1ZWIA

Structure of mutant kcsa potassium channel
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zwiA02
2AXHA 2WIMA 1NDGB 1E4XI 5GZOC 5DK2A 3DX6A 1MFBH 5DJDA 2YZ1A 1ZAGA 2J8HA 3ARSA 1OAUL 3QWRA 4Z7OE 1NJ9A 1M1SA 4FFZH 4G9FB 4OSUL 2W91A 4MCYA 3BH9B 3LDBB 1WAAA 1WIPA 2P8LB 4XTRD 4TUJA 4YZFF 3ULUE 2DQIL 3VXSB 1K8IA 4YHPB 1HHGB 2WWKT 5IWLA 1HILB 4XNXH 1QOKA 5FXCH 4C57C 1YEHL 2IPUK 5E9DA 2BVYA 4V1DB 3WLBB 1AY1H 3TVMB 3O3AB 2QQNH 1MRFL 3STLB 3FQRB 4M3KB 3K81A 4GBXC 3INUH 4QNPE 5IB2A 3D0VA 4H8WL 4PJAF 5F7DA 3QDGD 4Y19E 2HJKB 1NEZG 3U79A 2BZDA 3EO9H 4WI6A 5ALCL 4XPBH 3G5XA 2VQ1A 1SEBB 3P73B 4JFYA 2NPLX 3P77A 4NKOA 2VH5L 5DA4A 5J8OA 3K46A 4ETQB 4EXKA 4X4XB 1V8HA 3MRCB 3PWNB 3E2HB 3GBMH 3PWVB 3F65A 2JELH 2APXA 1UWEH 5SX5K 3WXVL 5D96C 3CUPB 2APFA 5IW1A 1F8TL 4R4FL 3HI1A 1UVQB 3B6SA 2ZSVA 2JE8A 1I7UA 3HAEG 3KJ6H 4Z7VB 3ULVC 3IDNB 3V0WL 2OJZH 1UXSA 1SYVA 4NZUL 4XP4H 1UADC 4ISVA 1Q1JL 4U1KA 1UWGL 2ARJQ 3LIZL 2AJVH 4P5TD 2R1XA 5F3HB 2BVUA 1AC6A 2VDLH 2ZG3A 4YUEH 1NCUA 1CU4H 1QVOB 1N4XL 5FO8A 1QG3A 3HS0B 3ZHDA 3RFZC 1JP5A 4JFFD 2E7HA 4XI5C 3PGCA 5HGHB 5ITFA 3CGTA 4PGCA 3ZE1E 3BT2L 4PS4L 1L9NA 1J87A 3EYSH 5ISZE 3FO9B 4AQOA 1I8MA 1KJ2H 5JW4N 1WF5A 3DX8A 3MV7A 4PJBE 1IGFL 4RDQG 5DHVA 3TJEH 4FZ8H 2BNRD 3RZWA 5E2WL 1RUPL 1QLFA 2GEEA 2ZCKH 3FCTB 4GMSH 1KCKA 2Y06L 5IF0B 5J57B 4NO5B 3MNZB 4GG8A 5D4QA 1D3CA 2E27L 4MA3A 4OCXH 5C08E 4IOFD 3FN3A 4JCMA 3QUYC 4HIJB 5HXMA 2AEIT 2AXGB 5BZWA 3TO2A 1OP9A 1PSKL 2A73B 1QEWA 4QXGH 5I71C 2Z92A 1DQMH 3IF1B 2IBZY 4S10A 2DQUL 3HN3A 1HSBB 3LHPL 2OSLB 3SJVE 4JFDA 5DMKA 1UB6A 5GZNC 2MNUA 5FAAA 3PDGA 1DN2A 5EOQL 4K71B 1JI1A 1FYTB 4ZQKB 4G42B 4OLWH 5J6GB 3QPXL 1PW3A 4JFHE 1NAMH 1EEZB 2IQ9L 2R56H 5C07D 1F4YH 3TH4T 5IV2B 1WAAE 1RHHA 2Q8BL 4JFXB 5J12C 4H5SB 2LU3A 3K1DA 1RK1B 5HHOE 4AYFA 3MV9B 4XVJH 1U3HD 4J1UB 2DDQL 1HXYB 3DX7B 2VL4A 3L7FA 1LQSR 3DGCR 5B39G 4KHTL 1HDMB 1U8HB 4K3HA 2FATH 3LV3A 4TN9A 1MF2L 5T5NG 1MCOL 2DOCA 3KPSD 1ZT1A 3ROLA 4WUUB 1KJMA 3FOMA 1VFOA 3U46B 5EFIA 4IJ3C 5TE7L 4WFFD 2QLVB 5F7WC 1JHTB 3MACH 3EDEA 1OTSC 1N0LA 5JZ7C 3N1MC 4NQSA 4H25B 4LPWA 2JTDA 1NGZA 1S5IL 3MRIA 2PTTA 3MNVA 3RBSA 4FG6C 3NPSC 2KDGA 4R97B 5IFJB 1F6AB 2VO5A 4EN3D 1ZLUH 4JZNA 4UV4H 3SDCD 2R0LL 3CFEA 1I1AA 4DK3A 2J8UE 4Z77B 4HXAH 5FKAA 3AGVA 2P45B 5JNYB 2DM4A 2KUTA 4EQ3A 5ADPL 3L1OL 4HMEA 4DCQB 1YEKL 2KBGA 5GSRB 5JUEH 3R4DA 4N90E 3IVKA 1RIHL 3EYVB 1ZSDB 2ZUXA 1XCQB 1G6RL 4Z95L 3I75B 3QUMB 4LKCA 2G9HA 1KB9K 1JZ5A 5C0FB 1AKJD 2H9GA 2UYLB 2BOCA 3GRWA 4WI5A 5EO9B 1KG0B 3MUY1 2ORBH 1PFCA 3T3ME 3U6RA 3U0PA 3VFSB 1EGJL 4I13B 4DJMA 1HHIB 3FONA 2L7JA 4OQTL 4CVZB 5DJZB 4C59B 3HMXL 4Q97A 3O3EA 2A1WH 5EBLB 3WNNA 2N1KA 1KBGH 3VH8G 1FBIL 3DETD 5L2JA 1CG9A 2FL5A 4H20H 5HDBE 1YQVH 2DWEA 5GRVL 3TH3T 5CUSL 5IVXA 5ITBH 1VESA 3DX9A 5DS8A 1OTUD 3LKPA 3SQOL 3ZKXB 2B1HL 1FL3B 1DEDA 1QBMH 2X2YA 4LHUA 4CU6A 3BWUC 2ATKA 3L3JA 5DT1H 3UJJL 2E8ZA 5T3ZL 4OIIH 2XKNB 4UT6L 5EZIL 4J8RA 5F3BB 5F1KC 3NAAH 1KCRH 2ZZUT 1AR1D 1VEMA 3MLWH 1ZLWK 2X41A 3SKUD 4Z0XB 2R9HC 2AV7A 1FZKB 4E41B 2PYEA 2QKIB 1GIGL 3MBEA 3O9WB 4JM4L 4OCWL 2MJWA 2YHGA 2X4UB 2Y5TB 3OKKA 35C8L 1YMHA 1DVFA 2NXZD 4NC1E 2P49B 1RVFL 4HULB 3QQ4B 4P3DB 3MRQB 1VFAB 3BW9B 5FYKH 2QHRH 3OF6A 1GZPA 1FGVH 2VLJA 2ERJC 3C6LA 3O4OC 1Y0LA 3BPCB 1AGBA 4KKLD 3WS3B 1OF2B 2VUOA 4NRYB 4LDOB 3O2DA 4FQPA 1NLBL 4CBPA 5KVDH 4JG1H 4ORGA 3OZ9H 4PY7A 3S37L 4ZDHB 4X4ZA 5GS0L 2BHYA 2R0KH 5IOPA 1WBYB 3LMJL 4YHZH 3T1FA 2Z8RA 3ZDZE 1WWAX 3TNMB 3WFZA 3IAPA 4PJ9C 1P84K 1ZHKA 1EHAA 1AJ7L 5BV7L 1DTUA 4MD4A 3SGJC 3WIHA 1OPGH 1IKFL 4KMTL 4UOW1 5GZOD 1FSKB 1RHFA 5TE6H 3L9RB 1TJIH 1QQDA 4PJGB 5A16B 3KYNA 3BP4A 5LVEA 4ZSOB 1KJ3H 4FQIL 2ITCB 5CP7A 5AD0B 1B0WA 1GPOH 4NN6B 5C0GB 3BGFB 2ENSA 1JGEB 1INQA 2B5IB 3GSRB 1FJ1B 4XBPB 3IDIB 3VFUA 1HXMB 3KLSA 1U8IB 3GHEL 1S7UA 3DOSA 2VXUL 3NA9L 2V2TB 5IW3A 3ZHLA 1EEQA 3BZ4B 5AG9A 4W4OA 4HS8H 4WEUD 2JJSC 2IPKB 2VTFA 4KK8D 4Y5VC 5B38B 3N85H 5DRNB 3TNNB 3NIFF 3QDJD 3C09C 5EU6A 1QSFD 3MJ7A 4Z18A 4S1DC 5I66A 1XF2B 5GRUH 1A7BA 5HHXH 1MJ8L 4HK3N 4Z7QE 2DBJA 4JM2C 1MOEA 1T21A 4L4TB 4ZPTA 3EYFA 2CDGA 1ZT4B 4L4JA 4RAVA 3SBWA 5T3ZD 2C3VB 3V7AE 3MFFB 3E1F1 2I25N 3FB8B 1AHWB 4LLUA 1RZ8B 2YD1A 3PJSB 3MLRH 4UTAH 5I17B 1A1NA 1LILA 4GRMA 3JWDC 4JR9H 5D7KD 3ECBB 4Y0GA 4I0CC 4JFPB 3IDGA 3ZL4H 4AENB 1CDGA 2Z31C 3D85B 3SDXF 1F4XH 4LP5A 1I8LC 5IESH 4CU7A 4Y4KC 3PQYD 4RISL 4F9PA 5C6TL 1WUNT 5GGRA 2MCPL 1M4KA 5C09B 4AMKL 1EDQA 4LRNL 5L6YL 3EW3B 4PV9A 3WUWA 4QF1A 1QUNA 3FFCA 3OKDA 4X6FB 2DIAA 4JG0H 3G04B 5JOFB 1C5CL 1YMMA 4LCCB 1N8ZB 1C12A 3VU2A 2FJGB 1BEYL 3MMEA 3F7QA 3QUZC 3S3JA 1K2DB 2CKBA 4KMQA 1HH9A 2EYSA 4DK6A 4UI2A 4CADA 1BM3H 4XB8A 3T0EC 4RGNB 4XI5D 1C08B 1DJSA 1INEH 4ONOA 5F21B 4OT1H 3ILPB 1OARL 4P2OA 2W9EH 4XMLH 4FA8A 4PJHA 1KCVL 3BE1L 4OZIB 1X7QA 2PYEE 5C0AB 4BQ8A 2DLGA 1X44A 1P7HL 2CK2A 4UNVA 4KGLA 4G8GD 12E8L 3QI9B 3F7VA 4R8WL 4F8TA 7FABL 4M5YH 2BJML 1GGBL 2YC1B 2G75B 3MODH 4Z7UE 2VLJE 5SX4I 2FSEA 4NFCA 4KZEL 5FGSA 3BRDA 3BISA 3RWIA 4HUUA 2GJZA 3QUYD 1NGPL 5GXBB 3UO1L 4MCZA 2AJUH 5DLMH 2P24B 3GJFB 1BZ7B 1ND0A 1AI1H 2OP4L 2H32H 3GMNA 4FS0A 4QTHA 4R0LA 4TYUA 1IGTA 1H0DA 2OZ4H 5BVPL 3HNTL 3P9MA 3RIFF 3VD4A 1CFNB 1G9MH 3HAEB 5FEBA 4PJDF 3S35L 2E9IA 4KUZH 1BECA 3QXUA 4X6CB 2E6JA 1FFOB 3U4EB 5JIPA 4YXLL 1BVLB 1S7SB 1NCBH 1QNZL 2WZPD 5K9OA 1JI2A 1NMCC 4N9GA 1FV1A 3CNKA 4ELMB 3NPZB 4PY8I 5L2KA 4NBZB 3NABH 2P8MA 3KS0J 5E95B 5TDNB 3FTGB 1F00I 4X4YA 1DQDL 3GSNA 4PG2A 3H9SB 1S7TB 1CGXA 5IROC 1EZVY 5KN5A 2EDJA 1QPXA 2BK8A 2AJ3B 1ES0B 2E8YA 1N6VA 3HUJA 4WFGD 2CRZA 4LVNC 4ENEC 3BWAA 1YA5A 1H3UA 2VWEE 1JZ3A 1WFOA 5IQ7H 5KZCB 4YDLC 4JO2H 2XZCL 2FIRT 1I7TB 4QRUB 3C5SB 1FFQA 4JHZA 3WFHB 2I9LA 4K3DL 4RGMC 2GQHA 5EU6E 4XP5L 2VR9A 3DUUA 2GJJA 3F7RA 5D7SH 3LKOA 3HG1D 2BFVL 1K3ZA 4KPHH 4HS6B 4J3UA 4QRRA 5JZ7D 1GSMA 4NCC2 4DW2H 2IBZX 3AREA 4FABH 1YDPB 3S36H 3ULUH 2DYPB 4Y4FD 3QIBD 4YLQT 3LQAH 4FXKB 3RWEA 1ZLVK 1XF4A 1TQCB 2Y4SA 2R4SH 2JCCF 5D7LD 3CSGA 4GAFB 4X7FC 5BRZA 4G6MH 1MUJB 2V17H 4MNHB 4NO0A 1GC1C 1H8OA 3LKNA 2CXKA 4XCEA 1VSCA 4PRDA 2OL3B 5BS0B 1N59B 1A4JB 2VZ3A 4LL9A 1PG7X 2QJDA 5E5UB 4N0UA 1CS6A 5I1AB 1KELL 5IGXH 3QEQB 3H42L 4PJIF 1T7WA 1FAIH 3OJDA 5FGBA 1YMME 1JF6A 1JJUA 4FHBD 5C0DA 1BLNB 1TZIB 2A9MH 4PJXF 3BJ91 4LPXA 5IB5B 3DYOA 5C86A 3QYCA 1YYMH 1KIUA 4G9FA 4U49A 5CJOH 4I0PD 2GIYA 4PRHE 1ZT7B 2P8LA 1EIBA 1KN4L 1GOGA 5I16B 3VXSA 3FRPA 1UWEL 1DSFH 3VA2C 4YHPA 1HHGA 5EO0A 1HILA 3NFSH 2A2QT 5B39B 1N6QL 2AAVA 3REVB 4XVUC 4K94C 4V1DA 4N8VB 3TVMA 3C8KB 1KT2A 2IH3A 1IGYB 3GO1H 3STLA 3JWDL 4EBQL 1NH6A 3W9EB 1KIQB 4OM0H 2R9HD 5JR1H 3G6DH 3QHZL 2H2PD 4IS6B 4PFEA 4X7SH 5C9JB 4IOSD 1U6AH 1FDLH 4GG6F 1F58L 3CXHK 4W6WB 4ONFH 4MJID 2Y25A 3P30L 3VRLE 5KS9A 1BREA 1SEBA 5F7HA 1OT1A 2AJYH 1C8PA 4KTEH 4X4XA 1RSFA 4LSSH 4YC2C 2G60L 4OZFH 4QRPA 2NY1C 3MRCA 1MY5A 3PWNA 3PWVA 4JDTL 1JNNL 3CUPA 1Z9OA 3MZGB 5GQBA 1IEHA 3OKLB 4OZGE 5CS7A 4G3YL 1GYAA 1QP1A 4Z7VA 2X1OA 3IDNA 1YPZF 3BKJL 3WFEL 4FRWA 3S96B 3VXOB 5L2KE 4J3SA 4P5TB 4XCFH 4K7PY 5F3HA 5CEZD 1QVOA 2BMKB 1J10A 1E27B 1J1XL 4WW2A 2XI9A 3VRIB 3VH8B 4AEIL 1M71B 1NBQA 4L8SC 4CNIB 1S7XA 1Q0YL 3QAZB 1VACB 4S1SL 3PGDB 5EUOB 5FO9B 3OSKA 4Z8FL 4O51B 4U1MA 1P9MA 4PRPE 4ZTOL 2AJXL 3WKMH 1KTKE 3WDIA 3IKKA 1GGCL 2DMKA 2XTLA 4KDTA 4X83A 2CMRL 4P46B 2GJ6D 5T1MB 4HZLB 4NZDA 4MXWL 1JCKA 4GKOA 2EC8A 3O6LL 3QG6B 4UT9H 4XB7A 1AXSA 3T2QA 3A6CH 2BNRB 3QDHA 1SMAA 3ZKMC 2ZWLT 4OCRL 3FCTA 1RIUH 2IALA 5IF0A 3IS1X 5TQ2L 4NO5A 5DUMH 3VWJD 4S1DD 5GJSH 1NAML 3MNZA 4Z7NF 4F37K 4P2RD 4ZS7L 2OK0H 5DUPH 4M48L 3SDAC 4D0DB 4G8EA 4S0SD 2AXFA 4N9OB 5D2NB 3CFIC 1S5HB 2AXGA 3VXRA 1L6ZA 1RZJL 1MHHB 4G7YL 4N0UE 3TIEB 5TFSL 4JPWH 5I8CA 3MLZL 3CVHH 4WIQA 2OSLA 4Q6YA 3P9LA 5EU7C 1ZLSH 1PBYA 2Z31D 2BVPA 1WIUA 3MR9B 1U2HA 4Y4KD 1E6OL 4O9HL 2X40A 4Q9RL 1W72L 1C16B 4ZQKA 3BPLC 5J6GA 2VZTA 4OUOA 4NGHH 5DMGC 4G9FE 5I74C 5ILTL 4F57H 1EEZA 1MIMH 3P40A 4RNRA 3V6ZB 4OKVB 4M6NL 2QQLL 4HLJA 1LO3L 2QSTA 2JKXA 4JFXA 3MLPA 3RL1B 3VXSE 3QUZD 4QXWA 4J1UA 5CJQL 2CR3A 2VABA 2JF1A 3DX7A 4MXVE 4JFOB 1WWCA 4NN7C 4OCYH 2MPAH 3VFGH 1MCSA 1RPQA 2VXQL 1FAKT 4V1DE 2IGFH 5SV3A 2EDXA 1UM4H 1HDMA 1U8HA 4XCNB 2VZSA 3QUXB 2VIRB 1T6WA 2AJSL 1MCHA 3U0WL 3KPSB 5I1EH 2E9JA 3U46A 3GMLB 4HAFA 4X7TB 1MFCH 4M7LT 4XPFL 4L1DA 1LK3H 2FD6L 1A7QH 3KPOB 3FMGL 1T04B 4MA1B 3RWFB 5DQ9B 2O61B 4PJAB 4XMPH 2Q7NA 2HLAB 5FGCB 4P9MH 4U1JB 3V52L 3HNSH 4IMLA 5KVGH 5KJRL 3ARGC 1WCBA 5TGBB 3SDCB 4KVCH 4JQIH 1CZ8L 1T1ZA 4Z77A 3BH8B 1ADQA 1G7QB 2WANA 5JNYA 1V7ML 1OSPH 2CJUH 1NGXB 3I84A 4DCQA 3JSSA 5GSRA 3QXAA 3EYVA 5ETUA 1FZOA 1ZSDA 4Z7VE 2XQBL 1XCQA 3OV6A 3QUMA 3WIIH 2EDFA 3HC4L 3UBXB 4KKNA 15C8L 5KSBA 4P57B 3C60B 2EE6A 5EO9A 1K9TA 1KLGB 4CVWA 4GW1B 1JNHB 3VFSA 5GS1A 1WEJL 5H2BB 4LQFH 2VOTA 4CVZA 4XH2B 5DJZA 4EKXA 3EUUA 1SM3L 5EBLA 3BD5A 4HIXL 3AU1A 3PDOA 1FVCB 4MA8H 4JEGB 1CXEA 1LWRA 3PWLB 2RCSH 4PLJD 4UUJB 5D8JH 2QHRL 3ZDXF 4LSRL 3PNWA 1QPPA 4F7MB 1AXTH 4UBDC 1FL3A 5HI4C 5HDQL 5CLTA 4YFLI 3B2VH 5E6ZA 1E6JH 3K7UA 1IL1B 3QULA 5DO2D 1PX4A 4ODWB 4ENED 1OP5K 5F3BA 4NNPL 2NY2C 1ONQB 1EJ6A 1MQ8A 4QXTA 1ULVA 5LCVL 2F9BT 4KI1A 4Z0XA 3RZCC 1FZKA 3HKFA 4NHUB 3H7LA 4E41A 1CFVL 5J9PB 2QKIA 5HY9B 5JPMB 2VISB 3ZZ1A 5ICZB 4LVOB 3BVNB 5F7LB 3EOYG 3GB7B 1DL7H 1HZHL 1JNLL 3QFJD 3CPLB 2BSTB 1Q9WB 1X5HA 4L8CB 3MGOB 4P3DA 3MRQA 3BW9A 3MPCA 1IM3B 3VFPB 4GAGH 1A6UL 3WS3A 2NX5D 3W0WA 3DI2B 4NRYA 4ZFGH 3EDJA 4X98B 2O5ZH 1YEIL 1VGEH 4H88L 2I5YH 4KV5F 5SV4A 4ZDHA 3CLEL 2R2BB 4OD1L 3SKOB 4RAHA 1FYTE 4HS8L 3O8XD 4GMTH 1SY6H 1E4KC 5GHWL 3KNBB 3TNMA 4QHKI 3C8DA 4AIOA 2HFEB 3VCLA 4KVNL 2V2XB 1G7LB 3MV9E 2RFXB 4GSDL 5A16A 2GSIB 2XPGA 2ITCA 5DGQA 5AD0A 5C0GA 1JGEA 3GRWH 3KPTA 1UYWH 5FUCC 3GSRA 1FJ1A 4GKSB 1NCCH 3PWJB 4UB0H 4Y2OA 4I18C 4YDVB 1AD0A 4R7NB 4EOWH 1G6RB 2YWZA 2WSKA 3WIFA 5C8JB 3MSPA 4WUUE 3WJJA 5HHVL 1QR4A 1CL7H 4OBRA 4XNYH 4JR9L 5ICXB 3BIBX 4LVHC 4AEEA 3QHFH 3ZL4L 2FWOB 3C2AH 1E4XH 1VFBB 3BZ4A 4ZD3L 1G84A 4LCIH 3B9KB 1F4XL 2EH8H 4XVUD 3AFLA 5E8DL 2IPUG 4YHIA 2CD0A 2IPKA 1CD1B 4FNLL 2Z93A 1N7ML 5B38A 3TNNA 5DRNA 3RX7A 3QDJB 4OI7A 2HTLC 2K9UA 1QSFB 3WD5L 1LD9B 3V4VL 4FFYL 1XF2A 1AGFA 1M05B 1T1XB 2DQEL 1K8DB 5JPNB 3PXJA 3BZDA 2XA3A 4L4TA 3SCMA 3B8SA 2ADGB 1FVEB 5FUOH 3PABB 1ZT4A 3CXDL 4YIQB 2C3VA 3G5YB 1GGIH 3UEZA 3MFFA 5EULV 4JKKA 5HGAB 1AHWA 4WY7H 5I17A 3CDGB 1U92B 2QQKL 2DQGL 5DD3L 3ECBA 2VDQL 1B3JA 5J3HC 4JFQA 1LEIB 5FHBH 1R24B 3D85A 4KROD 3ABZA 5TF1H 3PQYB 2AV1B 1F11B 4JCLA 3C5ZD 5C09A 2YKLL 3O2DH 2GT9B 4JY6B 2QR0B 5KSUB 5KVEL 4PRID 3G04A 5JOFA 4F9LA 4LCCA 3VG9C 5C0BB 2CK0H 3D3VD 2GTZB 1K2DA 4NDMB 4D9LH 5ALBL 4YXKH 5I1GL 4YEEA 3WIHH 4N5ED 5CWSB 3NACL 3NCMA 3MRGB 2VZOA 2MMXA 3PL6A 4K23H 4R4BB 1HH6B 5I1CH 4JVPA 3QEHB 1XH3B 3WFCH 3DMMA 3ILPA 1UJ3B 2HKFH 4R7DB 5BV7B 4E41E 2LABA 4JAMB 2NZ9C 5C0AA 4YXHL 5DRXB 1G9ML 3GSXB 1NCDL 4G8GB 4QYOB 1TCMA 4TQEL 3ZKMD 1DQLH 3F58L 3MX0A 4TTGA 2C9AA 4OF3A 3MOQA 1B6UA 5IG7A 1NQBA 4WFHD 4IHOB 4FTVB 3SOBL 1NEZA 5KOMC 4LMQE 3DPBA 4L1HA 1OTTD 3SDAD 3F7PC 4K7PX 5F9DC 4DGYH 1LK2B 1JPFB 4YHMH 2AK4D 4MS8C 1IT9H 1FL5B 2P24A 3JUZA 1BZ7A 3MV01 1MH5B 4WV1B 4XPAL 5IFHH 2FECI 1D9KB 5DMJB 5F7MC 5KG9A 4JO1L 5MEPB 1IJ9A 5J6HB 1CFNA 3UXFA 3HAEA 5DMIH 1C5DB 1BQSA 1ZS8B 4PJGE 2IPTL 4ODTL 4ZSOE 1FFOA 3U4EA 1S7SA 4QHNB 1OAXL 5I75C 4ELMA 2BDNL 4Y2DA 4GRLA 3UTOA 1MJ7L 5TDNA 4HIEB 3FTGA 1KJVA 5JIKA 2D2OA 3H9SA 1S7TA 4W6XB 4D9RD 2GSGB 5J56B 3TBYB 3LEXB 5F9JB 2F19L 1MCBA 1F4HA 2W1NA 3A67H 3KXFD 8CGTA 3OPZL 3MRBB 4QGTA 1U0QA 9CGTA 1HYSC 3QDMD 4LRIA 3FT2B 1PX3A 3BSZH 1I7TA 3C5SA 3RDTC 3S98A 3OGCA 2CKBH 2YPVL 2XQYK 5D1ZB 4GUPB 3LH2H 2YMXL 5I1LB 3ZKSD 3TZVC 2FHCA 4L9DA 1GGTA 2X9XA 4YWGL 4HS6A 2DQTH 3GIZL 1UT9A 3U7YL 1YDPA 4L4TE 4NQED 1G7MB 1BAFL 4Y4FB 3QIBB 1S9XA 1YYML 1FGNH 4FXKA 5DJ2B 1BJ1J 2G2RB 5CJOL 2YPLD 2F53D 3SQBA 1IGMH 1J5OL 5CINH 4JY5H 1MUJA 3AAZA 4MNHA 3MUGB 4MJ4A 1MFNA 5DUBB 2XZQH 2C4XA 4LIQE 4HPYL 2OL3A 1GOHA 4NM8H 5BS0A 4L4VD 1A4JA 5C09E 1MI5D 5I1AA 3I6LE 4OGAD 4L3CB 1MWAL 1HI6A 3SDXB 2AEPH 1A7NL 2B2XH 5LBSL 2Y9RT 4ZPVA 4YBLC 5C0EA 1CDJA 2NY0C 1ORQA 1KN2H 1BLNA 1TZIA 1U9KA 3ESVF 4S1RH 4AEHH 4TUOA 4D3CL 3OR6B 5IB5A 1BF2A 1KXVC 4RGNE 3MFGB 1PKQA 1E4JA 3A6BL 2EXYD 1V3JA 4I0PB 5GGUA 1BGXL 1SMOA 5HSFA 1CFQA 1ZT7A 4HXBH 1A6TB 1FLRH 4LSSL 5ID1B 1RJLA 5I16A 1OCWL 4UINL 4UBDD 4OZIE 5C0AE 4UU9B 4KJWC 5B39A 2NY3C 4LSUL 4XPTL 5HYQB 3I50L 3REVA 2I9TB 3CFKB 1HNFA 4M6OL 3N1QC 5HHMD 1SBSH 3N1FC 1WIOA 3C8KA 1D5XA 2WBJB 4LNRB 3VW3H 1IGYA 3V5HB 4NQUA 1J05A 3W9EA 2FJFB 5B8CC 2ZJSH 5CILH 2EKSB 3RI5K 1BQLL 1I9RH 3QDGA 5EOTB 5C9JA 3MREB 3BPNC 5T1DL 3KYOB 1DBJL 4LLMB 5IMOB 4WI7A 1OM3H 4AZ8A 2XKUA 5J13B 1FNSH 3EJZD 5DQDH 1J8HD 5D1QC 2DKSA 4LSQL 1IAII 4NSKA 1WJ3A 2X9YA 3BJLA 2CXGA 3STZA 2OXHA 3OAZH 4V2CB 3QCVL 1EV2E 3TT3H 5C3LD 3OKLA 4X6CE 4NKIH 3P3YA 1Q0XL 2B4CC 3RVUC 4UAOB 4I3SL 3EZJB 1J1PH 3BP5B 3DO7B 3SDYH 4ELME 4PJDB 3QXWA 3S96A 3VXMD 3VXOA 4P5TA 3PWUA 3WN5C 1M7DB 5DUML 3H9SE 2W0KA 1QHOA 1FIEA 3G6AB 2FYYB 1E27A 4WJ5A 1I9EA 1IC5L 3L7EA 1JHKL 2E5EA 2OR9L 3VH8A 3VRIA 1M71A 2K7QA 4JFFA 1CT8A 4CNIA 6FABH 1TIUA 5JXAH 4KKBC 1VACA 4GH7B 1ORSB 4I2XB 4O51A 4LASL 2K1MA 5HYIA 4ESKA 5ACMA 1F6FB 5DJ8B 1CQYA 2AGJL 5T1MA 2GJ6B 4HZLA 4KJPC 3BZFB 1ZLSL 3TA3C 1UZ8B 3QG6A 4TSCH 3BDXA 2BNRA 1IRAY 1I3GH 1S7VB 2HAZA 4Y5VB 3BX7C 1FYHB 1S9KC 2CRMA 5DD6B 1ZEAH 4BH8A 4MDIA 2HTLD 3VWJB 1JPST 2ZOKA 3LEVL 1GCFA 2APWA 4KRPC 3LQZA 4EIGB 1T3FB 4P2RB 1XGUA 1CFTB 3QCTH 4F37F 4D0DA 5JOPD 4NFBA 2BSSB 4Z6AT 2FX7L 1S5HA 2JCCB 3DURA 2XV6B 5BS0E 3U48A 2DIBA 3U83A 3KLHC 3TIEA 2ZUQC 4K7PH 3LS5H 4WU7A 3QEQE 1K6QH 5D93B 3D1MC 4DZ8B 4DGVH 4NWTL 5J3HD 2YEZA 4RX4D 4XNMB 4Q9CA 2APBA 3MRKB 4TOYH 4XXCC 1XIWD 3MR9A 1RUQH 3CZJA 2I27N 1O7VA 4OZHA 3CK0H 4BUHA 5F9WB 3KLDA 4PJIB 1ZHBB 2Q1EA 4RBPK 1B4JL 2Y23A 3IDYC 4M7KL 4JGJA 3RJQB 3FB5B 5FM4A 3DRQB 5HVGB 5C07A 3V6ZA 4NHCH 3UPCA 2I60H 5MI0B 2CLVB 1NUDA 1HSAB 1FLTX 3QUZB 1P6AB 5JW3L 1T0NA 1K5NB 4YDIH 2Y36H 3CFCH 2D03L 5GJTL 1OSPL 3V5KB 5K59E 4FQ2L 4EVNB 4KQ4H 3HZKB 4XCNA 4D9QE 5E99L 2RIKA 2VIRA 3MOAH 4O58L 1U8MA 2JJTA 3L6FB 3KPSA 5FDYA 4ZUWB 4OM1H 2NZ9D 1ERNA 3GMLA 4AG4L 3CU7A 5C70A 2JIXD 5HPMB 5BCAA 4WENB 5I0ZA 1LE5B 1UQSA 4L5FH 2FB4L 5JHDB 1WK0A 3RX8A 2UZIL 1T04A 3RWFA 5DQ9A 4LQFL 2O61A 4OLVL 4AIZB 3GIVB 1CLOL 5GS2H 3WS6A 2Y07L 2OM5A 1AQKL 4GG6B 2QSCH 4EN3A 5TGBA 3SDCA 3V95A 2A74B 4N0FA 2E3VA 1AGCA 1CICC 1A0QL 2A9NL 1KEGH 3BH8A 2GKIA 3AC0A 1G7QA 3NCCB 1NGXA 3P0VL 3CSPA 5DRWB 25C8L 3F8UB 3VXPA 4ODVL 5D71H 1NCTA 2LE9A 3E8UL 3QISA 4R6UA 1FL6B 2OS7A 4HDIB 4P0DA 3WSQL 1A6AB 1AKJA 2DLIA 5L0QB 2NXYC 3RTQD 4P57A 1NAMB 1SJXA 3T2PA 1YPZB 3SPVA 5SX4H 4OTXH 4GW1A 4IRJC 4KTYA 1JNHA 3ALXA 2DQHH 5H2BA 3JVGC 4HS3A 4XH2A 1LO0H 3EFDL 5EUOE 1AGEA 1FVCA 4JZOA 1KENL 1RZGA 4Y5XB 4M1GH 5F9OH 3PWLA 1UEMA 2J4WH 3C08L 1AFVL 1P1ZB 1AC0A 1I4FB 1FN4B 5T33H 3L95A 4F7MA 1LDPL 4ZFGL 4BFIB 4O2CB 5IVXF 5F7EH 3JV6A 4PJ8C 1VGEL 4LCUB 2ICES 2M26A 4ODWA 5C0ND 4IRSB 4F2MB 3MCKB 3PP3K 2BNRE 1HYSD 3MJ6A 1W72B 4ODSH 1ONQA 5ID0B 4P59L 4GQPH 1UZ6E 4GMTL 2B7DT 2HFTA 2VDRL 4U0RC 1AIFB 1NBYA 4NHUA 1GXEA 1RI8A 4HUKB 5JPMA 2C4FU 2VISA 2R1WA 5ICZA 1F4AA 3BVNA 3W39B 2GCYB 5DTFB 1P5VA 4HJ0C 5D2NE 4PLKC 2HFGH 1I3RA 1TVBB 2FZ3B 3GGWA 1FP5A 3CPLA 3NCBB 3MCG1 3NTCH 5EBWA 2XKSA 3MO1A 3MV11 2VXSL 1IM3A 5ABDE 1OAKH 4PJEB 2NX5B 2ESVD 5E5MB 4GAYA 2PN5A 2IAND 4DWHA 3ARFD 1UACL 4HH9A 4LP4A 5AWNH 3UDWC 4HJGB 4YK4B 1EO7A 1FC1A 5MP6H 1TZGL 3RL2B 2OYPA 3QCUH 5J1SC 1H5BC 3KPQB 2XWTB 1HINL 4OFDA 4LCIL 4XBGA 3O8XB 4G8IA 4LLAA 2WK2A 2X5PA 5TF0A 4HW6A 1G6VK 3X3GH 5FUZL 3V7MA 5L9DH 4X4ME 4K8RH 2HFEA 1HHJA 2NY0D 2V2XA 4QXUH 4M6ML 1L7TH 2M1KA 5FYLL 2BY3A 3QUMH 2RFXA 2DI9A 1LE9B 2GSIA 5FDWA 4LNVA 3N9GL 3W2DL 2VKWA 3OB0K 1KIPB 5GRXG 3VA6A 2WM0A 4YZFE 5IQ9B 2VDPH 4GKSA 3PWJA 4YDVA 4R7NA 1REIA 4FFWC 1G6RA 1TVDA 4Q6IC 5DJYB 3RWHA 5FK9B 4WY7L 3KPSE 2FCBA 2A6IA 4HWNA 1WT5C 4JLRB 1EHNA 3U30C 4DKDC 3W81A 3MLVH 2FWOA 4LGRB 4N0CC 3KR3H 4P4KC 1VFBA 1CE6B 2FR4B 5IJVB 4W68A 4M00A 2HTKC 1U42A 4OQTA 3UJIL 5TF1L 3HMXA 4PJAE 3OWEA 4XMKL 1DBBH 3VXQA 5FGCE 4XWGL 3PXHA 3QDJA 2W0PA 1QSFA 3ZTNH 1YJDH 3SGEI 4XCCL 2V5TA 1M05A 4G6KL 1T1XA 5F6HI 2LVEA 1K8DA 3ALPA 5CGYC 4X6EB 3HHRB 5D5MF 3T04D 1J88A 4NPYB 1G0XA 3RWJB 3VFTB 1CF8H 4Z9KB 1CCZA 2ADGA 1FVEA 3ZMRA 4YIQA 5E94B 4YXKL 1XGYL 3G5YA 1P4LB 1RURH 4XWOD 4YDKL 4WVRA 3WNKA 4JN2B 4YC2B 1JGUL 5D1QD 3G5VA 5HGAA 2CDFB 4BM7A 1MFDH 1U92A 1YNLH 3ZDYF 2P46B 5ACLA 5KSVB 3L5XH 2R29L 1JWUA 5T3XH 4DGIH 4KROB 3UTPD 3PQYA 5C9KA 2OTUB 2AV1A 1PG7W 4IRZL 3KYMB 5EOCH 3C5ZB 3UTSB 3R1GL 2BX5A 3QO1A 1T0PB 5BO1L 1DQLL 1F2QA 4MB4A 5D1XD 1F2XK 5KSUA 1H8SA 4GAJL 4NZTL 4PRIB 1ODAA 4Y4HC 4BKLB 1QFWL 5KVFH 4XGZA 3D3VB 4NDMA 1AD9B 1CXIA 4KK6C 2W65B 4KKBD 5AZ2L 2R0WH 2OBGA 3MRGA 2P44B 3ARBD 5D6CA 2YSSB 4R4BA 1HH6A 3QEHA 4Z0BL 3KVQA 4PB9H 4OCSH 3RWDA 2AXJA 4JAMA 5JHLL 4KJPD 3VGHA 1AQDB 3TA3D 4PJHF 2HKHL 4XAWH 3WO3B 1QFOA 4G8GA 4LCWD 4QYOA 5HVHC 1P2CB 2VC2H 3MJ8A 2H6PB 3I3DA 2EE2A 1UCTA 2CGRL 4IHOA 4KRPD 2C4FT 3MLUH 1EXUA 2FO1A 2XYCA 2CUIA 2FRGP 1FPTH 1XGQB 4LK4A 3SDDD 1BFVH 1A2YA 3QUYA 1LK2A 3HRPA 1DP0A 1HCFX 2AK4B 1JYXA 4B5EA 4CN6A 1JZ2A 3KLHD 2MQ0A 3EYOA 3H3PL 4WV1A 4QGYA 5E2VH 1BHGA 3V0VA 1JE6A 4F7CA 4P49A 4CMMB 5I15L 4I8DA 3LH2L 5J6HA 5CZKA 2WUCH 4QEGA 1ZS8A 3QJHB 5E8PB 1IKNC 3NIDF 4QHNA 3IFLH 3TBSA 2QL1A 3VI4F 1P7KA 1WBZB 1CK0H 3P0YL 4HIEA 4LIQH 2R69H 1IAKB 4MYWB 5F89B 1QHPA 32C2B 4MB5A 2GSGA 2GI7A 3LEXA 4R26L 1R3LA 1QFPA 1U8OB 5DVLA 3WUZA 4LHQB 1OY3B 3KXFB 5KANG 2G5RA 5SWQA 3MRBA 5CD3A 2FHFA 1R3KB 3QDMB 3HUJF 2XY1A 3FT2A 4NM8L 3UROR 2COQA 1CGSH 4OLZL 1OGTA 5KSAD 2DF3A 3V4PL 3QDJE 2F5BH 1WZ1H 4GUPA 1QSFE 3DO3A 4MVBD 1EO8L 3HG1A 2IAMD 1B4RA 3MGTA 4MMZC 4FQXC 1JV5B 2BNQB 5LAXB 5C0RH 4NQEB 4R90L 3X14B 1G7MA 3EJYC 4Y4FA 3QIBA 3TYGH 1JGDB 3WFDH 4J23A 5T3ZE 1DANU 5DJ2A 1JGLH 3WNMA 3MLSL 2YPLB 4MWFB 2F53B 1QBAA 2IBBA 5D7LA 3WE6A 5D7KE 1CICD 4BZ1H 3KGRA 3ZLQC 2NY5H 4HGKC 1XR8A 3MUGA 4A2LA 5C6PB 3VWKC 2QTEA 4Q9QH 5DUBA 3UAJC 2VRAA 3Q6GL 5L8KB 4OGYL 3PQYE 5FA3B 4L4VB 4ZXBC 3GSNL 1YEFH 3D2UD 3JWOL 4PGBB 1MI5B 3HI6H 4X80L 3RWCB 4PGEB 3RU8H 2ADJA 5KVMC 1MAML 4HFUH 3O45B 2J6EL 3LN9A 1A6ZA 1IGIL 2EDYA 1P69B 1IGCH 1NLDL 5DF0A 3V6FA 3W9DA 3JTSA 4OF5A 5IBUG 3GJFH 5C0BE 3MV8D 2YK1L 4AEFA 2XTJB 3OR6A 1LNUB 1W0VB 1U58B 5D2LF 1UM5L 2R1YB 4NZRL 4F33B 4XX1E 1CDHA 3V4UL 2BP3A 3HAEH 1T20B 4I0PA 3ILQD 4S0TD 1INDH 1UWXK 5DQDL 1A6TA 4JJ5B 5ID1A 4PYGA 5MHSD 5I76B 1A7PH 1DFBH 4YQXL 1CBVL 5FECB 5D70H 4P3CH 4PJ8D 2BVQA 3FO0H 3FL7A 1BWMA 5L8LB 5H37G 5HYQA 3GBNH 3KPLB 2J88L 4G8GE 2I9TA 1KPUB 5HHMB 3SE9H 4LNRA 3TPUA 4BK4A 2IG2H 4RWYH 2H41A 3V5HA 2WBKA 4WFED 5BZDB 2FJFA 3RA7L 3S5LB 4EDWH 4FTVE 1OGAD 4NOFA 2EKSA 1N5YL 5IHUH 2IBGA 4O4YL 5EOTA 3DIFB 1IEAB 1FE8H 4LLMA 4NP4H 2ZG1A 4I9WD 5IMOA 3RI5F 4CMHB 4HJ0D 1T89A 4PLKD 4MJIA 4U3XA 2EDEA 2VLLB 5F1IB 3LD8B 1BQHG 1J8HB 1KXQE 4OJFL 5C0CD 3I6KB 5KS9F 1IQDB 2MSPA 3LRGA 3EYUH 1YNTA 1BX2B 4OI9A 3RNKA 2Q76B 5LGJB 4JHWL 4YR6B 2XICA 2BXYA 4P48A 2P43B 5E2UH 3BP5A 3DO7A 4D0BB 3Q6FB 3QFDB 1W0WB 1XGPA 1ZKAA 2D31B 4PJDA 3VXMB 5IFAH 5K9JH 2D7OA 3QXTA 2OQJB 1GGUA 4H1LG 2OL3H 4ONHB 3SGJA 2OMBA 2ZUTA 5CJ5A 1GRWA 4OD3L 2HH0H 3CAFA 3QG7H 4C83B 2XRAL 3G6AA 3B5GA 2FYYA 5IBTH 5ICYB 4JHBA 4OAWB 3OMZA 5HYJD 3D87B 4WFGE 1TLKA 3FJTA 1MHEB 3SN6N 1ORSA 4PR5B 4I2XA 1QFUL 4PJ7A 1RZKH 2IFFL 1IC4H 3OHXB 4U1SB 4U1GB 4U2ZA 5IHLB 5JXEC 3ULUC 3LQAC 1MWAB 1NFKA 3K2MC 5KTEL 2GJ6A 4KHXL 4TOYL 1VKXA 3NIFE 4R9HA 2ENYA 4YGVB 1S7VA 4J3TA 1Q9OB 3VFMB 4Y5VA 1A7OL 4DN3H 2FEDC 2W60B 4JPKH 3GMPA 1JF5A 3VWJA 1NPUA 3MUHL 4NHCL 3HFML 4P2RA 4W4NA 5CGYD 4LSPH 1S9VB 5DVMA 3V8CA 4TPRL 5EA0H 2BSSA 3O6MH 4YDJA 4N8PA 1NFDA 2DD8H 2X9WA 2LTQB 4HWZB 2K3TA 1OD7A 3MRNB 4HQQH 5I1IL 3I6GB 4X7CC 3TBVA 5HHQB 4HCRL 1D6VH 3TN0B 1HKLH 3H9HB 1MCPL 4KTDL 3SDXE 3ES6A 2B8OT 1MIEH 4DZ8A 1XF3B 4O00A 4JFED 1JTPA 4XNMA 3O6FB 3BP6B 3MRKA 2Z31A 5EBMA 1XIWB 1QSED 3VMNA 2XOTA 3GI8L 5KW9L 2DQDL 4PJIA 4Y4KA 5BMFL 1ZHBA 3MJ9H 3AXLB 2HT4C 3HZMB 3IDMB 1LO5A 4PJXA 3HB3C 3FB5A 3RY6C 1A6VL 3DRQA 4G6JL 4HWEL 2BY0A 2YA1A 5FF6A 1CLZH 3GDBA 3WFBL 3ZYOA 4WNQA 1HSAA 2NR6C 1MFEH 3QUZA 3MGAA 4HIIB 1NJ9B 4UDTA 3RGVC 5CHNB 4EVNA 1TNMA 2IMMA 3HZKA 3LPGA 4OLYL 1T66D 4K7FA 2D4DA 4TUJB 2AQ2A 3LS4L 4KKCC 3L6FA 4Q0XH 4TULL 3HPLA 3O41B 1R5VA 4ZUWA 1RUML 3CH8A 3VFVB 5HPMA 2BSED 2JIXB 1QYGH 4KK5C 5E9DB 1LE5A 1PZ5A 1EMTH 4X8XA 2DQHL 1CE1L 3S7GA 2DQJL 2WUBL 3NCYS 4JQVA 1BD2D 2DQFA 3VFRB 2QQQA 2KL6A 2A74A 2NW3A 1OAUH 2Z35A 3ZT7A 3U7WL 4ZYKB 4OSUH 2VQ1B 3JV5A 4JFYB 3P77B 4AL8L 1M7XA 3KWWA 3ARTA 2DQIH 5B4MC 2LVCA 1FL6A 1MNUL 3O6KH 1IZJA 4HDIA 4PJDE 3SE4C 3W5NA 3RTQB 5CBEA 3OAYK 3TWCL 3HI1B 1YPZA 4JQXC 1YEHH 5KSBF 5SWSB 4GS7C 4M43H 2ZSVB 3KPPA 1I7UB 4MNQD 2PETA 1MRFH 3VXUD 1SYVB 5GISH 1HK6A 4OFKA 4ISVB 1J18A 2VSCA 3F12B 5EUKB 2HFGL 2R1XB 4H8WH 4Y5XA 4I2XE 3IETB 5J4MA 3G08A 4L3ED 3ZE2F 4APQD 1L0YA 1DCLA 5FO8B 1FN4A 4KK9C 3D25A 5ALCH 1VGKA 1LP9A 4BFIA 4O2CA 3K74B 2GJ6E 4FOMA 2VH5H 3D0LB 4LSTL 3ZE0F 4F2MA 3MCKA 2J1KA 4PGCB 2YD2A 3GHBL 5ID0A 5F6IB 3WXVH 1ADQL 2XQYG 4RGOL 4R4FH 1AIFA 1PD6A 2UY7A 4UIMB 3MNWA 4P2RE 3DX8B 3MV7B 5DHVB 4N1HB 3V0WH 4FQXD 1L7TL 2GCYA 4Y7MA 1DLFL 1QLFB 4YHYC 2AK1L 1Q1JH 5FYJL 4ODHH 1UWGH 3LIZH 1JNJA 2JCCE 3EJYD 1TVBA 1JHLL 3QFJA 4XPHL 3WDJA 5T1LD 1GH7A 3SE8L 4NCDA 4O5LL 5FOBB 4GG8B 3CX2A 4MA3B 4U1HA 1N4XH 1S78C 3S3SA 3BN9D 3EIFA 3PWPD 4X99B 2NX5A 4G6AD 4WEMB 1CLCA 3RBGA 1WFUA 3ARFB 3KJ4C 1CD0A 4HJGA 4P5MB 3UZEA 3UAJD 1IGJB 3KPQA 1N64H 4BZYA 4PJIE 2X4OB 2XWTA 3BT2H 4ZXBD 4LDLB 4PS4H 4F58L 5LXGL 3ARDC 3O8XA 4WEBH 3FKUS 5IBLC 3FQTB 5EOCJ 4PBXA 4YBLB 4JFDB 1IGFH 3B2UD 1UB6B 2YRPA 4M93B 1H15B 5E2WH 1RUPH 1LE9A 3BESR 3VGAC 2Y06H 5CEYB 4PD4J 2CKNA 2F54D 2E27H 3SO3C 2PUQT 2JB6B 5DJYA 4XNUL 2NCMA 3L7FB 4JLRA 5I1DB 4NN5C 1B0RB 2FR4A 1YC7A 5IJVA 5JHDE 2VDML 1EJOL 5JA9A 3MLYL 3LV3B 4BSJA 3ZKQD 2DQUH 2Q8AH 1EA9C 4Y16C 3ZKNC 2X4RB 3ROLB 3FOMB 4ZS6D 1GAFL 4GG6E 1YUHB 5EOQH 3FQXB 1CIDA 1CR9L 2ICWJ 4NQSB 4X6EA 4U3CA 3QPXH 3RWJA 3MRIB 3VFTA 1EH9A 5LKNA 1I1FA 3KG5A 2IQ9H 5E94A 1OW0A 2Q8BH 3W5MA 4P5KB 2ATPA 4I4WB 1P4LA 5F8RC 4W81A 2P5ED 1GL4B 4JZNB 1MEXL 1Z0NA 1JWMA 1Z9LA 2Z0BA 1I1AB 2DDQH 5J89A 2NLJB 5EIIB 5EZOL 5FKAB 4BQ9A 4ALAL 4XP1L 2E9BA 2PXYC 1IVLA 1X6NA 1J0JA 1YPZE 3LCYA 5EC1A 4OCSL 4KHTH 3LN5B 1MCQA 1HN1A 1MF2H 2OTUA 3L3OB 3ISWA 3P4NB 4XAWL 1BBDL 5FYJD 3KYMA 3UTSA 3C5ZA 1MCOH 1J0IA 2G9HB 3TBWB 1X5XA 5TH2B 1R3HA 3PP4L 1JN6B 5D1XB 4M4RA 4PJ5D 5ADOL 5TE7H 4HGMA 4RWHA 5IBUB 5CZXD 2Z8SA 4PRIA 5AYUL 3WN5B 4BKLA 3U6RB 3E6HB 2YA0A 1S5IH 5GRYA 3D3VA 2MHAB 4PRAB 3MLUL 3FN9A 2W65A 2DI7A 1YEJL 1VEOA 3ARBB 1TPXC 2R0LH 2YSSA 4UT7L 5IVXB 3DX9B 5JXED 3TFKC 3IRPX 3SGKC 2QBWA 5ADPH 3L1OH 1YEKH 2DJ4A 2QHLA 2ATKB 1RIHH 1G6RH 2D4FA 4J8RB 4Z95H 3VDBA 3AY4C 4LCWB 4Z7NE 4MJ6B 1P2CA 5FYJU 2H6PA 1XF5B 2FEDD 5EG6C 3MYZA 3WNOA 3T77B 1EGJH 3MBEB 1CK0L 3LEYH 4PJEE 2X4QA 4OQTH 2NX5E 4LF3B 5DJ6B 1IM9D 3HMXH 1RUAL 3BKCH 4N8CL 1HOCA 1I7ZB 3SDAA 4OUUB 1NMAL 1UCBL 3SDDB 1S7WB 5HD8C 1DVFB 1BQHB 2IJ0C 2PYFB 2AK4A 5CUSH 3QNZA 4XC3L 1K85A 3HPJA 1GZQB 1QR1A 3NCFB 3KHOA 1S9WA 1GZPB 2Q3ZA 2ZUQB 3C6LB 1CDBA 1Y0LB 2J2ZA 3SQOH 2B1HH 2NTSP 1CGWA 3MBXL 5IB4B 2V5YA 3UJJH 4ORGB 5T3ZH 4UT6H 5EZIH 3IAGC 5SWZD 1T83C 1ZE3C 3QJHA 5E8PA 4WDIB 1I8KB 4KRLB 2HRPH 4H1LB 4UV7L 1ACYL 3HB3D 4E42A 3FO1B 3BQUD 1GIGH 2UZXB 4PBWD 4JM4H 4OCWH 4LSVL 4HWBA 5F89A 5HDBF 32C2A 1QQDB 2X6MA 3OKEB 4I77L 3S4SG 2NR6D 3OKMA 4B7IA 1U8OA 4BZ1L 35C8H 4F3FB 1RVFH 3KXFA 3RGVD 4FZEL 2WAHA 1WV7T 2YR3A 2W9DL 1R3KA 3QDMA 4YPGB 4NOBA 3ZYIA 5IUSA 5AG8A 2ZNWA 4E9LA 3AS0A 5CMAB 2W9LA 2JB5L 1FIGL 3D18B 3QEGL 1A47A 4BSVA 5KSAB 1NLBH 2EIBA 3I3BA 3S37H 2W59A 3U9UA 4XVTH 3K0WA 2IAMB 3OKYA 4KRMB 1JV5A 4RDQF 5LAXA 1VFUA 1HHKA 4NQEA 4HMDA 3EHBD 1AJ7H 4MB3A 5BV7H 5I6XB 1JGDA 3EKCA 4KMTH 1IKFH 5I66B 2ED9A 1T1YB 4X6BA 5D5MB 2VERN 2WBWB 4U7MA 2I07A 2YPLA 4I0KA 4MWFA 2F53A 3CCHB 3JZ7A 2SEBA 4FQIH 5C08D 4N0RA 2YUZA 1T21B 3EYFB 4GXVL 4RAVB 4O02H 3FO0L 4QWWC 4L4VA 3UTSE 3D2UB 4PGBA 1MI5A 2A6KA 3GHEH 5B4MD 1W2KT 2VXUH 3O11B 3BKML 3NA9H 3RWCA 4GRMB 4EI5C 1HIML 3O45A 2YA2A 3SJVD 3K8MA 4PRIE 2X4TA 4JKWA 1KTDB 3MV8B 4WTZG 1Y6NR 1VDGA 3D3VE 4RRPG 3QWRD 1LNUA 5GGRB 1U58A 1KC5L 2FH6A 4F33A 1WWWX 4JE4B 4NP4L 1HEZB 1DQTA 4PV9B 4WI3A 3WUWB 5J1TC 3TH2T 3FFCB 3OKDB 1T20A 5JQ6L 1B0GA 5CGMA 1MJ8H 3L3GB 1C12B 3DVNA 3W11C 5HHOD 3DGGA 2QADC 3MMEB 1A22B 4IMKA 3S88H 5I76A 1FORL 2EYSB 3GKZA 3OB8A 5FECA 5I30L 1BZ9B 5GGTA 4QHKJ 4XP6L 1X6LA 4PJ8B 4CADB 1NAKL 3AMLA 1OSZB 3SKNB 4LU5L 5F88B 5GIRB 3KPLA 3VD9A 3FHAA 2CDEB 1KPUA 4OCNC 3OXRB 4OB5L 4PRNB 2YUWA 3QQ3A 1EEYB 3QUKA 4P2OB 3TESA 3FAXA 4PJHB 5T5NF 5BZDA 3NCJL 4WFHE 1X7QB 3HNVL 3KYKL 2VDOL 1KPVA 2EDQA 1OGAB 1FFPA 4RISH 5C6TH 1KGCE 1O5DT 4S11A 4JDVB 2MCPH 2VE6B 4AMKH 1IEAA 5DEGB 1QA9B 5L6YH 3GMOB 4IDJL 4M9PA 3SBWC 1NCAL 2JJVA 3ZO0A 2BC4B 1C5CH 2AK4E 4CRPA 1FG9C 2PO6C 2X10A 1J8HA 3V6OA 5C0CB 1BEYH 1S8DB 5E4IA 3HE7D 3LN4B 2FSEB 1S78D 4KV5E 2EICA 1BX2A 1ZVSA 1SEQL 3RWIB 4HUUB 1KF9B 4WWID 5LGJA 4YR6A 3Q0HA 5FB8B 4HIHB 1NSNL 3CDFA 1JZ4A 4MCZB 1ND0B 3ARDD 1OARH 3GMNB 5D7JC 4R0LB 4M7LH 3QFDA 1KCVH 1YN6B 1W0WA 3BE1H 2D31A 4PIRF 5JO5B 3VXMA 1MCEA 4F7TA 5IM7A 4GOSA 3CSBA 4ONHA 5IMKB 5CD5C 5DGRA 1KB5L 3X3FL 4R8WH 7FABH 3QNYA 5CBAA 2BJMH 1GGBH 4G43B 2KKQA 5HYJB 5KANI 3DNKA 3KXFE 4QHUA 1MHEA 1DE4B 1NEUA 3QDME 4I18A 4PR5A 4X4YB 3GSNB 2P7TA 3OHXA 4KZEH 4U1SA 3EJJX 2UUDH 1OWWA 3VD3A 1MWAA 3MCLL 2YS4A 4URTB 1IC7L 3ARRA 1NGPH 3HUJB 1NUFA 3RHWK 3UO1H 3BWAB 2MFNA 4U33A 2BNQE 2OP4H 4LEXL 2MWCA 4YGVA 2WLZA 4NQEE 3SHSA 3VG0L 1Q9OA 3VFMA 2I9LB 4Y16D 3ZKND 5BVPH 5J7CC 3HNTH 2W60A 1H3PL 1XZ0B 2DL9A 1TJHL 1TTFA 3SY0B 2AEQL 3S35H 1KTRL 3QIWD 2YPLE 3PV6B 2F53E 4JB9L 2PTUA 3HR5B 5MEND 4Z7UF 4YXLH 3SE3A 4QRRB 4GT7A 1QNZH 1CLZL 3AREB 1S9VA 3DVIA 3LKQB 3STBA 4OF7A 1G9NL 4HGWA 4HWZA 4RFOL 3G5ZB 1XAUA 1RJZA 2F15A 1OAYL 1MSPA 4L4VE 1DQDH 5HHQA 3NCYP 3OAUL 5HYSG 5TJWK 1MI5E 3L3DB 3H9ZA 4PD4K 2V9TA 5BRZB 1XF3A 4JFEB 1V3KA 4RX4A 3CFDB 1RUKL 2PXYD 1L0XA 3BP6A 3LKNB 3QRGL 3RWGA 5J1AB 1XIWA 4XCEB 4PRDB 4ZO9A 2XZCH 2XTJE 1II4E 1U93B 2ARJB 4K3DH 3HZMA 5TDPB 4XP5H 5F1NA 1MJJA 2OI9C 4UTBL 3OJDB 4M7ZB 2UWEA 2H1PL 2BFVH 5CZVL 5C0DB 3QIUC 4K9EC 2ID5A 5D2LB 3VDCA 43C9A 5JW4Q 2Q6WA 5F72S 4WGVB 2C3XA 3H6JA 3EBAA 1A1OB 4RMWA 4NUJB 4HIIA 4RA3A 4ZO7A 1TQBB 1XCTB 4TRPL 3TM6A 5CHNA 5CEZH 5JQHC 2A6DA 5HHME 2VLKD 5CEXB 3TFKD 5E24E 1OQOA 3BD3A 3NGBC 3O6KL 1KFAL 5EO0B 3O41A 4M1CD 3VFVA 4HT1L 2JIXA 1TNNA 1ZVHA 4GLRH 1EK3A 3RPKA 2GTWB 4M43L 5DJXB 1UJTA 3O81A 1KELH 1KT2B 3H42H 1A02N 2IH3B 5HVHB 1JMZA 5GISL 4CL7A 5I2IB 4NRXA 2J5LB 5IEKB 1MQKL 1J8HE 3V6OE 2DL2A 3VFRA 3IFNL 4DUWA 4EUPG 1PYWB 1X5YA 5JW4R 2FECL 4R2GC 2WIIB 3D6GA 3RVTC 5ESVB 2HRLA 4ZYKA 3BAEL 2XWJB 5H35B 5HD8D 5KS9B 1IFHL 3EDDA 1ITCA 1I8IA 1WICA 3Q1SL 4PJCA 1CLYL 3NFNB 1KN4H 3HI5L 4QRPB 3VXME 5FGBC 3FQWA 3RTQA 4MZ3A 1N6QH 4ACPA 4HG4K 4S2SB 3RVVD 5SWSA 1MHCB 1IQWL 4HUVB 5GRJL 3JWDH 3K2UH 4EBQH 3F12A 1F3RB 4ODHL 4X6DF 5EUKA 5FUCE 3UJTL 3LDBC 3QHZH 1I9JL 3IETA 3FN0L 3DI3B 3MA9H 4APQB 1F58H 3I02B 1EAPB 3ZYJA 3FZUD 4WW2B 1EHLL 3P30H 5LG1A 1S7XB 1PLGL 4Y5YB 4NC0B 3D0LA 2R8SL 4WWKD 2ED7A 4OGXL 3TVMC 2G60H 1ZANL 4JDTH 2EH7L 1JNNH 4U1MB 1QFWI 1N64L 1BBJA 1F02I 3MUZ1 4WEBL 1Z3GL 4G7VL 3WJLA 4UIMA 1D5IL 3ESUF 4G3YH 5A2LH 1AXSB 1F45A 1VHPA 3BKJH 3WFEH 3VMPA 4GXUM 5JOPE 2YD9A 3RY4A 4L8DB 2IALB 3R8QA 4WRLA 4P9HC 5I19L 3E2HC 1RZIA 2CH8A 2XY2A 5FOBA 1WVZA 4X99A 2WNGA 2WQRA 4BELD 1J1XH 3UCRA 4G8EB 1BFOB 4NQDD 4AEIH 3W82A 2AXFB 4M61B 1Q0YH 3ARFA 5E6ID 4DZBA 4P5MA 4S1SH 1UENA 3VXRB 1IGJA 4Z8FH 2R23B 2ADFL 2WWMC 2DWDB 2X4OA 4ZXBB 5BXFB 5I8CB 4ZTOH 2AJXH 1GGCH 5AAMA 2HYMA 4LCYB 2Q8AL 1PZUB 2YXFA 1U3YA 3TCLA 4EI5D 3FQTA 2CMRH 3MOBL 3P9LB 3NN8A 4MXWH 1KLFA 2BVPB 3O6LH 1NUNB 1NBVH 4UILL 1H15A 2GW5A 5SX5H 4OCRH 3MRMB 1B9ZA 2DBLL 1NGQL 3FT4B 4ETYA 5TQ2H 5CEYA 1G1CA 1P9MC 3BD4A 3MRPA 3GNML 2F54B 4RNRB 3SGDI 1JUFB 1NMBL 2A6JA 4ZS7H 1KYOK 1R3JA 2JB6A 4M48H 2QADD 1R0AL 4KDTC 2D0FA 2NQCA 4OLXL 2VABB 1F5WA 2V5SA 2V7HB 2DJSA 4G6FB 3MXWL 1RZJH 5I1DA 4ZOBA 1B0RA 5DZNA 1JPGB 3CVIL 4G7YH 5E9DE 5TFSH 1WQVT 2NY6C 1RD6A 2DN7A 4M4PA 1Q8MA 3HZVA 3MLZH 2X4SB 2P42B 2X4RA 4YX2L 3B9AA 4KZDL 1Q9KA 1UH2A 4XC1L 3K3QA 3U9PL 1YUHA 5B8CA 3U2SA 4QY8A 1E6OH 4HHAB 4O9HH 3FQXA 3GM0A 1W72H 4Q9RH 4KQ3L 1IAIL 4Z5RB 5ILTH 1DBML 3U7AA 1X9QA 4M6NH 2QQLH 4HUMB 1LO3H 4K2UL 4P5KA 4WI9A 4I4WA 4IMLB 2PO6D 4FN0A 5C92A 2VXVL 2P5EB 3F5WB 5F7YC 1WCBB 5D1QA 1OP3K 2AQ1A 1P7QD 5CJQH 1X5AA 2NLJA 4NJ9L 5EIIA 1T1ZB 4D8PB 3TP4A 4W70A 2VXQH 5SWSE 3BIKA 4K71C 3QXAB 4MJ5B 2AW2A 3LN5A 5ETUB 1FZOB 5EU3B 4HC1A 3VI3F 3TEUA 1U95B 3L3OA 3P4NA 2AJSH 3DSFL 3OBAA 5D7JD 3TBWA 3U0WH 5TH2A 5KSBB 2Z9TA 2WQ8A 1JN6A 5D1XA 3UZQA 3ULVF 4PJ5B 5IVZB 3AB0C 3FHQA 1UB5B 4KXZI 4XPFH 3WN5A 2FD6H 3T0DA 3E6HA 3FMGH 3GK8L 5GS1B 3E6FB 3LEYL 3T0WA 2EECA 5DWUL 2MHAA 4PRAA 3BKCL 3V52H 4I3RL 1GHFL 1JF1B 3AU1B 3PDOB 4PRHD 5A2KH 3BYTA 5INCB 5KJRH 3ARBA 5F8QC 3BYYA 1CZ8H 2R39A 4I3GA 5CSGA 1GJIA 1CTNA 3PNWB 1V7MH 4NO3B 4U6VL 2DTSA 3QULB 1OAQL 3MV7E 5DI8A 1MRCL 3UX9B 2XQBH 3TA3A 1NANI 2RHEA 3S3PA 2NTFB 3HC4H 3B5TA 4LCWA 3S34L 3EOBB 15C8H 1VERA 4HX1B 4MJ6A 4QXTB 5TQ0L 4C4KT 2AKRB 1XF5A 1N0XL 4QTIL 2HRPL 5DD5L 3S36X 3T77A 4KY1L 1WEJH 1E4WH 4LF3A 5DJ6A 1ROWA 1IM9B 3ULVL 1I7ZA 1SM3H 4OUUA 1TETL 1T2QL 4HIXH 4K8RC 3SDDA 1S7WA 2F8VA 2H2SC 5IB1B 1I1RA 1BQHA 4U7KA 4WI4A 2VAJA 2PYFA 4DUXA 2VMFA 4NJAH 1GZQA 5F7FA 4LSRH 4LAQH 3BI9X 3W0WB 5L7XL 5HDQH 5IB4A 1X4XA 1RZ7L 4JFDE 3BDYL 4NNPH 5SWZB 4XVTL 7CGTA 4WDIA 1I8KA 1MCWW 2X1WL 2NY7L 3QT2A 5LCVH 1T5XA 4H1LA 1CFVH 3FO1A 3BQUB 3VCLB 4PTTB 3CX5J 3QIUD 3ZKXC 3OKEA 2VLRD 2B0SL 4KDWA 1QLEL 2XPGB 2OMNA 1HZHH 1JNLH 3P11L 1MVUB 4F3FA 1YJDC 1JRHL 2RJMA 5EPMB 2DKMA 2VXTL 3DHJA 3RGVB 1AO7D 2CQVA 1NBZA 5JOEA 1OT2A 2DQCL 1AD0B 4O02L 4YPGA 1A6UH 4PRPD 5CMAA 3WIFB 5HI5C 3NIGF 1YEIH 3FFDB 2EEBA 3D18A 5KSAA 4YHLH 5KOVC 4H88H 3O9WC 2DLHA 3CLEH 3NZHL 2IAMA 4OD1H 4DTGL 3T08A 3UTZB 1QTYT 4YHIB 5GHWH 2BVOB 2BRRL 2Z93B 2EE9A 1DUYA 4M6AA 3C6SA 4GBXD 1U8KB 4KVNH 1T1YA 3MRLB 5CKAA 1RAMA 5D5MA 2P5WD 1AGFB 1J1OL 1QACA 3CCHA 4LPYA 4GSDH 4WCYL 1H3VA 1ZLWH 1CD8A 4R2GD 5D72L 3S88L 4Q74A 3RVTD 3SCMB 1G1YA 43CAB 4XBEL 1BJ8A 1JYVA 3BIAX 4FQQB 1H3WM 5FO7B 1E0OB 3D2UA 3MRFB 3HCVB 3O11A 1BJMA 5HHVH 2IFGA 1P53A 4JFQB 3NCEB 1FSKC 3NH7L 4ZD3H 5I1JL 3C5JB 1KTDA 2DM3A 2O5YL 2V7NA 4YHOL 1SJEA 5E2TL 3MV8A 5E8DH 5TE4L 4FNLH 3ZTJG 4NN6C 4FQ1L 1N7MH 3BGFC 3JVGA 3ULVD 2DMCA 5IK3A 1HEZA 1CIUA 3WD5H 3V4VH 4FFYH 2Z4QA 1A6WL 5A2JH 2DQEH 1JL8A 5IVXE 1MREL 1RU9L 3L3GA 3CU1A 2VAAB 3WJJC 1IC1A 4UQ3B 3N0PB 1BZ9A 1QLRB 3CXDH 4PJ8A 4L9LB 1OSZA 5FYLE 3SKNA 1RIVL 5F88A 5GIRA 3TVMD 4LCWE 4M5ZL 3PL6B 2CDEA 5BOPA 4ELKB 2QQKH 2BVTA 2DQGH 3OXRA 5DD3H 4PRNA 3DMMB 2VDQH 1EEYA 3JV4B 4M7LL 2E7MA 2GAZA 4QRTB 2PTVA 5GGRY 4XPGL 3T0BA 5JDJA 1J7VR 1OGAA 3AS3A 3T4AB 5FGRA 2BY1A 4JDVA 2VE6A 3UZVB 3DROA 5GSVA 2YKLH 5DEGA 2CIIA 1QA9A 5HDLA 1E28B 3GMOA 4B7LA 4U6HB 5DYOB 5L88L 4JN1L 3VXTA 5KVEH 2GY7B 5EB9A 4E5XA 2BC4A 1QKZL 1I3VA 1NC4D 5I1KL 1BZQK 5IG7B 4EUPB 1AHWC 4PB0L 5C0CA 5C2UB 1S8DA 1NEZB 3HE7B 3FQUB 3LN4A 4JGMA 5F7KC 3WV0A 1BFTA 5DQJB 5ALBH 3U0TB 3G6JA 4TNWK 5I1GH 1DQJB 1UM6H 3VDAA 3KJ4B 3NACH 3UDWA 5FB8A 4HIHA 3Q5OA 3NVQA 2YUXA 3EFFB 3TO4C 4F7PB 2EE3A 2BHUA 4XHJC 1QFWM 3ARDB 4QHLA 2D7PA 5KG9B 1YN6A 4FQHB 5E08L 5JO5A 1WCQA 4XCYA 4F9LC 4LCCC 4YXHH 1RQ5A 4J4PC 4PLNC 5GZND 1NCDH 1A9BB 4CVXB 5IMKA 3TJHC 4TQEH 4R4NC 3F58H 3GBLA 4G43A 2VSDA 3B43A 5HYJA 5EU5B 4Y2DB 4GRLB 4MQTB 1DE4A 5DK3A 3SOBH 1MY7A 1KJVB 4Y1AD 8FABB 2IADA 4Q6IA 4YNYA 4F15B 1H3GA 1WFNA 4LLWB 4PJ7F 2DMBA 1WT5A 2J6EA 5IP4A 1OWRM 3BEWA 3QI9C 3RHWF 1S3KH 4XPAH 2NY6D 3DHMA 2NY5C 3OGCB 4JO1H 5GGTH 2R4RL 1XZ0A 3SY0A 1XR9B 1CXLA 5D5ME 3NFPA 1I9IL 3PV6A 3QIWB 2WP3T 5IT2L 2IPTH 4ODTH 3HR5A 5MENB 3ARQA 1OTSD 1LEKB 1OAXH 5DURD 3WHE0 4MAYC 3LKQA 2WW8A 2V9QA 2BDNH 2A0LC 1S9XB 4FG6D 1F90L 1MJ7H 1HE7A 2ICCA 3G5ZA 4JM2F 3ZDYE 1NFDF 2EO1A 2APVA 4JRYD 2XXCB 5CEZL 3GMQB 3L3DA 5FCUL 2FGWL 2F19H 5J11B 5C6WH 4N1EA 1YNKL 1TTGA 4U6XA 3WCYA 3AAZB 4JFEA 3CFDA 5IIEB 3OPZH 4RFNB 5J1AA 1QSEA 3MV8E 5D6DA 1FYTD 1U93A 3V9FA 2ZPKL 4KJQC 2YPVH 2ARJA 3DSNA 5TDPA 5M94B 1HI6B 2YMXH 3B8YA 3FFCE 4ZPVB 1BFSA 1T80A 4P23C 5C0EB 4LQ1A 4YWGH 1ORQB 3IFOB 5D2LA 3MV9D 3MRJA 3GIZH 4TUOB 4TVPL 3MRHB 4HUNB 3U7YH 1BAFH 4PBVC 1A1OA 4HBQA 4NUJA 3V79C 1MHPL 1RULH 2VZVA 5HJ3B 2PKDA 1PKQB 4LRIC 2EC9U 1XCTA 5AAWA 3REWB 5GGUB 2IMNA 1CFQB 2W0FB 2VLKB 5CEXA 4KDVA 1J5OH 4CKVX 4WUUD 4ZFZB 1RJLB 3VMOA 5L8JB 4PV8B 4AQ1B 4KU1A 4PJHE 1RK0B 1XGRA 3OR7B 1J0KA 3TIDA 4HPYH 3UYOD 1OGAE 1CI5A 4NWUL 5DDHB 1BWWA 4UIKL 4GXUN 1KB5B 2GTWA 5DJXA 4I9WE 1D5XB 1MWAH 1A7NH 5LBSH 1MCFA 1TQCC 3K2UL 1J05B 5I2IA 5HVWA 3IJHA 2A38A 5IEKA 4HUXB 5E56A 1DQQB 5C0CE 1BD2A 2Y7QB 4D3CH 1PYWA 3QDGB 2AI0L 3MA9L 1U8PA 3S6CA 2WIIA 2VDNL 5ESVA 2XWJA 1KV3A 5H35A 3A6BH 5HHNB 1F4WL 2AJZB 1BGXH 1CYGA 2WLYA 1F3JB 5EWIL 4NKQB 1JTTA 3NFNA 4LGSB 2A77L 1KTLB 4PYHA 5DR5L 1U3ZA 1OCWH 4UINH 4NSKB 4OZ4B 2WWKO 2L4OA 1ZLVH 3STZB 3QB7C 4LSUH 4XPTH 2OX5A 3NIDE 2DJUA 3I50H 4HBCL 1RZKC 3GZKA 4S2SA 2C1OA 2CO7B 3VI4E 4FXGB 4M6OH 1MHCA 4MNQA 3RVWC 5DSCB 4PTUA 4HUVA 1IKNA 5HYJE 3VXUA 2BNUA 1RV6X 1UGNA 4PJ9D 1FNLA 1MAJA 2ZUWA 3PWUB 4AM0B 4XTRC 4HCRA 2VR4A 1BQLH 4ZG1A 5HI3C 5T1DH 1TFHA 3BUYB 1DBJH 4L3EA 4APQA 4LARL 1EAPA 3I02A 3MZTA 4WJ5B 5DJAA 3L7EB 2EIEA 3HUJE 1CXKA 4JFFB 1CT8B 3CLFL 3E0GA 4J6RH 4ZFOA 4Y5YA 3GFUA 4WWKB 1LP9F 4U3HA 2YWYA 4LSQH 1WISA 4NC2B 5MEOB 4JO3L 5A2FA 4HKJB 3O9WD 3QCVH 1LEGB 1DLHA 3M8OL 1Q0XH 1Y6MR 4QRRE 4TVPD 1NBVL 4I3SH 4FQXA 3GKWL 5FA4B 3MYJA 4L8DA 5T1LA 4BH8B 4MDIB 4Q9BA 4S1QL 2ZOKB 4DKFL 3LQZB 1XGUB 1QZ1A 4QT5B 3PWPA 1IC5H 5BRZE 2XZZA 3AVEA 1JHKH 2OR9H 3H3BC 1BFOA 5GGSA 4JFEE 4NQDB 2Z91B 4JM2D 4M61A 2HVJA 5E6IB 5DEFA 3DURB 2R23A 2YOCA 4LASH 3SKJL 5HGDA 2DWDA 2H8PB 3BEVB 5C0IB 4ZXBA 2RBLA 5BXFA 4X6CF 4WU7B 4P5TC 1DN0B 1J8KA 1P4BL 4LCYA 2QSVA 5ESAB 2AGJH 2YEZB 4N5UA 4CW1A 2WINA 5D2LE 4OZHB 4PLOB 3MRMA 2DTML 2R2EB 3FT4A 4U05A 3KAAA 5E4EB 3I9GL 1D6EB 4OF8A 3LEVH 2F54A 1PQZB 5C07B 1JUFA 1A8JH 4KI5C 1OOAA 2X09A 2IH1B 3HC3L 3S4SA 1L7IL 2GUOA 2R0ZL 1U3HB 2HWZL 3O2WL 4P46C 3T09A 2FX7H 1T0NB 2V7HA 5GRZA 3WO4C 3EOAA 1BVKA 3T0ED 3CMOL 1GVIA 1JPGA 1G7HA 1OVZA 2EC9T 4O2EB 1U8MB 4NWTH 2HT2C 2X4SA 3LPWA 1OHQA 1ZA6B 1GC1L 4KC3B 4YE4L 4HHAA 3RUGF 1UQSB 3BO8B 1B4JH 4X7DC 5K33A 2Q7YA 2VDKH 5D2NC 4Z5RA 2OZ4A 4M7KH 2KQMA 1TCRB 4EI6A 1C7SA 5KS9E 1DBAL 4JZJB 2LU7A 3DECA 4ZTPH 2PO6B 4QRPE 5DHVH 3CC5B 4LLYA 2P5EA 3F5WA 4EN3B 2EDLA 3KPRD 4N0FB 1AGCB 5JW3H 2AERT 4D8PA 4BFGA 2D03H 2CPCA 5GJTH 4FQ2H 5DC4B 4MJ5A 3VXPB 3MROB 5EU3A 5E99H 3TO4D 1OLLA 2D0HA 4LVEA 4O58H 3I6LD 2UUDK 3RRQA 1U95A 4HV8A 1UXWA 3U1SH 3BMWA 5DK0A 1AKJB 2GFBB 4PJ5A 5IVZA 4AG4H 3LKSB 4ERSL 3QNXA 3FB7B 4WTZA 1UB5A 2BSRA 3TV3L 4J4PD 3SPVB 5IMMB 1MRDL 2Y6SC 5ENWB 4RRPA 2FB4H 1DBKL 2FLBT 3BUTA 2UZIH 3E6FA 1EAJA 4K94L 4R4ND 4X6DB 4OLVH 4HS3B 3QRFM 1E4WL 5TPWL 1CLOH 1UA6H 1KB9J 5JIHA 5EU4B 2Y07H 2R2HB 3BKYL 1JF1A 1AGEB 2D9QB 1AQKH 4JZOB 1RZGB 4PRBA 5INCA 4HJJL 3QUXC 2W07A 3LOWA 1TZHB 4NJAL 1A0QH 4GKNB 5JXEA 2A9NH 3IJSB 1ETZB 3L95B 4LAQL 5F96L 4CDHA 3P0VH 4NO3A 2NYYC 3JV6B 3OQ3B 25C8H 3TT1L 4ODVH 3QI9D 5IHZB 4MA1C 3E8UH 3L5JA 2NTFA 3LVEA 5IB3B 4ODBD 2XA8L 3EOBA 3WSQH 2ZKHH 5ELIA 4HX1A 1ZV5A 2AKRA 1AP2B 4DKAA 1NBYB 3DRTA 3K8LA 2EDRA 4IM8A 2R1WB 3FOLB 2OTWB 1IM9A 4JPVL 4MAYD 3ELAT 5C2BH 3EFDH 1I3RB 2A0LD 3GGWB 5IB1A 3VXRE 2EZ0C 1KENH 2NXZB 3OX8B 5EBWB 3C08H 1AFVH 1ZHNA 3MO1B 2ARWA 3LKRB 5DC9B 3T1WA 1LDPH 1VEPA 3C60C 4GAYB 1AR2A 2B39A 1EVTC 4YHLL 4HH9B 3QWQB 5SWZA 4KKAC 3VGFA 3GSQB 5JTWA 1EZVX 4XBGB 4P59H 3PG2A 4KJQD 4G8IB 2P47B 4C4KO 1C5BL 3DETC 1J11A 2VDRH 4P99A 1ZA3B 2FX9L 4Y8AA 3RAJL 2F54E 3RY6A 3BQUA 4P23D 3H9SD 1HHJB 4RQQB 4PTTA 5BW7A 1KCSH 4WHCA 4LPVA 1I3UA 2VLRB 3ALWA 4KI5F 5FDWB 5E0QA 1CVRA 1FO0L 1MVUA 3AUVA 3S9DB 5INDB 5EPMA 5HPOA 5F7NC 3RGVA 4D2NA 1AO7B 2VXSH 1AR1C 4ZUTB 2CLRA 2MOVA 4JREC 4IIQC 5FHAL 3RWHB 3GI9L 4B53A 3FFDA 2A6IB 1RMFL 1UACH 1X5KA 4BQBA 1TZGH 2PR4L 1YY9C 1B6DA 4LVOC 5GGVL 3VFWA 1HINH 5KBNC 5DJ0A 3U4AA 3UTZA 2DYPD 1EPFA 2BVOA 3VXQB 4FP8L 1JPSL 3MC0A 4HK3J 4WW1A 1EFQA 5FUZH 4OFYD 4K55A 5H37H 4BUGA 4GBXB 4QRQB 1U8KA 3MRLA 1U8QA 5CKGA 5DFTA 1OP5H 4M6MH 2P5WB 2P5EE 5FYLH 2HJFB 2D7NA 4M7JL 4HKBB 3N9GH 3TLRA 3W2DH 5C08A 5D7IF 4KMLB 1HHHB 1RZFL 3SKMB 4BFBD 1A5FL 1QBLL 3OKOB 4PG9B 43CAA 5BS0D 3DUSB 5HYSA 2F5AH 4FQQA 2HVKB 3UTTD 4NUGL 1JGVL 5FO7A 3G5VB 5FYJE 2NY1D 3MRFA 4HWBL 3QEQD 3HCVA 4U7SA 4A2MA 5KSBE 4PJ5E 1Z6JT 5D96B 5M7QA 3SJVA 1N26A 1JWUB 3X13B 3C5JA 5BJTB 3PF2A 4JQXA 4E0RA 3UJIH 3RVWD 4XMKH 3KS0H 3TF7C 4XWGH 3QO1B 5HBBA 2XWBB 3VJ6A 3ZE2E 1ZHLB 4K3EL 4XCCH 4G6KH 5HHOA 1IILE 2VAAA 2VITB 5HI3D 2O5XL 3SEPA 4XGZB 3ZE0E 4TSAL 5TDOB 4UQ3A 5FKPA 4H1LH 4JKPH 3DYPA 3O2VL 1QLRA 1UFUA 3CJJA 1UM6L 3B9KC 1XGYH 4L9LA 4YDKH 4KK8C 1JGUH 5D6CB 4D9QD 4L8BA 4ELKA 3JV4A 3V2AR 3KLAA 2R29H 1ITBB 2VQUA 3RWDB 4QRTA 4OIAA 1LO2L 2X4NA 3DVGA 5DD1H 3BRFA 4FQCL 3T4AA 4IRZH 4Q2ZB 4RFEB 3R1GH 4WTXA 1E28A 3CVHA 4OIBA 5BO1H 3MRRB 4GFTB 4U6HA 5DYOA 1S7RB 3H0TB 3BZEB 4GAJH 4NZTH 1JPTL 3MJ8B 4TNVK 4XAKD 4DN4L 5T3XE 4QOKD 1JWSB 1NC4B 4EUPA 5LJYH 3OJ2C 4M03A 1QFWH 4LKXA 3HE7A 1KCUL 1CWVA 3FQUA 3MTRA 5DQJA 3W0WE 1EXUB 2J8UA 5E5RB 4OKDA 2XFXB 3U0TA 1YZZA 1DQJA 1YEGL 3MXVL 1NUGA 1A2YB 2RQ8A 4JPIB 3QUYB 5AZ2H 4TNWF 3DXAD 2EKJA 5SWZE 2C7UB 3IU4L 4Y89A 3EFFA 1T03L 4F7PA 3EYOB 4PGJA 1S3KL 4Z0BH 5I71B 3ARDA 2EYTA 3V0VB 3IJYB 4F7CB 4FQHA 3CH1A 2CSPA 5AYQA 5JHLH 5GGTL 5I8KL 2UZYB 1UH3A 2HKHH 3T8XB 1ZGLB 1A9BA 4CVXA 3D9AL 3TBSB 5JMOC 5DMGD 5EU5A 1P7KB 3CDCA 1SJVA 5GS0C 2CGRH 5IW6B 4KI5D 1HQRA 3FQNA 4Y1AB 8FABA 5J12B 1UJ3C 3LZFH 5DC0A 2FNBA 1W8NA 1Q72L 4LLWA 5BV7C 1EUTA 3QA3B 1R3LB 4P46D 2LFGA 3IDXL 1MJUL 5I73C 1T7VA 1B88A 4OCMC 5SWQB 5CD3B 1WGOA 1PDKA 2BHZA 1ZLUK 3H3PH 1LDSA 2NY6B 2NW2A 3WL9A 4JFZL 2AS5M 1WZKA 2HT2D 4Y16A 1OGTB 5I15H 1QO3A 2OCFD 2DAVA 1XR9A 3SGDH 3T3PF 3QIWA 4IJ3B 3HG1B 3MQIA 3MGTB 5MENA 4HF5L 2VR5A 1LEKA 5LQBL 5DURB 1HQ4B 4UOJA 3IYLW 3NPSB 3P0YH 1RULL 4WV1C 1Z0MA 5LWYL 4MGXA 1D9KC 1HWGB 4JRYB 3GMQA 3ARGD 5D7LB 2WV3A 3WE6B 4JHAH 4R26H 5DD0L 4GQ9L 4POYA 1XR8B 5IIEA 2PXYA 3JTTA 4G8FB 4MLSA 1T7XA 1XGTB 1FCGA 1C1EL 4X0KB 1R3IL 2B1AL 4OLZH 3V4PH 2ADJB 2WP3O 1A6ZB 1EO8H 3AB0B 3V6FB 3W9DB 3JTSB 3IFOA 4XVSL 2Y6SD 3DBXB 4NQCD 4ZNCD 3I3EA 2UWEF 2XG4A 3MRHA 4R90H 4PP2B 2XG5A 5J0BA 3EOTL 2FX8L 2QSQA 1K4DA 4RAUB 1OAZL 5HJ3A 2FDBP 4EZMA 2X4PB 3MLSH 1FFNB 4NKDB 3REWA 5DMYA 4WUKL 5FFLA 3QUXD 5JDSA 2W0FA 2KH2B 2VLKA 3Q3GB 5D1ZC 4N8VG 1WC7B 4OD2A 4C56D 4FMKA 4ZFZA 4ONGL 4PV8A 3SGKA 1RK0A 5HI4D 2CR6A 3OR7A 2NYYD 1A7RL 3F6IA 2BVQB 3UYRL 4KXZH 3Q6GH 4PUBL 3LAFA 3OGOE 4OGYH 5DDHA 3HMWH 5T1KD 1FH5L 3GSNH 3JWOH 1KB5A 4Y4FC 3QIBC 2NY2D 3AY4A 4X80H 3TPUB 1FHGA 1MAMH 2J6EH 1IGIH 1NLDH 4HUXA 4LLVA 3RZCD 4WO4C 1DQQA 2YK1H 4CN1A 5D9SA 1SY6A 2Y7QA 2F58L 1UM5H 4NZRH 4HKXA 3V4UH 1PJ9A 1U3JA 4MJIB 1ACZA 2EZ0D 5DVKA 1DDHB 4J6RL 2AJZA 5HHNA 3ARUA 3IAQA 2HJLB 3S97C 3PDDA 1NANH 1F3JA 1U8LB 2D3VA 4DKEL 4OV5B 1KTLA 2ERJB 3O4OB 3O3DA 4YQXH 1CBVH 4BSWB 1YNTB 3C60D 4PJCF 4OZ4A 2HN7B 3RNKB 2YBRB 3CXHJ 5IVOA 1RFDL 2J88H 4Y8DC 3OJVC 4KUCF 4FXGA 1T83A 4KKAD 4BZ2L 5DSCA 3QEUA 3RJDA 3GUTB 2J7LA 1XGPB 4PJ9B 4I0PC 2Z8VC 2PW1B 3RA7H 5EH1A 1A4KA 5EZJB 4AM0A 1CGTA 4WHYG 1N5YH 2BCKB 4G80A 4O4YH 3QZWG 4FMFA 3BUYA 5A43C 3TYFB 4FQJL 2PW2A 3L5IA 1FG2B 3QH3B 4WWKA 5EORL 4OJFH 1YECL 5DZLA 2WBJC 4OI8A 3QQNA 4X8JA 4PJ7B 4FXLA 4OLUH 1FRGL 5MEOA 1M7IB 1EERB 4JHWH 5CJXC 1WFTA 4M1DL 4HKJA 2H2PC 1LEGA 1YY9D 2X42A 1Z9SA 5MENE 4QO1A 1VKXB 1CD9B 3RY5A 4QCIB 5J13C 4MQXC 1T89C 5FIEA 5FA4A 4KGJA 3VE0B 2AVGA 1IBGL 5EC2A 1V7NL 3OXSB 4Z7UA 3AS1A 3GMPB 3C09B 3IRZA 2RGSA 4OD3H 2GK2A 4M9OA 3RKPA 2XRAH 4LLDB 5DHXB 4QT5A 3KPMA 2OLDA 4LPCA 1NDMA 4NQDA 2Z91A 4JM2B 2VYRE 3QXVA 4YDJB 1NFDB 5E6IA 2VZUA 2X44D 1YEEL 1D5MB 4BA8A 1FZMB 1MCRA 4UAOC 1QFUH 3TBVB 2IFFH 2H8PA 3BEVA 5C0IA 4DVRH 5BOZG 4WU5B 3ES6B 1DN0A 3UP1A 5IJKC 4Z7WF 5ESAA 4EI5A 5KTEH 2FJHB 4KHXH 2Z31B 5EBMB 1KEML 3WHXB 3I2CL 1NL0H 4NNXA 2ZCLL 4Y4KB 3R8BB 4DAGL 1A7OH 3E3QE 4K3JL 2VDKL 1ZWIB 2R2EA 3L5WB 1TJGL 1PKQE 5CJBA 1LO5B 4PGDB 4PJXB 4JANB 5JLZB 1D6EA 1VPOL 1PQZA 3A0OA 2GY5A 2PNDA 3HFMH 2VLKE 2IH1A 5FF6B 4ZTPL 4WNQB 4TPRH 1U3HA 1JFQL 1YYLL 3P4OB 4N0YL 2ICWB 1V5JA 4JVWA 4UDTB 5I1IH 3MRDB 3B9KD 4LEOA