U6YA 1FVCA 1G9NL 3IT8D 3L3DB 3LEXB 4MD4A 2J5LC 4L4VA 3GSWB 1DLFH 1EGJA 1YEJH 1X5HA 2FIRT 5C8JB 1HI6A 4QF1B 3E6HB 4XXDA 3MRPB 4N8PA 4DW2L 3UZQA 3CC5A 4EVNA 1IGJB 5CGYC 5BV7L 1JYNA 1VEPA 4P3WA 3KYKL 5I1GH 3HI1B 5GGTA 4J8RA 1A9EA 5FUOL 3LEXA 4JFDB 3AC0A 3MCLH 1QFWL 2HLFC 3R4DA 1X6LA 2A9NH 3PWLB 2MCPL 1J1XL 5LAXA 4UAOB 1OB1A 4P9HC 3B2UC 4OD1L 4HS8H 4M48L 3BQUA 4F7EB 1UXWB 5DMKB 32C2B 3ILPA 4TUJA 1FYHB 3ZDXF 5JO5A 3BKJL 1A2YA 4ZO7A 1QNZH 4EI6B 4MAYC 5IVOA 1K9TA 4E5XA 3ZT6A 1Q9LB 5AYQA 2QADD 2EDQA 1XF4A 3T4YB 3TO4C 2V2WB 4NYLA 4HZLA 1PJ9A 3MNZB 4ZFGH 4UB0H 1EPFA 1K5NA 3QUYD 3HI6H 2MKLC 3B6SB 1VB9A 3SDXE 1S3KH 1EHXA 2WWMC 3RJQB 5I1AB 1KN4H 5I1KL 4X7CC 1A47A 3MLXH 1S5IH 1PG7H 2AJVL 2VITB 4OD2B 4LASL 5KVGL 1MPAH 3P0VL 4MB3A 3JV4A 4NKDA 3SGKC 1YEKL 3LS5H 1HYRC 5CZKA 3WDHA 4DGVL 4XWOD 5BMFH 5A2LH 3MGTA 5DGRA 3DRQA 5J6GA 4OFIA 5LWYL 5IIEA 2NXYC 4MD5A 2Z91B 3DLQR 2V7HA 2QHLA 4WDIA 4UQ3A 3NFNA 1AGFA 3QUZD 3D0LA 1DVFD 4KZDH 5DJCB 1CL7H 3QDGE 1OP5H 2R4SL 3RUGB 4Y19D 1XF4B 3MRQB 5KANG 3T4YA 2QQLH 2IANE 4EJ1C 4LNRA 2RBLA 1A4JA 1DQML 3VW3H 2P8MA 4X7TA 5FUZH 2BOBA 4MCYA 4G42A 1QVOA 5KAQG 3DVGA 4QXUL 2FH8A 1HILA 2BNRA 4X4XA 4P2OA 2EEBA 1QKZH 2NR6C 2P45B 3L5WB 4LP5A 4KUCD 2ORBH 4YHOL 2NNAA 5EBMB 1FBIL 2LAGB 5E8PA 4LHQB 1ES0B 4AM0B 2W91A 4A2LA 4MJIB 1F3DH 1NAMA 4YFEA 4JRXD 2VQTA 4O2EA 2D7TL 4OZFB 1IKNC 3MRGA 2J3SA 3RX8A 3CFDB 2BY3A 2ZZUT 2VXVH 5IEHA 2YKLL 4LLMA 4RISL 5FYKL 4UV7L 1BVLB 1JYWA 4Y4KA 1JGVH 1X9QA 5B3NA 5DJ8B 4XCYB 4ZO9A 5DHXB 4QHMA 1VGEH 2H9GA 4U1SB 1Y6MR 2GSGB 4ZS6D 5CEYB 2ERJC 1KXQE 3RA7L 1HHHB 4OGXL 1R24B 3WNNA 2X4RB 1YEEH 2VZOA 3L95A 1X44A 4JFEA 4J12A 5INCA 3QRGH 3ILQC 4F7MA 3PL6C 3BWAA 4IDLA 4AY0A 3GMPA 3GRWL 2E5EA 1MRDH 3DVFA 5IB4A 4U1NA 4PJXA 5A16A 1WTLA 3QA3B 5C07A 2V5RA 2K7PA 3B43A 3FZUC 2HFGL 2VLRA 5DVNA 2Z31D 3VFWB 4DFHA 5EOQL 2VQ1A 5ADPH 2EICA 5E1HB 3ULVL 4PB9H 1Q0YH 4MQXD 4L8DA 5GS2H 4I3RH 3R1GL 1H5BB 4XAWH 4YDIL 3O3AB 5C0BE 4OLXH 2C3HA 3IJYB 4RDQF 3OXSB 2LFGA 2VDPL 5H37H 2F8VA 1YEHL 3G5XB 1BQSA 2P5EA 3BYYA 4FXGA 4HWNA 3WE6B 4PJ7E 1MUJA 3SDYH 1U8NB 2Y36L 4WCYH 3GMQA 3LQAC 2YEZB 5EN2A 1KTKE 1EUUA 2Q1EA 1WF5A 3C6LB 2ICWJ 1UA6H 5DD3L 3BKJH 4FQQA 2XPGA 2YWYA 2FX7H 3ARBD 1NUGA 5TE6H 4WWKC 1XGPB 2FECL 5DC0A 5T1LB 1MRCL 3QQ3B 2G75A 2Q76A 2NY2C 4TUOB 3IXAA 2HVJA 3C2SA 3WJJA 4OLEA 3VG9B 3BXNB 1T7YA 4I48B 3MGAA 4U6VH 5HHXL 3HPLA 3OAUL 4PRDA 2JIXB 5F9JB 3B9KC 2C5DC 4KJYB 1WBYB 3DMMC 3MRLB 4DTGH 2ESVD 2CR3A 1AY1L 3ZT7A 3BJ91 3QUZC 5EBLB 2DWDB 1RQ5A 4YPJA 1U58B 1AGBB 4HK3N 2CQVA 5C0GA 3VFMA 3QIUD 3WDIA 5B39B 1DFBL 2DTSA 4NWTH 1AO7B 3BP4A 3FO0L 4S10A 1I85A 2ADFH 4HJJL 3P0VH 4NKIH 2NX5E 3WL9B 4B41A 5JOPD 2HFTA 3AROA 1AO7D 1RHFA 2A73B 3DMMA 4Z95H 2NY2B 4V1DB 4YEFA 5E4EC 2X7LA 1I75A 3QQ9C 3JWOC 5SWSA 3V52H 5K9JL 1UM4H 5JPNB 1IGTB 1AC0A 4EUPB 2GQHA 3PWPE 1JE6A 3RQ3A 2Z31C 4MDJA 4JANA 1TITA 1A3RL 4LCIL 5HBBA 4PRHA 4HGWB 2GCYB 3HZYB 5JOFB 3BKYH 2SEBB 1S7SA 4UNVA 2DLTA 1IM3B 4CU6A 3CXDL 3IDJA 3DSNA 2CXGA 5C0JA 3W9DA 4Y1AD 3WSQL 2VUYA 4YDVB 4HK0B 1YQVH 2WAHA 4YHLH 3DRQB 1O5DT 1AKJD 5TE4H 1A1MA 1GZQA 4TUKH 1A6TA 5D7IA 4ELMF 2H2PD 3DSFL 3I6LD 3KLHD 2ORBL 4Z8FL 1RIUL 1KOAA 1Z9OA 1NH6A 3HLAA 3BP4B 4ZUVB 5JW4M 4LSRL 4XTRC 4LDLB 2YBRB 1TJHL 3C87A 3E8UL 4YNYA 5I0ZA 4EXKA 1ZLWH 1MVUB 3EOYG 2EZ0D 2HN7A 3UTTD 3H3PH 2VXTL 2FX8H 4NCC1 4Y16C 4NYLB 4X6EA 3OX8B 3N85H 3ARBB 4KK8D 1T5XA 3TYGL 5C0CD 4F15B 3T8XA 2G2RB 4PJ8A 4PREB 5C0BA 2DQHH 4K55A 1FO0A 32C2A 2AK4A 3EDDA 1U3YA 2DM3A 4MXQC 2DQGH 3S4SA 3BKMH 3HE6D 1QQDA 4HBCH 4YBQC 4L5FH 3UJTH 3I2CL 2R0ZH 2X42A 4X8JA 1CI5A 3JWDL 4DK3A 1FYTE 5AUMA 5J56B 3EOAA 1IC4H 2L4OA 5F93C 4TQEL 2IPTL 1CFTA 1AGEB 2AQ3A 3SY0B 4WWKD 1KJ2L 5GSRB 3F6IA 1VFAB 3RVVC 3CZFA 5BV7C 2NY2D 4V1DD 4LVOC 4ODXB 5ANME 2XG5A 2NY0D 4FQJL 1YEHH 1NJ9A 3HNVH 2E8YA 4TTDD 5BRZA 1YUHA 1MHEB 4LPWA 2AXJA 4IRSB 1VENA 4P23A 4X6FA 3SE4C 5HVFB 2GFBB 2BHZA 4OLZL 3VE0A 3FRPA 4PUBL 25C8H 4F7CB 4BQ8A 2R2CA 4XTRD 3VRJA 2E6JA 3CFEA 1GCFA 3U0TB 1BJ8A 2W60A 5IKCA 1MQ8A 4MQSB 3IB4A 2GT9B 4RIRA 1L9NA 4XHJD 4S0SD 4F7CA 3QXAB 4M7ZC 5FECB 3MRGB 4IRZL 4A6YH 1ORSB 2XN9B 4NUGL 3UEZA 3RHWK 4YWGH 2WUBL 5JZ7C 5F3BB 1UZ8B 3FO0H 4HIEA 5FUOH 3RZCA 2IFFH 4XNZB 2VDNH 3BGAA 1JK8A 2QQNH 3VXPA 3PXJA 3G6JA 4C59B 3ZSSA 3L5WA 3FO9B 4YX2H 1Y0LA 1YPZF 4YHPB 4OZIA 2R1XA 1Q9WB 1T4KB 1B4JH 1R3LB 1UM5H 2XZAH 3P2TA 4RAUB 1MCNA 3NACL 2Y1VA 3WFCH 2H2PC 2XKUA 5D7JB 4NC0B 5ICZB 1CGSH 3H9SB 2Q20A 2QBWA 4YPGA 4ZNCD 1A6UL 1U8IA 2V5SA 2BMKA 4FNLH 4OTXL 1DANU 2ZSVB 3K2MC 4XPBH 2HJLB 3SOBL 3MOBL 1C08B 2XQBL 2QHRL 1TENA 3MRCB 1MHCA 3S4SB 2FBJL 4B5EA 2EZ0C 3VGAB 5IGXL 1DQLH 3GJEB 4YUEH 3UTSB 5DWUH 4LDOB 4E9LA 4G6AC 4PJIA 4Y16D 2RFXB 1Y18B 4FQXB 4KKAD 5H2BA 3VWKB 1BBDL 3OZ9H 4GLRH 4LF3B 1E0OB 3OJDA 2AJVH 2H2SD 4J23A 2W9DL 3OF6A 1TTGA 1U8PA 3KPQB 3JWOL 4KMQA 2NZ9C 4G6JL 1HIML 3RY6A 1NC4D 2X70B 1T4KA 2WMPA 1AFVH 5EIQA 3PF2A 4TNVF 2XACC 2AV1B 1OT2A 3QWRA 3V6OC 4MA7L 2JKXA 5F9AC 4HJ0C 5ALCL 1U2CA 1T5WB 3LKRB 1ZWIA 2B8OT 5SV4A 5IW6A 3EYVB 3JZ7A 4FXGB 2X9XA 5F89B 4G7YH 2J4WL 4HFUH 1A7QH 3IDXL 4NQCB 4D0DA 1KN2L 4XPAH 5I8EB 4AEHH 4YHMH 3L7EA 5FYKD 2H1PL 5ITFB 4OIIL 3UBXA 3G6DL 2VL5B 3BQUB 2X4QB 2X44D 5IVXF 4ENEC 3V4UL 3DX6B 2XICA 4JHAH 3VXME 1H3GA 5GJTH 3IVKB 1QPXA 1D5IH 2P5WE 4P0DA 4X7SH 5EZJB 4L8BA 4OGAC 3ZTNL 2DQIL 4OZGB 5IB2A 2UVEA 4WHCA 3S96B 4GRMB 1NQBA 4LFHG 5T1KD 3P9LA 5IR1A 5C0IA 4LKCA 1RUML 3VFSA 5JW4R 5TQ2H 3GKZA 3QQ3A 4ZAKA 5IKCB 2J6EH 1M6OA 2WNGA 4NUJB 1CGWA 4Q9BA 1FAIL 1QRNB 4NO0B 1MFDL 4P2CG 1YEJL 1GHFL 4M1GH 3TBSA 4F37K 5DSCA 3MUZ1 3MLTA 3TT1H 3GM0A 4HC1L 2A6IA 4DEPC 4JM4L 4ZPTA 3VGHA 5CBAB 5E9DB 1FZJA 2XA8H 1F00I 1UB6B 2FNBA 4ZDHB 4GW1A 3WIHA 3QAZC 1JNJA 1Y0LB 4YHPA 2Y5TA 3X14A 4PJEB 5C0ND 5DYOA 5J1TC 4P2OC 5IW3A 5L2JA 3TVMB 4H8WL 1QFWH 5HDBF 3FQUA 4XVUC 1G9MH 3QCVH 1D5XB 4H20L 3WN5B 1OARH 3HFML 2DRUA 4DEPB 3R06A 4Z0BL 1YMHA 2R2HA 5EO9B 5DHYA 3PNWB 4WI3A 2ZSWA 3QSKB 4K8RC 4RRPA 5EOCJ 4ENED 1NDMB 2PYEA 4KC3B 4NCDA 4QHMB 1MJUH 4OT1L 2I24N 4LMQI 1UA6L 3SKNB 1QEWA 4LCYA 4W4OC 5EFIA 3FT2A 3QEHA 3KPSB 1VGKB 3MBXL 5EZLA 4ELME 3HAEA 5K33A 5B38A 4X8XA 2QHRH 4DKAA 4UIMB 5CEXB 2WWKO 4OZFA 5I8OL 15C8L 5I30L 2UV3A 1M71B 2IPUG 3HUJF 5FOJA 2FEDC 4FQ2L 4LIQE 4B50A 3NGBC 4U1IA 1CDUA 4U1LB 3T0DA 3MLXL 4PLOB 3VFPA 5CINH 4K7FB 4LIQH 4JJ5A 3V7AG 3DYPA 4GKNB 4KROC 4FMKA 4X4YA 1JPSL 4LBEA 1QA9A 3WEXB 2VMFA 1MCQA 4S1RH 5DRWB 2AJZA 2P8MB 4X7TB 5CIPH 1UVQA 1I1CA 5HYSA 5J11C 1WAAA 3NPSC 4PJEE 4PRAB 5F6HJ 3UAJC 1D6EA 3QHZH 4IOIB 3RI5K 3V4PH 3FFDA 1DUYB 4ZUWB 3WFZA 5DK2A 2M26A 1FYTA 3RTQD 3CDGB 4ZUUB 3BD4A 3KPLA 1IKFL 2YC1B 4ZTOH 4XH2A 2LABA 4R7DA 3QDHA 2QQLL 3AU1B 3OKYA 4MQ7A 3TLRA 1DUYA 4ZUWA 4TSBL 3QNXA 1G9NH 1BQHB 1ZLVK 4U6HB 3NCJL 4HAFA 3GSRA 4N8CH 4JQIL 4ODTL 1UM6L 3M8OL 4PY8I 4D9QE 1NGPL 5FB8A 3NCFB 1T20B 4XNMB 4UT6L 3WFDH 2JE8A 3CMOL 4HULB 2YD3A 2HG5A 4EDWH 5K9KB 4X6DB 1G0DA 6FABH 4ONGL 4YHYC 3CVIL 3QUZA 4AT6B 3U2SB 4XT1C 2GYSA 1CD1B 4GS7B 3D3VB 4O2CA 1YEIH 3IDIB 5AZEH 3VXMB 1FNEB 3D3VD 1T0MB 3CLFL 3V8CA 4LLDA 2F5BL 2XRAL 3KJ6H 1MSPA 3O3DB 3P30H 3CXHK 4NPYA 2PTTB 5C0JB 5EU5A 3SKNA 4OI8A 2CUMA 3STLB 3ALXA 3HHRB 3STZB 5D6CB 1W72L 4JRXB 3CX2A 1MRDL 4CJ0A 3RDTC 1TVBB 5DQ9B 2BOCB 5E00A 3QDGA 2FJHA 1QRNE 1KB5H 3ARGC 5JW3L 3WO3B 4Y8AA 3S37L 1H8SA 1GOHA 4POZC 1YY8A 3QBTB 3SJVB 2QLVB 1OHQA 1PG7X 3O0RH 3H8NA 3O6KH 5HGBA 2COQA 4KXZI 4PGDB 3PL6B 2HJKB 3ELAT 1NMAL 3QUXB 1A7OL 5KVGH 2DLFH 4IJ3B 4UTBL 3SDDD 3HE7C 4L8CB 4ZPTB 3VFUB 2GTZB 4EN3A 2HVKA 3NABL 3MNVA 4TRPH 1DLHB 4M93B 1QFWI 3LKOB 2Q86B 4M43L 3L5IA 4PJ7F 2EH8L 3UJJH 3MMEA 3VGGA 1BMGA 1PZ5A 3CFJA 4C54A 4OSUL 3OR7B 5JA9A 5CJQL 4GG8B 3IJSA 4M1CC 2D31A 3GB7A 2FRGP 3VFSB 5E8EB 1P6FA 1L7TH 1I3RA 5EBGA 1F4WL 1HQ4A 2ADJA 1H15A 3DVGB 1VFAA 1JI1A 4LAJH 3S9DB 3GZKA 4FQ2H 1DQMH 5IEHB 3VW3L 4RFOL 2EKJA 4U1MB 3ESVF 4NFDA 5H94B 2JJTA 3KYKH 3RTQC 5I1GL 1U8NA 3PIQA 2IEPA 3MRQA 3TBWA 3Q3GA 1JFQL 3HZVA 4LQFH 4Y8DC 3LH2L 2VLJE 3F7YB 3O3AA 3MQIA 1UH2A 1JBJA 5CLTA 1HCVA 2C7UB 3G9AB 3GI8L 1A6ZB 2MCPH 3HR5B 4QGTA 2YPKA 1N59B 4NZUL 3SGDH 2O61A 4JO2L 3MXVH 1Q9KB 5KZCD 4PJIE 4QRSB 2R56H 4G6FB 1P7HL 2FWOA 2A6DB 2BOBB 4NSKB 1PYWA 3MV8A 1T1YA 4Z18A 5HHMD 3P9WB 3GBMH 1GIGH 1O7SA 4XAKD 3MFFB 5IOPA 1I8MA 1A7PH 4KUZH 2OLDA 4HG4K 5L8KB 3L95B 3O2WL 4JFEB 4X6CF 3ZYOA 4JQVC 3VG9C 2VLRE 4MLSA 4IIQC 5D2NE 3HC0B 5SV3A 4KTEH 3EUUA 4ODTH 1NFDA 4WV1B 3LS5L 1JYVA 4XAKE 4JPIB 1FGNL 5GIRB 4ELMB 5IMMB 3MACH 3UYPA 3KG5A 2EDBA 3TO2B 1U3HD 1A7BA 5KN5A 4FTVD 2DQCH 2VB5A 1WCBA 1NUNB 2HFGH 2VITA 4OD2A 2OJZL 2JCCF 3WHXA 3UZEA 3E0GA 3TO4D 5J06A 2IJ0C 3BKCL 3PWNB 4NQEA 2JJVA 5I16B 4YDIH 1T04B 5I17A 2XXMB 2SEBA 1XGYH 5IROA 3G04B 4G80B 3C5SB 3ZKNC 2WP3T 1RHHB 1P4BH 4RX4A 2WBKA 5F96L 1EEZB 3WIFB 1V8HA 1PKQA 3MPCA 1T6VN 3CVHB 2XQYG 5I6XB 2YPLD 2VLKE 4HLZG 3WBDA 1EEYA 3QZWG 4R2GD 4PJHA 1A7QL 3IDXH 4QOKD 4JZNB 4RAUA 3MCKB 1RHHA 3A6OA 4FFYL 1MFCH 5B8CA 5FUCC 2FL5A 3EYQC 1FORL 3Q5TA 2PTVA 2MJWA 5DD1L 3RGVC 5D8JH 1YEFH 4JVWA 5F9OL 4G3YH 4XPGH 2VC2L 1EH9A 3SDXF 6CGTA 3VH8A 1FBIH 3D6GA 3HG1B 4BK5A 2VZUA 1WJ3A 4ODUA 1XIWD 3OKDA 1S7QB 1IQDB 3D85A 1LO0L 2A6JB 2DB8A 2PXYA 1IAOA 1NEZB 3D69B 4NWUL 4BK4A 1TCRA 3NAAH 2ZP0T 2ZOLB 1W0VA 3U6RB 3I6KB 4K07A 5KS9F 3QEGH 2XWJA 3RA7H 4XXCC 4NN6C 4DOHE 5GRVL 5CIPA 2OMNA 4P9MH 1NMCB 4IIQB 4LARH 2YRLA 3D69A 4XB7A 1WZLA 5HY9B 4OLZH 2J6EL 1YEGL 3T3PE 1CXFA 1MIMH 3S3SA 1UQSB 4P46A 3FQWA 5ADOH 3Q48A 2QQKL 3JBG7 1W0WB 3BT2L 4OM0L 3VRLE 4YXHH 3IFOA 1BVKB 3TYFB 1I7TA 3QQ9D 1DBMH 1DBBH 2FZ3B 1UWEH 4PGDA 5E24E 4AJ0A 3STBA 5FXCH 5I2IA 4I3RL 1SBSH 2ZPKH 4QRRD 1ZLUK 5DRXA 3IFLL 1JGEA 2Z8VC 2R15A 5B38G 3CXDH 1UC6A 1PAMA 2QR0B 4NNPH 3ZL4H 4DJMA 1UB6A 3QCUL 4I0PA 1NCTA 1FYTD 5IT2L 5B4MD 4JVPA 2BK8A 2HRPH 2QTEA 3O9WA 1KF9B 2YD6A 1I7ZB 2OI9C 4LSQH 4DN4H 1BWWA 3JSSA 2C3VA 4ZSOA 5ISZA 1VA9A 5C86A 1NCAL 3DX9B 3PE9A 1L0YA 2P42B 1TETL 1OARL 5IP4A 4LK4A 3V5DB 3S35X 1OPGL 1PGRB 3G6AA 4MB4A 5CEZE 3OGCB 1S9VB 3IKCB 4N68A 2C3WA 5IQ7L 1QP1A 2J2ZA 3MFGB 1M7DB 1W0WA 2F19H 1ZLSH 4M61B 2VN4A 4LLMB 5A1AA 2D7OA 5A43C 3LPWA 1U95A 4KKCC 3G5YB 1JPGA 4FQIL 1I7UA 2D0HA 2VN7A 3TJEL 1HNGA 1ODAA 3MV8E 4KDVA 3FT4B 1AQDB 2ZJSL 5HHXH 5EO1A 3K2UL 3UROR 5K9KA 3TH4T 4OZIE 3G08A 1C1EH 3WS3B 1CDHA 1DUZB 2CUHA 3FOLA 5F9WC 1T66C 5E6IB 3O4OB 3HG1D 1QRND 4XNMA 1T21B 3UC0H 2VDLH 4JFOA 2EXWC 1VPOL 3CDGA 2W9DH 3ALPA 4PRPB 2H32A 4WI4A 4MXQD 1BIIA 1M05A 3L3HB 5E8NB 1C8PA 4Q9RH 3CMGA 5EDXA 5E08H 3RL1B 4MJ2A 4H5SB 4YDLC 2FO1A 2AJZB 5KW9L 3EYQD 4OIAA 3TN0D 2D4DA 5DMGC 1XH3B 5CWSB 5DJXB 1VFOA 2O5ZH 1G9EA 1A6WL 3CLEL 5BS0E 5CEZL 1BOYA 1MCFA 4G7YL 2NY3B 5T3XD 3T0VA 5AZ2L 1XF1A 4E0RB 5TE4L 5HVGB 2L7UA 5FYKE 3I3EA 5JPNA 2HT2D 3DECA 3RWFB 5L9DH 5AAWA 4JY5L 4GMTL 1XCQB 1KT2A 1LEGA 4QHNA 4N0RA 4O4YL 3U9UB 5T3ZL 4JRYD 3RVTC 3UTTA 2QQQA 1QA9B 1CGXA 1LE5A 4GRWF 3E8UH 3QG7L 5I75C 1IM9D 2DQDH 1YEKH 5ETUA 4NZTH 3BUTA 4S2SA 4JM2D 4OCLC 2NY3C 4UNTA 4WO4A 1I8KB 4YC2C 5L8JB 2PW1B 1O7VA 2EDLA 1EJ6A 2ZSVA 3KNBB 4UIMA 2W92A 4OV6F 3CX5K 1MFBH 4D0CB 1IFHL 4M7LT 1A6AA 1IQWL 4KDWA 2AJSH 5AWNL 1N64H 4GKZB 3BHBA 1NFKA 1CGYA 1MFDH 4LCWA 1PBYA 1CXLA 5FGCE 3EDEA 4M1GL 4UZGA 1CDIA 1DZBA 3OB8A 3TT1L 2WW8A 3VXPB 1MAJA 5D2NB 4WY7H 4Y2DA 4PG2C 5ACMA 2NXZC 4NFBA 2HKFL 2DQGL 9CGTA 5DJDB 2J6EA 1T1YB 1DQDH 5LGKA 4KY1L 4Y1AA 2E27L 1MUJB 3LVEA 3TN0C 3TBSB 3QZWA 1FJ1A 4KQ3H 2NXYD 1U93B 2WP3O 4M1DH 4MA1C 35C8L 4ETQA 2D7TH 1LE9A 5BOZG 2LAAA 3AAZB 4PD4J 2ZUSA 3K4ZA 1BM3L 1PEZA 5D1XC 5D7KD 3DVNB 4C56E 3L7FA 1KSRA 2ITDB 4L3AA 3TC9A 2ZCLH 5IB4B 4CU8A 1NCAH 1G7PA 3BEVB 3IDGA 3UTQB 3F58H 4YO0B 2W0KA 4NZRH 1F4XH 1NMAH 3HUJA 1TQBB 3O6FC 2UYLA 3LKPA 2J88L 3MROA 3W39A 4ODHH 1OTTD 2F53D 4KUCF 4L4TD 1AFVL 1N6QH 1MEXL 1EJOL 1VADB 5HHOE 4GAGH 4W4NA 4H88L 1T6WA 4RMVA 2C4XA 5CIPB 3PJSB 2W59A 4QY8A 2C3GA 5GSVA 2QKIA 5DS8A 4EBQL 3SKOB 1B2WH 2VLKA 1QFUL 1FH5L 3ULVH 4HWZB 4F33B 1RFDL 4IDJH 1ADQA 2IFFL 3KPRD 1MNUH 5EZJA 4MNHA 4PJ9A 2R39A 1E27A 3EYVA 4RFOH 1JVKA 5C0RL 1ES0A 3FL7A 4YHZH 3KPMB 3B83A 5IVXA 4HDIA 3EYUL 1OGTA 1PEWA 2IAND 3OG4B 5ITFA 1SEQL 5DLML 4U31A 1DN2A 4JO3H 3VFNA 1HH6B 2CDEB 1HHKA 4HHAB 3ZTNH 2A6KB 4NQCA 5GZOD 5HGDA 3DX8A 2RCSL 3BGMA 2M8XA 1BVKA 3RWEB 4GBXD 4XCCH 1OAUL 1S7RB 3LDBC 4M4RA 4EDXB 3CPLA 3P9MB 2WIIA 1KPRA 3O2VH 5BVJB 2NY7H 1FRGH 5B3JF 3T0EA 2BX5A 4PJDE 4RQQB 1KLGB 4GSDH 3V9FA 1TZIB 4OM1L 3NIFF 3NPSB 5L8LB 2F58H 5FGRA 3P73B 4PJ8C 2EYSB 2MFNA 1CBVL 5MENE 2Q6WB 2BHUA 3MGTB 1MCBA 2H26A 2MPAH 5DUPL 4HJ0D 5I18L 2ZNWA 1XGQB 1HIMH 3WUZA 1E4WL 1NL0H 3QEUB 1LD9A 1F02I 3FONB 5GIRA 1KEGL 4ODUB 5DJYB 2FHCA 3L3GA 4LCYB 3CVHL 3LN5B 3LN4A 3DWTA 3O11A 2ZUTA 2OJZH 5J12B 4E0RA 3D3VE 1D6VH 1RJYA 2QADB 4XZUB 3IDNB 1B0RB 5ITBH 1HDMB 4OF8A 1C08A 5C09B 5C07E 3VMNA 3L6FA 4LCIH 5J0BA 4M5YH 5F88B 4O00A 5C09D 1SYSB 4EDXA 4UNUA 2XG4A 1JPST 1KN2H 1NUDA 3HMXL 1KJVB 5EU6B 5C0FA 2UZYB 3GMRA 4P2QD 5C0NC 5EU6D 5GGVL 1ITBB 1YZZA 1PSKH 1E6OH 3WSQH 1B9ZA 1HH6A 5FECA 1A3LH 4TUJB 1G0YR 4GW5A 4HPOH 1D5IL 2XNAA 2EDRA 3MLUL 1TQCC 1MFAH 4PV8B 1S5HA 4NJ9L 5EU4A 3MRLA 1T03L 2P49B 2ARJB 2IH3B 5F9WB 5HHOA 3VFOB 5J9PA 5JHDA 1SVCP 2FLRT 1HXMA 4X7DC 4FOMA 2VAAA 3EYFB 4CVZA 2LU3A 1WBZA 4NC1E 4TN9A 1AO7E 3LKSB 5F7FA 2DQFA 5MEQB 1LMKA 3HC4H 3VDCA 5FKAA 5DHVH 1SY6L 4RCAA 3NZ8A 3KPPB 5IFJA 4Q0XL 4NZRL 5K59E 4M3KB 4HUVB 4YHIA 1UZ6F 4Z78B 2XKSA 3V4VH 1TQCB 2OL3B 5HYEA 2GITB 2YEZA 1V7NL 4ODHL 2LE9A 4PRIB 3W11D 4OI9A 1CICD 2OK0H 4ISVB 4D9LH 1HXMB 5TJWK 4E41B 5KBNC 4MJ4A 1NLBL 4JB9L 3KWWB 2EEAA 4QXGH 2WBJC 3AY4C 3HE6A 2I26N 2NYYC 2XNAB 4QRUA 4WI7A 1JGDB 4RZCA 1N7ML 2V17L 4HKJA 1GVIA 2VJXA 4S1DD 4RBPK 2QV2A 3ZT5A 4JHBA 5EA0H 4GBXC 4KI5D 2MQCA 1E4KA 4XNXL 1KIRB 2E3VA 4D0DB 3DI3B 1FAKT 4DQOH 3O3DA 3LZFL 4KK8C 3H0TA 4DZBB 5GZNC 2A83A 3HZKA 3OX8A 3SO3C 1NCWL 5EOTB 2CDGA 5HGGS 2BFVL 3NA9H 1MI5E 1MCDA 2DJSA 3SDCB 1R5IA 3W5NA 1MCWM 5C0CE 2BVUA 5T1KA 5C92A 4M7LL 5HHPA 2AP2A 2FEDD 4JPWH 4P2RE 4WI8A 4K94C 3T65A 4NT6A 5EO0A 4DKDC 3STLA 1ONQB 5F6HI 1FZMB 3RTQB 1T5XB 1OY3B 3W2DH 2A77L 4OCRH 3VD4A 2DM7A 5CJ8A 1XIWB 4PJ7A 1AXIB 1RSFA 2WWKT 3T2NL 5F1KC 1MJJB 1WIPA 3EFFA 4N9GA 4WU5A 1SM3L 3ZDZE 2Z92A 3S36H 3TIEA 3AM8C 5K9QI 4X9IA 2OTWA 2X4SB 3BW9A 3SDCC 2BZDA 1ZA3A 3NTCL 1W8NA 1JZ8A 2CD0A 1KEML 2W0PA 3QDMB 4DAGL 2FECI 4DN3H 1ZHNA 3OBAA 4BH8A 5GJSH 1I4FA 4HG4J 1DVFB 1KEGH 4IBLT 4YX2L 2AV7B 5DHVA 4WHYG 5M7QA 5IB2B 3DXAD 1IEBA 1RUAH 2VLLB 4I0PC 4OQTA 3IF1A 5KSUB 4M8QB 3VFOA 2E6PA 4GMSL 4N8VA 2HH0H 3WLBA 3QUMB 3G5ZA 2OTUB 3EYOB 5GS1A 4KRPC 4X4YB 5I1JH 3DX7A 2XTJB 4W70A 3OR6A 5HPMA 1GAFH 2CKBH 1UKQA 3EFDL 1V7ML 3NCJH 3RUGF 3AS0A 1BFVL 2O5ZL 1ZGLB 1GJIA 2N1KA 1UM6H 1IT9H 5HHME 3BO8A 4MJID 1FORH 4JFFB 3O4LE 2MOVA 5A2FA 3ARWA 4GMTH 4XBGA 5D70L 4EDWL 5BRZE 1A4KB 3TBTB 3IU4H 4X99A 4NJ9H 5GRJL 4F8TA 4GQ9H 3N1QC 3VRIA 5DUMH 4GRLA 1FVEA 3BRFA 2XI9A 3FMGH 4GKOA 4YLQT 1BREA 2HJFA 1KGCE 3GSVA 5JXAL 3HMXA 5DGQA 2JIXA 5F9JA 3QDME 1H8NA 5IOPB 3V79C 3BXNA 1YUHB 3U0WL 5TF1H 3QIBC 3VWKA 3MRDA 5IESH 5C0BD 5CBEB 3HAEB 1BEYL 1BVZA 4FQ1H 3SQBA 3QPXL 3ZYZA 1RJLB 3L3KA 1JGDA 3TVMC 2X4PB 3BZFB 1T3FA 4KMTH 5T33L 4HGWA 3EJYC 1RZJH 4BELD 2PYFB 3GMNA 4KQ4H 4LGPB 1E27B 1XCTA 5D2LA 2JK5B 1CZ8H 3HE7D 3WLWC 2FJGA 3O2WH 4QOKE 2L0DA 2AGJH 1JNNL 5IMOB 1EA9C 4J4PC 1A1OA 2VDMH 2VLKD 4UDTB 4O5LH 3WYRA 2AK4E 3C6LD 3QHFL 3P40A 4P4KB 3V6ZA 1HKLH 3IJHA 3T0EC 4OGYH 3B8YA 2IFGA 5CZXC 2DKSA 1E28A 1CQKA 1MFEL 4P9HH 5HYQB 4ZTPH 5DC9B 4H1LA 2H6PB 3CCHB 1TETH 3EO9H 2CKBA 1NLDH 2DLFL 5E7FA 1NCCH 4PGZA 5DVLA 1FNGB 1JGLH 5F1IA 5FHBH 4G6FD 5ALBL 3ARDC 4LLUA 1CDJA 3LDBB 5MI0B 1T83A 4M3JA 1F11B 1G0XA 5SWZB 4OCRL 4Y5XC 1X5KA 4YZFE 5ETUB 1G7QB 5C08D 1FSKB 4P4KA 1K8IB 1FL6B 3GM8A 2V5TA 1U8MB 2APFA 3CSPA 3LS4L 3QIWC 3EDJA 4GS7C 5KSBE 3KXFA 1KCKA 5TH2B 2Y06H 1BBJB 3SDCA 4FFWD 2J8UB 2Z93B 3BH9A 1INQA 1T2JA 1T2XA 3ZE1E 4XP1L 3H9ZA 3HZKB 1KEMH 1S9YA 1BX2A 5I1EH 5JW4Q 3LEYH 4XVSL 3MLVL 1Y6KR 1HSBB 1S7SB 2GY5A 1VKXA 3QDAA 5JDSA 1Z5LB 1CE1L 1RZFH 4JG0L 1AR1D 3QFJD 4G3YL 4XPGL 1G7LB 1MCIA 4UI2A 3L3IB 4NRXB 3O11B 4R96B 4DUVA 1XF2B 4M1CD 5E08L 3GNMH 1P4IH 4K9EL 3RDTB 1KJ3H 3U46B 5BO1H 3TF7C 5J6GB 4ZXBC 1X4ZA 1DDHA 3VXOB 5EBWB 1YYLL 5F7EH 4NN6B 5IBUB 3IDMB 4DGYH 3IFPA 4Y1AB 4HXAL 4IRJB 3O6LL 3RI5F 1MCPL 2CDFA 4XCCL 1LQSR 3S6CA 2ICEB 4MZ2A 3X3FH 1YNKH 1ETZB 5MP6L 1T3FB 3VD5A 2ATPB 15C8H 4O58H 4PJ9C 1A6VH 1G6VK 1U42A 3T0ED