1ZWIC

Structure of mutant kcsa potassium channel
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
molecule tags Immune system/ion transport
source organism Mus musculus
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1zwiC00
3E89A 2W0FC 4F4LA 3E8FA 4G28B 5EC2C 1K4CC 4X88A 5CBFA 1OCZC 2YEVA 4MVZA 3OGCC 4CBCA 1S5HC 4PA4A 3RVYA 3IFXA 4RUFA 5EBMC 2Y69C 1XL4A 3E86A 4P9OA 5E1AC 2DWDC 5EBWC 1R3JC 5KUKA 1J95A 3F7YC 2ZXWC 3T4ZA 3E83A 2AHYA 2EILC 1BL8A 3PJSK 5EBLC 3AG4C 3SPCA 3SYOA 5B3SC 3X2QC 2DYSC 4RUEA 4MVSA 2X6BA 3RW0A 3K04A 4X8AA 3E8BA 2X6CA 1KKDA 4PA7A 3R65A 3ABMC 4MVRA 3LUTB 3UM7A 4XDLA 3GB7C 4J9ZB 4P30A 2JK5C 4MS2A 2HJFC 4QNHB 2H8PC 4R6ZA 4ZBMA 2HFEC 5KUMA 3SJQC 3SYQA 3T1CA 2WLLA 4R8CA 2KB1A 3ZRSA 1R3IC 2IH3C 4MW8A 2Q69A 4MSWC 2Q68A 2AHZA 3E8HA 4MTGA 2EIKC 2WLIA 4I9WA 4LBEC 2EIJC 4PDVA 5EC1C 2HVKC 3RBZA 1M57C 2EIMC 5CBGA 3ABLC 3LDEA 4P2ZA 4R50A 2Q6AA 3F7VC 4JTCB 4JTDB 4H37A 2WLHA 3HPLC 3OUFA 4PDMA 4X89A 5J9PC 4GX2A 4HZ3A 4DXWA 3LNMB 3K0GA 4UUJC 3FB5C 3K06A 3OUSA 3FB7C 4PDLA 3IGAC 3T4DA 2HVJC 5IY5C 3WG7C 3K0DA 3SYCA 1ZWIC 4G27B 2OCCC 4XDKA 4GX5A 4MVQA 2K1EA 3SYPA 4BW5A 1LNQA 3VOUA 3FB8C 2WLLB 1XL6A 3KG2A 3F5WC 3OR7C 4RO2A 4OXSA 4P9PA 3SPGA 2DWEC 2WLIB 1ORQC 3AG3C 4EKWA 4PA3A 5BZBA 3SYAA 3ABKC 4LP8A 2A0LA 3TCUA 1M56C 4RAIA 2R9RB 2A79B 2QTOA 3FB6C 5EK0A 4TWKA 4MTFA 4WFHA 4R7CA 2WLNA 1K4DC 4H33A 3LDCA 2BOBC 2WLJA 3TETA 3AG1C 4PA6A 3AG2C 4PDRA 2BOCC 2ITDC 3BEHA 4MTOA 2A9HA 3LDDA 5CBHA 3SPHA 2EINC 3UKMA 1V54C 5B1BC 4QE7A 1P7BA 4GX1A 1JVMA 1OCOC 3K08A 3STZC 3RVZA 3ASNC 3K03A 2ATKC 3SPIA 4XDJA 2Q67A 2ZD9A 2DYRC 1OCCC 3OR6C 4WFEA 3ZJZA 1R3LC 2QKSA 4HYOA 3SPJA 4MVMA 4PA9A 4MW3A 4MVOA 3STLC 2ITCC 4J9YB 2NLJC 4JTAB 1V55C 4GX0A 2X6AA 1G4YB 3E8GA 5B1AC 2P7TC 3ASOC 4WFGA 3JYCA 1QLEC 2HG5C 2WLMA 1OCRC 4QE9A 4MVUA 2IH1C 1R3KC 4LCUC 4WFFA 3EFFK 3T2MA 4KFMA 2WLKA
chains in the Genus database with same CATH superfamily
3A0BZ 5D5PA 4G28B 1K4CC 1TVKB 2IJJA 1IBLB 4NXNB 3OEHG 4X1YA 3VBBA 4RUFA 5EIBD 3RYCA 2V4DA 3ABKB 5EBWC 1R3JC 4LF7B 3TXQA 2XAFA 3OTOO 2LGWA 1PD3A 3ABTA 2GBOA 4NXMO 3CCRV 3CEIA 3ABMC 2XAGA 3GB7C 1PNLA 2VRZA 4EFBA 5LYJB 1JQ0A 1R3IC 1XMQB 2Q69A 4JI0O 1ZTEA 1DTOA 2B5UA 1N32B 2W6IG 4LFAO 3ETDA 3K57A 1FD9A 4BIUA 4PI0A 1WA8A 4DW0A 4JI4O 4IT5A 1VF7A 2IJIA 1FXKC 1LNQA 1URFA 4CH4A 2PF4E 1XL6A 2OTJV 2NR5A 4YIOA 1LUVA 3JAWA 5GONA 4JAAA 2Y4TA 4H13B 3T1HO 2F4VO 1SKVA 1TVKA 2GHYA 4QJFB 4J7KA 2YDEA 4DR4B 5A9GA 1NT2B 5LGUA 4DK0A 5IY5B 1Q90D 3OM3B 1QLEB 1YTFD 4CH3A 1R6TA 2EBOA 3UKMA 5GW7A 4GZRB 1K5SA 3RVZA 3K03A 2Q5ZA 5DECA 1FJGB 3RGBA 1Q6UA 1N0JA 4PV1B 3J80N 4X62B 5AG2A 4DR3B 1M9NA 1VQNV 2EJ7A 4WFGA 4X20A 3ZBHA 4N23A 1H2MA 4JYCA 4J7JA 3CE2A 4RWUA 5CBFA 1GM7A 5LHIA 1I94B 4UVCA 4B3SB 4UCVA 1WPXA 2ZXWC 4F6RB 3Q4HA 3RFRA 1DK1A 2BCCH 2CGOA 2X6BA 2P4KA 4OPAA 1SQQH 1YVWA 1KKDA 1DLBA 1CPYA 2JK5C 2HJFC 2YIAA 5E79Z 4ZHQA 4YY3O 2DN9A 2KG7A 5J2TA 1YDXA 2QTSA 1WA8B 5JVDB 4LBEC 5JQGA 1GAXA 1Y74A 2JRIA 4GUNA 3M8AA 4J42A 3HKEB 2XNDG 1TUBA 4FPPA 1IVSA 4NXNO 3AK2A 2GV9A 5CB4B 4XDKA 3HB3B 4DYLA 3SYPA 3OW2U 1RP3B 4O4HA 4CZZA 4P9PA 1ORQC 1YI2V 4B7KA 1PNKA 2OIEA 1P49A 1P7GA 1BHBA 1CP9A 5EK0A 1QHTA 4MTFA 2DW4A 2BTQA 1D5AA 3SJCC 1HP8A 4IGGA 1SQXH 4TV9B 5B1NA 4TT3G 1P7BA 1KQSU 2ODMA 3SPIA 2ZD9A 2JGDB 2XUMA 3AK3A 1TGOA 3CXCU 4E4EA 1S72V 3HKBB 5JCOA 1JR9A 1QLEC 1SQVH 4LF6O 2E74B 3D36A 4DR7B 2WAMA 1GKFA 2DOSA 3FYIB 1NH2B 3RT3C 4O4LB 3E83A 2BTOA 5LXTB 2VS0A 4KHPB 5LGNA 1Q81W 3ETEA 3JATA 1GM8A 4X1YB 1M57B 1U96A 1TUBB 4X9QA 2A7WA 1FXHA 1ROPA 4TV9A 1HNXB 1XBLA 1IBKO 4R50A 1D2DA 4JTDB 4H37A 4LF4B 5IYCO 4JPRA 4PDLA 1WB8A 4BW9A 2HHHB 3CRQA 3ZEDA 4UCOA 3ABMB 4MVQA 4DR2O 4PD4F 1BE3H 1H2SB 4DV7O 1NTKH 5CMUA 3ZMUA 2DWEC 3C3SA 4O2BB 3G4SV 4TWKA 4DK1A 2PGGA 4KL1A 1RSOB 3QTCA 4UXNA 3BABA 4U3FH 3IJ4A 3G6BA 5B1OA 2HP8A 4JGSA 1M4UA 3ETGA 1ZLZA 1AR4A 5LBQA 2DYRB 3CMAV 3FX7A 5LGTA 2YI8A 4UFZA 3ASOB 4CH6A 2P67A 3QNEA 4JI5B 1VQPV 2ITCC 3B09A 1R6NA 3JATB 2DMXA 1H2KA 5C8YB 5JWPA 2X6AA 3QG5A 1W2BU 3ASOC 1ZAUA 4FLTA 1J5EO 4DR3O 2AW9A 4B3RO 1H38A 3JD2A 3E8FA 5IJ0A 1D5NA 4X88A 5H2FZ 3ZRWB 1NR1A 4PA4A 2ADPA 3JSLA 2V1DA 1U97A 4CC5A 2PYJA 4IL6Z 3X2QC 5B66Z 5LMUO 4RUEA 4ICGA 4FLYA 2Q9LA 4FJCC 2QM7A 2QWRB 2ARHA 2Q73A 3HKCB 3UM7A 4P30A 4JYAO 5IYBO 3U10A 4TQFA 2PTMA 1WNSA 2OWOA 4PDVA 2CTQA 4ZHQB 4X66O 1QQCA 1F4MA 4LFCO 1XI1A 4FLVA 3K06A 4EEQA 4JI5O 1Q6HA 2OTLV 1V9PA 4G27B 1FXVA 2N74A 1BCCH 3SJAC 4BW5A 1BZKA 3W7WA 4G2KA 5B1BB 1J5EB 2XAHA 4OXSA 4LC1A 4JYAB 3K5MA 1P4RA 4O4IA 5JJNB 2ZDIC 3CCSV 4FM2A 1VQ6V 1I08A 4J11A 1WJZA 3HKEA 1B04A 4H33A 3L73H 1F7YA 3LDCA 3U11A 4ZKIA 4X20B 1HW7A 4EB6B 1WPBA 2Y0PA 5JJJB 5CBHA 3SPHA 1K7DA 1V54C 3RYHA 1JVMA 1IDSA 4BAYA 1MA1A 4LF5B 3OR6C 3ZJZA 2DE0X 2F4VB 4MVMA 4LF9O 3N27A 3AEIA 3HR0A 1AJPA 1OCOB 4JI6B 1BQ0A 2P7TC 1OCCB 1HNXO 4B3SO 1XMOO 4W4LA 3T2MA 1FKAO 5IJ9A 4K3AA 1L1FA 2ZIOA 5CA0A 4OGQB 3RVYA 5LP6A 3IAYA 1OHHG 2LQTA 4P9OA 1XL4A 2MK3A 3HKCA 4JZGA 4UVBA 3TGUH 2Y48A 4TV8A 3CC2V 3PJSK 1BL8A 4IIJA 2LW7A 3S3XA 1N34O 4MVRA 2LGQA 3ZHTA 4J9ZB 1I5YA 3R66A 3T1CA 1NVPD 1N36O 5IJ0B 2GTAA 1BGYH 4R8CA 4DV0O 1VQMV 3D8CA 2AHZA 3STZC 1ZUQA 4IHJB 3G71V 2HVKC 2E5LO 4EB6A 1VF6A 1MOFA 3K58A 3ZS8C 2YC0A 1AVMA 3M99B 1XOUA 4GX2A 3LNMB 5IY5C 3RN4A 4N21A 3W7XA 3K0DA 2YIBD 1M1KW 2M6YA 4TOIA 2QWNB 3VOUA 5IYDO 3KG2A 4B7EA 3CX5F 3JASA 4DV0B 1Z5VA 5EZYA 2AXTZ 5K1PA 2QSAA 2OIGA 4WF9V 3L9DA 5LA6B 3FB6C 3K5LA 1WP8A 3H01A 1AI6A 4Q20A 3K9SA 3WU2Z 4PA6A 2CE4A 3CMEV 3E22B 3FKSG 2WA4A 2H94A 2PZSA 1K33A 1K73W 3KZIZ 2F1MA 3CYOA 3K79A 1Q3EA 4J9YB 2DQ0A 3ZMSA 3Q4HB 3RYFB 3BHPA 3OFNG 4QIWF 2XASA 2RMKB 2UXBB 1VMGA 3JALA 2RQ6A 4DRXB 1MABG 1AILA 1M56B 2QWPB 4WFFA 5CN0A 5KMGA 3E89A 4DUYB 1FJGO 4DV3O 1O9HA 2QR4A 4O4JB 1IX9A 4CBCA 1N8RW 2P5OA 2ZM6B 1AI7A 3F7YC 3E35A 2XOKG 2E5LB 3SPCA 4U3JB 2EILB 3CCQV 2IU0A 3K04A 2UXXA 4TUYB 3E8BA 3JASB 5KHKA 5FL7G 2ZE6A 4PA7A 1GH6A 2ZNJA 5EIBC 5F2VO 4ZBMA 2CGNA 2ILMA 2JGUA 1YCIA 1FFXB 3L71H 2L35A 1RFYA 2CTWA 1K8AW 2EIMC 4DV6O 4K0KO 3LDEA 4DR1B 4DV1O 4MT8A 2H3OA 1S76D 1MNGA 4UUJC 1UPGA 2ZDIA 5FPOA 1MSDA 2K1EA 2JEUA 3J81N 4JI0B 2PYLA 1SERA 1E1RG 4DRXA 2ZT9B 1GN4A 2PI5A 2RDCA 4YIPA 3OMNB 3TCUA 4RAIA 2ADQB 4DV5O 2O57A 3CCLV 5J2UB 4AI8A 4I4TA 3QO5A 1I7FA 2BOCC 1F4NA 5HFMA 1N33B 3SR2C 2HJDA 1QR9A 1VQOV 5IWAB 3FD9A 5EYPB 2Q7HA 1KU9A 1AJNA 1VARA 3JAMN 4ZOLA 3ZHQA 5JH7B 2P06A 3C90A 4PA9A 1RPOA 2XT9A 4NR1A 3N2KB 5IE9A 4ASUG 4GX0A 2WA3A 3TJTA 4NTWA 5B1AC 1PM9A 3OT7A 1IXMA 1L8DA 4K0KB 4A5UB 1QCEA 4JI2B 2HEPA 3CB2A 2IM9A 1M93A 1XHXA 1AR1B 2YXHA 4W4KA 4I7ZB 1H2LA 1SA0A 3IFXA 1YTFB 4UCSA 2DWDC 1JPXA 2AHYA 1W0JG 5L3GA 2AZ0A 3OAAG 4CS4A 3D3QA 1YHQV 4B3TO 2YXLA 1H8EG 3CJHA 1WAZA 3HKDB 2HFEC 4I50B 3P3PA 1CXZB 5HFLA 1KD1W 2UUCO 1XQ8A 5EC1C 3RBZA 1EZVH 2WWWA 3JARA 3CPWU 2FYUH 1QU7A 5C93A 4IIJB 4PDMA 5TISZ 2PI4A 2RN9A 4J7ZA 3SYCA 3L70H 2UUAB 2ZE7A 2N05A 3QO7A 4GCZA 4ZI7A 1FFXA 3MD0A 5BZBA 4YJ3B 3ABKC 3AG4B 1M56C 1G8MA 2QTOA 2ZCEA 4OX9B 2X7RB 4O2AA 2E76B 2B1IA 2Y0IA 4JASA 2A9HA 3ZN0A 3IC9A 3KKYA 4AQYB 4ABMA 1FS0G 3O65A 3W7UA 1OCOC 2YUAA 3VQWA 3DXRA 4XDJA 1E79G 2LFSA 4HYOA 2QKCA 2HHHO 4X65O 1KKCA 3X2QB 4FMTA 1IBKB 4WFBV 1H8HG 1R3KC 2WLKA 3AG7A 4GKKO 2Z5UA 4LR3A 4FLXA 2QJ1A 1US6A 1KB9F 3IC7A 3I55V 3SDLA 5H6RA 4FLWA 1VP7A 4LF4O 2XTAA 4DR5O 1QR8A 3RYFA 2D2CB 5C8YA 2GUZB 1NH2D 4MVSA 2UU9B 1QLNA 2F23A 4OX9O 3JARB 4J80A 1HNWB 4XDLA 3WG7B 5FLXN 4QNHB 5KUMA 5BY1A 3OMAB 1GMGA 3GVMA 3AK1A 4MSWC 4UVAA 2EZPA 1TUEB 3MHSC 2CTRA 5LMNB 2EIJC 3K59A 1XMOB 4DV5B 1G1XB 2Q6AA 4DR5B 2ZKOA 4BIOA 5LXTA 1EN4A 3D36C 4HZ3A 3D3IA 3AG2B 3BFRA 4NYKA 3WFVA 5GTHZ 4NB5A 3EVKA 4DV3B 3HKDA 3FB8C 1KMIZ 4QPJA 5A2QN 4I55B 1Y76A 2FMLA 1UJWB 4LP8A 5KX5A 2JS3A 2QEXV 2A79B 4DV4O 4B3TB 1HNWO 4X64B 3FYEB 4DR6B 4B3MO 4RQFA 2RNBA 2QM4A 1YF2A 2CH7A 1Q6IA 3OEEG 3A0RA 1B06A 4GKJO 1OZ0A 4QE7A 4MTXA 2VQEO 2ATKC 1THZA 1R3LC 4O4IB 3ZHRA 3CWBH 1YJNV 1PL0A 4O4LA 3T1YO 2CAZC 2YXYA 4UCTA 2W0XA 3NR7A 4GYCB 3APQA 4X1KB 4ZOLB 4NKGB 5GONB 1F51A 2IH1C 1SQBH 3EFFK 2F43G 5EC2C 1S5LZ 4YJ2A 1R1BA 3ZHUA 1NQTA 1GM9A 1NZ6A 5J2UA 3UCSC 4JF3A 2Y4UA 2Q7GA 3EXAA 1H2GA 2FKXA 1MZFA 4ZIBA 4JI1O 2ETNA 1QNMA 1E1QG 3JD4A 4O2BA 1XNQB 4HNAA 4H0LB 3JAKB 5BR8O 3ZMVA 3SYQA 2W6JG 2WLLA 3ZRXA 2IH3C 5CA0B 3GWOA 2Q68A 1GTOA 1M57C 2KSDA 4UV9A 1KP2A 2L6LA 1AB3A 4I50A 5J9PC 3U0ZA 4X62O 3K0GA 4PHZA 1Y76B 4NTXA 2R9IA 2C2AA 3OGIB 4K8XA 3L74H 2VQEB 2N04A 3DC6A 3BCCH 3KCXA 1N33O 3CCMV 3MHHC 2A0LA 3S3WA 4JYYA 1HR0O 4PI2A 3CCEV 1PL4A 5JQGB 4JYBA 1YZBA 1MSWD 4I0XA 2QA4V 5B1AB 4D7SA 2DYRC 4YJ3A 2FTKA 1JX9A 4BIZA 3JD3A 1A32A 4CC6A 1TAEA 4FFKA 2P6JA 5LOVB 2UXDB 1GRJA 2LJ2A 4JI2O 4K8ZA 4CS2A 1OV9A 3B2EE 1LUWA 1AR5A 2XAJA 4DR1O 1K9MW 1UFIA 2HG5C 1FXKA 1Q7YW 3BVOA 1ZL8A 1LR1A 3E22A 1KP3A 1Y66A 4JI4B 5H6QA 3SGIA 2QGNA 4X66B 5KUKA 4LFBB 3SYOA 4J41A 1AI5A 3QVNA 4JAVA 3RW0A 3ZCCA 1XREA 1VQLV 4D6TH 2X6CA 5D5QA 5LL6Y 3R65A 5KLVH 4YHHB 3LUTB 3ETQA 1JFFA 4E2LA 3LSQA 3BA8A 4R6ZA 3A8TA 3SJBC 4F6EA 4DO2A 3L75H 3CSXA 4TV8B 2E3CA 3ABLC 3FAVA 5H9CA 4DUZB 2WLHA 2YICA 1S3JA 1L0NH 4X1IA 2HVJC 3JAWB 1VIBA 1K3EA 2LFRA 5LOVA 1WN7A 5FNVA 1N4CA 3F5WC 4DR2B 4WFAV 1OCZB 3UO3A 3AG3C 4PA3A 1EFRG 1NVPB 3CRMA 4KHPO 1VF5B 2A3QA 3CCUV 2LO1A 3KCYA 3UO2A 4PDRA 5IWAO 3AG3B 1FFTB 2YIBA 2PUSA 3H1HH 3BPZA 2G38A 3APOA 4JI8B 2EIJB 1Q8IA 4U7OA 1OCCC 3CRAA 5CA1A 4GKKB 1Q5OA 4X64O 2CH7B 1SETA 1K97A 3P3NA 1V55C 5BMVB 4LWSB 1R6KA 2Q0OC 2UXBO 3K5OA 5JVDA 3K3WA 5KHHA 1MZEA 2RCVA 1OCZC 3ZN1A 2IBZH 3OGCC 1O9GA 4J10A 3F5TA 4AQYO 1ZSPA 2EILC 4IYHA 2OT5A 2ZXWB 1M90W 4JV5B 3W7SA 2OCCB 1XNRB 1Y74B 1NR7A 2H8PC 1N34B 2JS5A 1V54B 4H44B 4JV5O 4MW8A 2HKOA 4I55A 2B1GA 3DSQA 1FAFA 2CUGA 3I5DA 5JCOC 4JTCB 2V7QG 3H1LH 2WPDG 1GN3A 4CH5A 1XUQA 2QM8A 4DXWA 3C3TA 2UXDO 1GK9A 4JZ2A 1HWYA 1W0KG 1ZWIC 3A0HZ 1PKXA 2QWQB 2VQFB 2ZE8A 4FIPC 1N36B 4JI6O 4YY3B 3RYIA 1EN5A 2LW1A 3B40A 4LNUA 1T5EA 1DGSA 1WLEA 1SZXA 2IW5A 3OD4A 1HR0B 5LMUB 1YSCA 4DV2B 2AZ2A 4WBNA 1BS3A 1M5IA 1I5XA 1I0HA 3VQYA 1I94O 2ZR3A 1Z5WA 2QDOA 2Q67A 1YIJV 5FPRA 1GN6A 2XAQA 2NLJC 3RYHB 2Q4PA 3JD0A 5DEDA 3E8GA 3TK1A 1N32O 2EULA 3JCZA 1KUQA 4I0XB 3JAKA 3QO8A 5EYPA 4LF6B 4MVZA 3OE7G 1SRYA 1JJ2U 2DQ3A 5E1AC 1FXKB 4LH7A 3MAQA 3AG4C 3THOA 1K5QA 1Z2GA 2R9AA 1YJWV 3DTUB 4YHHO 4QGPA 2YEVB 5KA5A 3LSSA 3B8NA 3E8HA 5EZYB 2Z3YA 1YEWA 2BSKA 2IU3A 1ZL8B 3QF7A 4AILC 1R73A 5LA6A 2R70A 3ML0A 3OUFA 3H9VA 4JAUA 1HNZO 3T4DA 4HBNA 1W59A 5LP6C 3WG7C 5JH7A 4JI7B 4UCUA 2B9ZA 1K92A 1BMFG 2Q8VA 3E2EA 2HR3A 3CD6V 3B4SA 4B3RB 1BQZA 2JJ2G 3OR7C 1RSOA 1VF6C 1YJ9V 3NXSA 3SPGA 4BWAA 2WLIB 3OMIB 3SYAA 2Y69B 1HNZB 2Q0AA 2WSSG 4B3MB 1XNRO 1XEQA 4AHCA 3G67A 2BE3A 5IYZB 3K5NA 2IJKA 1S5JA 1AP5A 2BOBC 3TETA 4L87A 4XBFA 3BY6A 4O4JA 1KBHA 1XHZA 2P90A 1TA8A 5IT9N 5CB4A 2EINB 2QKSA 4DUYO 4MW3A 1MG1A 4MVOA 4JI1B 1NKDA 1VQ4V 3ZHSA 2NN4A 4TUYA 3JYCA 1WB7A 5KA6A 4CS3A 4WBNB 1RM1C 3L72H 4FLUA 1IBLO 2DJVA 4DW1A 2Z0AA 1XDCA 1RPRA 3GWKC 2QWOB 5EBLC 3H1IH 4Z1MG 5ITZB 4WCEV 3ZIAG 2P4VA 4LF8O 4NTYA 4IYIA 5KHGA 2CDYA 3CRCA 1IBMB 2FB5A 1EZJA 1SC5B 2A06H 1XNQO 1FYJA 2KB1A 1SS3A 4YJ2B 5KHIA 3MDSA 4Z1VA 1N0NA 2EIKB 3WB0A 4KP4A 5IDJA 4LF7O 1X59A 3HPLC 2GUZA 3K9AA 1JMKC 3OUSA 3IGAC 3H1KH 2OCCC 4LF5O 5KAFZ 1DF5A 2IJHA 4D7TA 3J7AU 3P32A 2WLLB 4FZ0A 3W7TA 4O2AB 1NBMG 2DYSB 2OYQA 1NTZH 1S77D 4WFHA 1K4DC 3A2FA 1FPOA 2YSUB 1JJOA 3VQVA 1P84F 4JI8O 2NNUA 2ITDC 3LDDA 1V55B 2CK3G 1B6QA 3K08A 3ASNC 1K34A 4WFEA 4I4TB 3SPJA 1YITV 1Q86W 5KAIZ 4JI7O 3EHBB 2EX3A 2M7WA 1OJHA 1WP7A 1VQ8V 5GTIZ 3ASNB 4QE9A 4RQEA 4IHJA 3RYIB 1JFFB 2UUBO 2P22C 2KQXA 4F4LA 2PY5A 1EN6A 1JCHA 1SQFA 2KG7B 1S5HC 1GN2A 4DUZO 5LHHA 1SESA 1F23A 2OCHA 2Q7EA 3LSUA 2DYSC 3BRCA 4X65B 2YS8A 4X1KA 3N2GA 1ENVA 1SA0B 5DM6V 3T1HB 3CC7V 5KX5B 2EJRA 3SJQC 3UT5B 3CHXA 3ZRWA 4O4HB 3ABLB 4MTGA 2EIMB 4I9WA 5CBGA 2QKAA 3B77A 4TQDA 4LNUB 2EZOA 3OTFA 4FM1A 4LFAB 1JA8A 3ZMTA 2ZR2A 1Y4MA 3DXRB 4GLXA 4B08A 3O9OA 4UB6Z 4I5SA 1X4TA 4DV2O 3FAVB 4DR4O 4YXWG 4LWSA 4Q6GA 4R7CA 1Q43A 4X1IB 4EFEA 1Q82W 2WLJA 3RYCB 4L8JA 1BSMA 3AG2C 4MTOA 1G6UA 3CXHF 1Y67A 2UXCB 4KXRA 5FNVB 2HLDG 1NU1H 5IYZA 4UV8A 1PV0A 2GDSA 4FK5C 3ZX6A 1SZTA 5LHGA 3PN1A 1VQ5V 4DV1B 2E75B 4ZI7B 4FLZA 1OCRC 4JI3O 4MVUA 4LCUC 1NJIW 2QE7G 2UXNA 2ZQMA 3I56V 2YEVA 3WB2A 1QVFU 3ZMZA 5LYJA 5B3SB 3CCJV 5L3CA 5EBMC 3E86A 1ZX3A 2BSKB 3ABUA 5CA3A 1J95A 4NXMB 3T4ZA 3HKBA 3B8MA 1L0LH 3P30A 5B3SC 1AI4A 2VWKA 2GSMB 1KC8W 3TXSA 5KHJA 3OTOB 3WB1A 1H2NA 3H1JH 4MS2A 3CRRA 1AP6A 5LP6B 2UXCO 1XILA 3ZHVA 5L3FA 2F95B 1KECA 2EIKC 2WLIA 5BXZA 2VQFO 1VQ7V 3F7VC 1AJQA 3DGEA 3ZRVA 1Y6XA 3FB5C 2XHBA 4GX5A 3VQXA 4QPKA 4TSFG 2UUAO 4RO2A 2LP7A 1PNMA 5L3BA 2YI9A 5B5EZ 2JVDA 5H5NA 4GT1A 3CCVV 2R9RB 1SQPH 1PP9H 3BAAA 4DV4B 1RM1B 3RWRD 3AG1C 1EM1A 3BEHA 2R72A 4GKJB 2UUCB 1XMQO 2ZE5A 3FFQA 1VQKV 5BR8B 4FZ1A 4DR6O 4C7UA 1VEWA 2GTSA 1MMMA 1VQ9V 3CJHB 3CP1A 4F6RA 2X0LA 2VWJA 5JJEB 2MW2B 4FM0A 5J2TB 1EBOA 5ITZA 4KUMA 2CTPA 4LH6A 3T1YB 2RJZA 3BA9A 4KFMA 1PPJH 3FB7C 1COWG 2W0FC 1NI8A 2YIDA 4HAMA 3AG1B 2AGAA 3JSNA 2Y69C 2D3OW 3ICXA 4I9QA 4LF8B 1GO3F 3JCUZ 2ZINA 3N2KA 1B3QA 5DN6G 3UQ8A 4LFBO 4X8AA 4PJ0Z 1CEZA 1DF4A 1BT8A 2F66C 3G80A 5L3DA 5KMGB 3M7MX 4FFBA 2ZNIA 3CS5A 4BR6A 3ZRSA 3JALB 3N2GB 4UCRA 1SQGA 3LNNA 2JEXA 4HNAB 4NVPA 4P2ZA 1KYOF 4X89A 4U3JA 2ZM6O 2BTQB 1NS1A 4LF9B 2JGDA 1AROP 2KKWA 4K35A 2FL4A 4DV7B 1HDJA 5LMNO 2UUBB 3UT5A 5BMVA 2F93B 5L3EA 1QBZA 4EKWA 1JOYA 5CA1B 2K9PA 4U7NA 4PELA 1S0VA 2WLNA 4DV6B 2ZIMA 1QVGU 1SF9A 3DC5A 5IJ9B 3CC4V 1IZ3A 2EINC 1NTMH 5B1BC 3JD1A 2JJ1G 4GX1A 1OCRB 1IBMO 2JDIG 4FVMA 2UU9O 1BHAA 3G6EV 1IURA 3STLC 4FFBB 4LFCB 4JI3B 4UB8Z 4JTAB 4Z2WA 1G4YB 1YXBA 2JIZG 4OPHA 2WLMA 5K1XA 4DR7O 1IXBA
chains in the Genus database with same CATH topology
1L1FA 2F43G 4G28B 5EC2C 1K4CC 2IJJA 3OEHG 1NQTA 3RVYA 3VBBA 1GM9A 1OHHG 4RUFA 1RPRA 4JF3A 3ABKB 1XL4A 2MK3A 4P9OA 4UVBA 5EBWC 2Y48A 1R3JC 2XAFA 1H2GA 3CC2V 3PJSK 5EBLC 1BL8A 1PD3A 3ABTA 4Z1MG 4WCEV 3ZIAG 3CCRV 3ABMC 1E1QG 3JD4A 2XAGA 4MVRA 3GB7C 4J9ZB 1EZJA 1I5YA 3ZMVA 3T1CA 1NVPD 1PNLA 3SYQA 2W6JG 2WLLA 4R8CA 2KB1A 1JQ0A 1R3IC 2IH3C 3ZRXA 2Q69A 3GWOA 2Q68A 1VQMV 2AHZA 1GTOA 3STZC 3G71V 1DTOA 2B5UA 1M57C 2EIKB 2HVKC 2W6IG 4KP4A 4UV9A 5IDJA 1MOFA 1KP2A 3ETDA 3HPLC 3M99B 5J9PC 3K9AA 4GX2A 3LNMB 3K0GA 3OUSA 4BIUA 3IGAC 5IY5C 4N21A 3W7XA 3K0DA 1M1KW 2R9IA 2C2AA 2OCCC 1DF5A 2IJHA 1FXKC 1LNQA 2IJIA 3VOUA 5IYDO 3P32A 2WLLB 1XL6A 3KG2A 3W7TA 2OTJV 1NBMG 3CCMV 2DYSB 3MHHC 2A0LA 4WF9V 1S77D 3FB6C 3H01A 4WFHA 2GHYA 4QJFB 1K4DC 1AI6A 2YSUB 4Q20A 5LGUA 3CCEV 5IY5B 4JYBA 2NNUA 4PA6A 2ITDC 1MSWD 3OM3B 1QLEB 1YTFD 3CMEV 3LDDA 2EBOA 1V55B 3FKSG 3UKMA 2QA4V 2CK3G 5B1AB 5GW7A 1B6QA 2H94A 3K08A 1K5SA 3RVZA 3ASNC 3K03A 1K33A 1K73W 1K34A 2DYRC 4WFEA 3CYOA 3SPJA 2FTKA 1YITV 3K79A 1Q86W 1JX9A 4BIZA 3EHBB 3JD3A 2M7WA 2P6JA 4J9YB 2DQ0A 3ZMSA 3OFNG 4QIWF 2XASA 1M9NA 2XAJA 1VQ8V 1VQNV 4WFGA 1K9MW 3ASNB 2HG5C 1FXKA 4N23A 4QE9A 4RQEA 1Q7YW 1MABG 1M56B 4WFFA 4JYCA 5CN0A 3E89A 1KP3A 4F4LA 1Y66A 1JCHA 5CBFA 4CBCA 5H6QA 1S5HC 1GM7A 5LHIA 1N8RW 4UVCA 1WPXA 5KUKA 5LHHA 1AI7A 1SESA 1F23A 3F7YC 2ZXWC 3E35A 2XOKG 3SYOA 3SPCA 2EILB 1AI5A 2DYSC 3CCQV 2X6BA 4JAVA 2IU0A 3RW0A 3K04A 2UXXA 1ENVA 3ZCCA 3E8BA 1VQLV 2X6CA 5FL7G 5DM6V 4PA7A 3R65A 1DLBA 1KKDA 1CPYA 3CC7V 3LUTB 4E2LA 2EJRA 3LSQA 2JK5C 2HJFC 4R6ZA 4ZBMA 3SJQC 3ZRWA 3ABLB 4MTGA 2EIMB 4I9WA 4LBEC 4DO2A 5CBGA 1K8AW 2EIMC 3ABLC 3LDEA 5H9CA 3B77A 4MT8A 2WLHA 1S76D 1S3JA 2EZOA 4UUJC 2HVJC 2XNDG 4FPPA 2ZDIA 4XDKA 1K3EA 2LFRA 3HB3B 3ZMTA 2K1EA 2JEUA 3SYPA 3OW2U 2ZR2A 1Y4MA 3F5WC 4WFAV 1OCZB 4CZZA 1SERA 4P9PA 1E1RG 3AG3C 1ORQC 1YI2V 4PA3A 2PI5A 1PNKA 4I5SA 1EFRG 3OMNB 3TCUA 4RAIA 1BHBA 1CP9A 4YXWG 1NVPB 5EK0A 4MTFA 4R7CA 2DW4A 3CCLV 1Q82W 3CCUV 2WLJA 3QO5A 3AG2C 4PDRA 2BOCC 3AG3B 1FFTB 4MTOA 5B1NA 1F4NA 4TT3G 5HFMA 1QR9A 1P7BA 1VQOV 2HLDG 1KQSU 2EIJB 1AJNA 4UV8A 4U7OA 3SPIA 2ZD9A 1OCCC 4FK5C 1SZTA 5LHGA 4PA9A 1RPOA 1SETA 1K97A 3CXCU 1S72V 1VQ5V 4ASUG 1V55C 4GX0A 1R6KA 5B1AC 1IXMA 1QLEC 1QCEA 1OCRC 4MVUA 4LCUC 1NJIW 2QE7G 3K3WA 2UXNA 2ZQMA 3D36A 3I56V 1OCZC 1AR1B 2YEVA 3ZN1A 3OGCC 3ZMZA 1QVFU 5B3SB 3CCJV 5L3CA 3IFXA 2WAMA 5EBMC 3E86A 1YTFB 1GKFA 2DWDC 3FYIB 3ABUA 5CA3A 1J95A 1NH2B 1JPXA 3T4ZA 3E83A 2AHYA 2EILC 3B8MA 1W0JG 3P30A 2OT5A 5B3SC 5L3GA 1AI4A 2ZXWB 2GSMB 3OAAG 1KC8W 1M90W 3W7SA 2OCCB 1YHQV 5LGNA 1Q81W 1NR7A 1H8EG 3ETEA 4MS2A 2H8PC 2HFEC 1GM8A 1V54B 5HFLA 1KD1W 4MW8A 1M57B 2HKOA 5L3FA 2B1GA 5EC1C 1KECA 2EIKC 1FXHA 2WLIA 2WWWA 1ROPA 3RBZA 3CPWU 5C93A 4R50A 4JTCB 3F7VC 4JTDB 1AJQA 2V7QG 4H37A 1VQ7V 4PDMA 3DGEA 2WPDG 4DXWA 2QM8A 3ZRVA 5IYCO 4JPRA 3FB5C 4PDLA 2PI4A 1GK9A 3SYCA 1HWYA 1W0KG 1ZWIC 3ABMB 4GX5A 4MVQA 1PKXA 4QPKA 4TSFG 4FIPC 4RO2A 3QO7A 4GCZA 2LP7A 5CMUA 3ZMUA 1PNMA 2DWEC 5L3BA 3MD0A 5BZBA 3ABKC 3AG4B 4GT1A 1M56C 3CCVV 1G8MA 2R9RB 2QTOA 3G4SV 4TWKA 2X7RB 1WLEA 2IW5A 1RM1B 1YSCA 4UXNA 2B1IA 4JASA 3AG1C 5B1OA 3BEHA 2A9HA 3ZN0A 1I5XA 4JGSA 3ETGA 1FS0G 3W7UA 5LBQA 2DYRB 2ZR3A 3CMAV 1VQKV 1OCOC 5LGTA 4XDJA 2Q67A 1E79G 3ASOB 2LFSA 4HYOA 2P67A 1YIJV 3QNEA 1VQPV 2ITCC 2XAQA 2NLJC 1R6NA 3CP1A 3X2QB 1VQ9V 2X0LA 4FMTA 3JD0A 2X6AA 1W2BU 3TK1A 3E8GA 3ASOC 1EBOA 4KUMA 4WFBV 1H8HG 1R3KC 1H38A 4KFMA 3JCZA 3FB7C 2WLKA 1COWG 3JD2A 2W0FC 3QO8A 3E8FA 2Z5UA 4X88A 4HAMA 4MVZA 3AG1B 3ZRWB 1NR1A 3OE7G 4PA4A 1SRYA 3IC7A 3I55V 1JJ2U 5H6RA 2DQ3A 2Y69C 5E1AC 1FXKB 2D3OW 2V1DA 1GO3F 1QR8A 3AG4C 5DN6G 3X2QC 4RUEA 4MVSA 1NH2D 1K5QA 4FJCC 4X8AA 1QLNA 2QM7A 1CEZA 1DF4A 3UM7A 5L3DA 4XDLA 3WG7B 4P30A 1YJWV 4QNHB 3DTUB 5KUMA 5KA5A 2YEVB 3OMAB 1GMGA 3ZRSA 5IYBO 3LSSA 4MSWC 3B8NA 4UVAA 2EZPA 3E8HA 1TUEB 2Z3YA 3MHSC 2EIJC 4PDVA 2IU3A 2JEXA 4P2ZA 1R73A 2Q6AA 3ML0A 3OUFA 4X89A 1F4MA 4HZ3A 3D3IA 4JAUA 3AG2B 3K06A 3T4DA 3WFVA 3WG7C 2OTLV 1AROP 4G27B 1K92A 1BMFG 3E2EA 1FXVA 2HR3A 4BW5A 3CD6V 3W7WA 3FB8C 4G2KA 5B1BB 2JJ2G 2XAHA 3OR7C 4OXSA 5L3EA 4LC1A 4QPJA 1YJ9V 1QBZA 3NXSA 3SPGA 2WLIB 1P4RA 4EKWA 3OMIB 1UJWB 3SYAA 1JOYA 2Y69B 4LP8A 2ZDIC 3CCSV 2WSSG 2QEXV 2A79B 4U7NA 1VQ6V 4PELA 3FYEB 1S0VA 2WLNA 2IJKA 4H33A 3LDCA 4RQFA 2BOBC 1QVGU 3TETA 4ZKIA 4L87A 4XBFA 3OEEG 3A0RA 3SPHA 5CBHA 1K7DA 2EINC 3CC4V 1V54C 5B1BC 1OZ0A 3JD1A 2JJ1G 4GX1A 3BY6A 1JVMA 4QE7A 1OCRB 4MTXA 2ATKC 2P90A 4BAYA 1THZA 3OR6C 3ZJZA 1R3LC 2EINB 2JDIG 2QKSA 1BHAA 3G6EV 4MVMA 4MW3A 1MG1A 4MVOA 3STLC 3AEIA 1PL0A 1YJNV 1AJPA 1OCOB 4JTAB 1NKDA 1VQ4V 1G4YB 2P7TC 1OCCB 2JIZG 3JYCA 5KA6A 2WLMA 1F51A 2IH1C 1RM1C 3T2MA 3EFFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E89 A;  2W0F C;  4F4L A;  3E8F A;  4G28 B;  5EC2 C;  1K4C C;  4X88 A;  5CBF A;  1OCZ C;  2YEV A;  4MVZ A;  3OGC C;  4CBC A;  1S5H C;  4PA4 A;  3RVY A;  3IFX A;  4RUF A;  5EBM C;  2Y69 C;  1XL4 A;  3E86 A;  4P9O A;  5E1A C;  2DWD C;  5EBW C;  1R3J C;  5KUK A;  1J95 A;  3F7Y C;  2ZXW C;  3T4Z A;  3E83 A;  2AHY A;  2EIL C;  1BL8 A;  3PJS K;  5EBL C;  3AG4 C;  3SPC A;  3SYO A;  5B3S C;  3X2Q C;  2DYS C;  4RUE A;  4MVS A;  2X6B A;  3RW0 A;  3K04 A;  4X8A A;  3E8B A;  2X6C A;  1KKD A;  4PA7 A;  3R65 A;  3ABM C;  4MVR A;  3LUT B;  3UM7 A;  4XDL A;  3GB7 C;  4J9Z B;  4P30 A;  2JK5 C;  4MS2 A;  2HJF C;  4QNH B;  2H8P C;  4R6Z A;  4ZBM A;  2HFE C;  5KUM A;  3SJQ C;  3SYQ A;  3T1C A;  2WLL A;  4R8C A;  2KB1 A;  3ZRS A;  1R3I C;  2IH3 C;  4MW8 A;  2Q69 A;  4MSW C;  2Q68 A;  2AHZ A;  3E8H A;  4MTG A;  2EIK C;  2WLI A;  4I9W A;  4LBE C;  2EIJ C;  4PDV A;  5EC1 C;  2HVK C;  3RBZ A;  1M57 C;  2EIM C;  5CBG A;  3ABL C;  3LDE A;  4P2Z A;  4R50 A;  2Q6A A;  3F7V C;  4JTC B;  4JTD B;  4H37 A;  2WLH A;  3HPL C;  3OUF A;  4PDM A;  4X89 A;  5J9P C;  4GX2 A;  4HZ3 A;  4DXW A;  3LNM B;  3K0G A;  4UUJ C;  3FB5 C;  3K06 A;  3OUS A;  3FB7 C;  4PDL A;  3IGA C;  3T4D A;  2HVJ C;  5IY5 C;  3WG7 C;  3K0D A;  3SYC A;  1ZWI C;  4G27 B;  2OCC C;  4XDK A;  4GX5 A;  4MVQ A;  2K1E A;  3SYP A;  4BW5 A;  1LNQ A;  3VOU A;  3FB8 C;  2WLL B;  1XL6 A;  3KG2 A;  3F5W C;  3OR7 C;  4RO2 A;  4OXS A;  4P9P A;  3SPG A;  2DWE C;  2WLI B;  1ORQ C;  3AG3 C;  4EKW A;  4PA3 A;  5BZB A;  3SYA A;  3ABK C;  4LP8 A;  2A0L A;  3TCU A;  1M56 C;  4RAI A;  2R9R B;  2A79 B;  2QTO A;  3FB6 C;  5EK0 A;  4TWK A;  4MTF A;  4WFH A;  4R7C A;  2WLN A;  1K4D C;  4H33 A;  3LDC A;  2BOB C;  2WLJ A;  3TET A;  3AG1 C;  4PA6 A;  3AG2 C;  4PDR A;  2BOC C;  2ITD C;  3BEH A;  4MTO A;  2A9H A;  3LDD A;  5CBH A;  3SPH A;  2EIN C;  3UKM A;  1V54 C;  5B1B C;  4QE7 A;  1P7B A;  4GX1 A;  1JVM A;  1OCO C;  3K08 A;  3STZ C;  3RVZ A;  3ASN C;  3K03 A;  2ATK C;  3SPI A;  4XDJ A;  2Q67 A;  2ZD9 A;  2DYR C;  1OCC C;  3OR6 C;  4WFE A;  3ZJZ A;  1R3L C;  2QKS A;  4HYO A;  3SPJ A;  4MVM A;  4PA9 A;  4MW3 A;  4MVO A;  3STL C;  2ITC C;  4J9Y B;  2NLJ C;  4JTA B;  1V55 C;  4GX0 A;  2X6A A;  1G4Y B;  3E8G A;  5B1A C;  2P7T C;  3ASO C;  4WFG A;  3JYC A;  1QLE C;  2HG5 C;  2WLM A;  1OCR C;  4QE9 A;  4MVU A;  2IH1 C;  1R3K C;  4LCU C;  4WFF A;  3EFF K;  3T2M A;  4KFM A;  2WLK A; 
#chains in the Genus database with same CATH topology
 3A0B Z;  5D5P A;  4G28 B;  1K4C C;  1TVK B;  2IJJ A;  1IBL B;  4NXN B;  3OEH G;  4X1Y A;  3VBB A;  4RUF A;  5EIB D;  3RYC A;  2V4D A;  3ABK B;  5EBW C;  1R3J C;  4LF7 B;  3TXQ A;  2XAF A;  3OTO O;  2LGW A;  1PD3 A;  3ABT A;  2GBO A;  4NXM O;  3CCR V;  3CEI A;  3ABM C;  2XAG A;  3GB7 C;  1PNL A;  2VRZ A;  4EFB A;  5LYJ B;  1JQ0 A;  1R3I C;  1XMQ B;  2Q69 A;  4JI0 O;  1ZTE A;  1DTO A;  2B5U A;  1N32 B;  2W6I G;  4LFA O;  3ETD A;  3K57 A;  1FD9 A;  4BIU A;  4PI0 A;  1WA8 A;  4DW0 A;  4JI4 O;  4IT5 A;  1VF7 A;  2IJI A;  1FXK C;  1LNQ A;  1URF A;  4CH4 A;  2PF4 E;  1XL6 A;  2OTJ V;  2NR5 A;  4YIO A;  1LUV A;  3JAW A;  5GON A;  4JAA A;  2Y4T A;  4H13 B;  3T1H O;  2F4V O;  1SKV A;  1TVK A;  2GHY A;  4QJF B;  4J7K A;  2YDE A;  4DR4 B;  5A9G A;  1NT2 B;  5LGU A;  4DK0 A;  5IY5 B;  1Q90 D;  3OM3 B;  1QLE B;  1YTF D;  4CH3 A;  1R6T A;  2EBO A;  3UKM A;  5GW7 A;  4GZR B;  1K5S A;  3RVZ A;  3K03 A;  2Q5Z A;  5DEC A;  1FJG B;  3RGB A;  1Q6U A;  1N0J A;  4PV1 B;  3J80 N;  4X62 B;  5AG2 A;  4DR3 B;  1M9N A;  1VQN V;  2EJ7 A;  4WFG A;  4X20 A;  3ZBH A;  4N23 A;  1H2M A;  4JYC A;  4J7J A;  3CE2 A;  4RWU A;  5CBF A;  1GM7 A;  5LHI A;  1I94 B;  4UVC A;  4B3S B;  4UCV A;  1WPX A;  2ZXW C;  4F6R B;  3Q4H A;  3RFR A;  1DK1 A;  2BCC H;  2CGO A;  2X6B A;  2P4K A;  4OPA A;  1SQQ H;  1YVW A;  1KKD A;  1DLB A;  1CPY A;  2JK5 C;  2HJF C;  2YIA A;  5E79 Z;  4ZHQ A;  4YY3 O;  2DN9 A;  2KG7 A;  5J2T A;  1YDX A;  2QTS A;  1WA8 B;  5JVD B;  4LBE C;  5JQG A;  1GAX A;  1Y74 A;  2JRI A;  4GUN A;  3M8A A;  4J42 A;  3HKE B;  2XND G;  1TUB A;  4FPP A;  1IVS A;  4NXN O;  3AK2 A;  2GV9 A;  5CB4 B;  4XDK A;  3HB3 B;  4DYL A;  3SYP A;  3OW2 U;  1RP3 B;  4O4H A;  4CZZ A;  4P9P A;  1ORQ C;  1YI2 V;  4B7K A;  1PNK A;  2OIE A;  1P49 A;  1P7G A;  1BHB A;  1CP9 A;  5EK0 A;  1QHT A;  4MTF A;  2DW4 A;  2BTQ A;  1D5A A;  3SJC C;  1HP8 A;  4IGG A;  1SQX H;  4TV9 B;  5B1N A;  4TT3 G;  1P7B A;  1KQS U;  2ODM A;  3SPI A;  2ZD9 A;  2JGD B;  2XUM A;  3AK3 A;  1TGO A;  3CXC U;  4E4E A;  1S72 V;  3HKB B;  5JCO A;  1JR9 A;  1QLE C;  1SQV H;  4LF6 O;  2E74 B;  3D36 A;  4DR7 B;  2WAM A;  1GKF A;  2DOS A;  3FYI B;  1NH2 B;  3RT3 C;  4O4L B;  3E83 A;  2BTO A;  5LXT B;  2VS0 A;  4KHP B;  5LGN A;  1Q81 W;  3ETE A;  3JAT A;  1GM8 A;  4X1Y B;  1M57 B;  1U96 A;  1TUB B;  4X9Q A;  2A7W A;  1FXH A;  1ROP A;  4TV9 A;  1HNX B;  1XBL A;  1IBK O;  4R50 A;  1D2D A;  4JTD B;  4H37 A;  4LF4 B;  5IYC O;  4JPR A;  4PDL A;  1WB8 A;  4BW9 A;  2HHH B;  3CRQ A;  3ZED A;  4UCO A;  3ABM B;  4MVQ A;  4DR2 O;  4PD4 F;  1BE3 H;  1H2S B;  4DV7 O;  1NTK H;  5CMU A;  3ZMU A;  2DWE C;  3C3S A;  4O2B B;  3G4S V;  4TWK A;  4DK1 A;  2PGG A;  4KL1 A;  1RSO B;  3QTC A;  4UXN A;  3BAB A;  4U3F H;  3IJ4 A;  3G6B A;  5B1O A;  2HP8 A;  4JGS A;  1M4U A;  3ETG A;  1ZLZ A;  1AR4 A;  5LBQ A;  2DYR B;  3CMA V;  3FX7 A;  5LGT A;  2YI8 A;  4UFZ A;  3ASO B;  4CH6 A;  2P67 A;  3QNE A;  4JI5 B;  1VQP V;  2ITC C;  3B09 A;  1R6N A;  3JAT B;  2DMX A;  1H2K A;  5C8Y B;  5JWP A;  2X6A A;  3QG5 A;  1W2B U;  3ASO C;  1ZAU A;  4FLT A;  1J5E O;  4DR3 O;  2AW9 A;  4B3R O;  1H38 A;  3JD2 A;  3E8F A;  5IJ0 A;  1D5N A;  4X88 A;  5H2F Z;  3ZRW B;  1NR1 A;  4PA4 A;  2ADP A;  3JSL A;  2V1D A;  1U97 A;  4CC5 A;  2PYJ A;  4IL6 Z;  3X2Q C;  5B66 Z;  5LMU O;  4RUE A;  4ICG A;  4FLY A;  2Q9L A;  4FJC C;  2QM7 A;  2QWR B;  2ARH A;  2Q73 A;  3HKC B;  3UM7 A;  4P30 A;  4JYA O;  5IYB O;  3U10 A;  4TQF A;  2PTM A;  1WNS A;  2OWO A;  4PDV A;  2CTQ A;  4ZHQ B;  4X66 O;  1QQC A;  1F4M A;  4LFC O;  1XI1 A;  4FLV A;  3K06 A;  4EEQ A;  4JI5 O;  1Q6H A;  2OTL V;  1V9P A;  4G27 B;  1FXV A;  2N74 A;  1BCC H;  3SJA C;  4BW5 A;  1BZK A;  3W7W A;  4G2K A;  5B1B B;  1J5E B;  2XAH A;  4OXS A;  4LC1 A;  4JYA B;  3K5M A;  1P4R A;  4O4I A;  5JJN B;  2ZDI C;  3CCS V;  4FM2 A;  1VQ6 V;  1I08 A;  4J11 A;  1WJZ A;  3HKE A;  1B04 A;  4H33 A;  3L73 H;  1F7Y A;  3LDC A;  3U11 A;  4ZKI A;  4X20 B;  1HW7 A;  4EB6 B;  1WPB A;  2Y0P A;  5JJJ B;  5CBH A;  3SPH A;  1K7D A;  1V54 C;  3RYH A;  1JVM A;  1IDS A;  4BAY A;  1MA1 A;  4LF5 B;  3OR6 C;  3ZJZ A;  2DE0 X;  2F4V B;  4MVM A;  4LF9 O;  3N27 A;  3AEI A;  3HR0 A;  1AJP A;  1OCO B;  4JI6 B;  1BQ0 A;  2P7T C;  1OCC B;  1HNX O;  4B3S O;  1XMO O;  4W4L A;  3T2M A;  1FKA O;  5IJ9 A;  4K3A A;  1L1F A;  2ZIO A;  5CA0 A;  4OGQ B;  3RVY A;  5LP6 A;  3IAY A;  1OHH G;  2LQT A;  4P9O A;  1XL4 A;  2MK3 A;  3HKC A;  4JZG A;  4UVB A;  3TGU H;  2Y48 A;  4TV8 A;  3CC2 V;  3PJS K;  1BL8 A;  4IIJ A;  2LW7 A;  3S3X A;  1N34 O;  4MVR A;  2LGQ A;  3ZHT A;  4J9Z B;  1I5Y A;  3R66 A;  3T1C A;  1NVP D;  1N36 O;  5IJ0 B;  2GTA A;  1BGY H;  4R8C A;  4DV0 O;  1VQM V;  3D8C A;  2AHZ A;  3STZ C;  1ZUQ A;  4IHJ B;  3G71 V;  2HVK C;  2E5L O;  4EB6 A;  1VF6 A;  1MOF A;  3K58 A;  3ZS8 C;  2YC0 A;  1AVM A;  3M99 B;  1XOU A;  4GX2 A;  3LNM B;  5IY5 C;  3RN4 A;  4N21 A;  3W7X A;  3K0D A;  2YIB D;  1M1K W;  2M6Y A;  4TOI A;  2QWN B;  3VOU A;  5IYD O;  3KG2 A;  4B7E A;  3CX5 F;  3JAS A;  4DV0 B;  1Z5V A;  5EZY A;  2AXT Z;  5K1P A;  2QSA A;  2OIG A;  4WF9 V;  3L9D A;  5LA6 B;  3FB6 C;  3K5L A;  1WP8 A;  3H01 A;  1AI6 A;  4Q20 A;  3K9S A;  3WU2 Z;  4PA6 A;  2CE4 A;  3CME V;  3E22 B;  3FKS G;  2WA4 A;  2H94 A;  2PZS A;  1K33 A;  1K73 W;  3KZI Z;  2F1M A;  3CYO A;  3K79 A;  1Q3E A;  4J9Y B;  2DQ0 A;  3ZMS A;  3Q4H B;  3RYF B;  3BHP A;  3OFN G;  4QIW F;  2XAS A;  2RMK B;  2UXB B;  1VMG A;  3JAL A;  2RQ6 A;  4DRX B;  1MAB G;  1AIL A;  1M56 B;  2QWP B;  4WFF A;  5CN0 A;  5KMG A;  3E89 A;  4DUY B;  1FJG O;  4DV3 O;  1O9H A;  2QR4 A;  4O4J B;  1IX9 A;  4CBC A;  1N8R W;  2P5O A;  2ZM6 B;  1AI7 A;  3F7Y C;  3E35 A;  2XOK G;  2E5L B;  3SPC A;  4U3J B;  2EIL B;  3CCQ V;  2IU0 A;  3K04 A;  2UXX A;  4TUY B;  3E8B A;  3JAS B;  5KHK A;  5FL7 G;  2ZE6 A;  4PA7 A;  1GH6 A;  2ZNJ A;  5EIB C;  5F2V O;  4ZBM A;  2CGN A;  2ILM A;  2JGU A;  1YCI A;  1FFX B;  3L71 H;  2L35 A;  1RFY A;  2CTW A;  1K8A W;  2EIM C;  4DV6 O;  4K0K O;  3LDE A;  4DR1 B;  4DV1 O;  4MT8 A;  2H3O A;  1S76 D;  1MNG A;  4UUJ C;  1UPG A;  2ZDI A;  5FPO A;  1MSD A;  2K1E A;  2JEU A;  3J81 N;  4JI0 B;  2PYL A;  1SER A;  1E1R G;  4DRX A;  2ZT9 B;  1GN4 A;  2PI5 A;  2RDC A;  4YIP A;  3OMN B;  3TCU A;  4RAI A;  2ADQ B;  4DV5 O;  2O57 A;  3CCL V;  5J2U B;  4AI8 A;  4I4T A;  3QO5 A;  1I7F A;  2BOC C;  1F4N A;  5HFM A;  1N33 B;  3SR2 C;  2HJD A;  1QR9 A;  1VQO V;  5IWA B;  3FD9 A;  5EYP B;  2Q7H A;  1KU9 A;  1AJN A;  1VAR A;  3JAM N;  4ZOL A;  3ZHQ A;  5JH7 B;  2P06 A;  3C90 A;  4PA9 A;  1RPO A;  2XT9 A;  4NR1 A;  3N2K B;  5IE9 A;  4ASU G;  4GX0 A;  2WA3 A;  3TJT A;  4NTW A;  5B1A C;  1PM9 A;  3OT7 A;  1IXM A;  1L8D A;  4K0K B;  4A5U B;  1QCE A;  4JI2 B;  2HEP A;  3CB2 A;  2IM9 A;  1M93 A;  1XHX A;  1AR1 B;  2YXH A;  4W4K A;  4I7Z B;  1H2L A;  1SA0 A;  3IFX A;  1YTF B;  4UCS A;  2DWD C;  1JPX A;  2AHY A;  1W0J G;  5L3G A;  2AZ0 A;  3OAA G;  4CS4 A;  3D3Q A;  1YHQ V;  4B3T O;  2YXL A;  1H8E G;  3CJH A;  1WAZ A;  3HKD B;  2HFE C;  4I50 B;  3P3P A;  1CXZ B;  5HFL A;  1KD1 W;  2UUC O;  1XQ8 A;  5EC1 C;  3RBZ A;  1EZV H;  2WWW A;  3JAR A;  3CPW U;  2FYU H;  1QU7 A;  5C93 A;  4IIJ B;  4PDM A;  5TIS Z;  2PI4 A;  2RN9 A;  4J7Z A;  3SYC A;  3L70 H;  2UUA B;  2ZE7 A;  2N05 A;  3QO7 A;  4GCZ A;  4ZI7 A;  1FFX A;  3MD0 A;  5BZB A;  4YJ3 B;  3ABK C;  3AG4 B;  1M56 C;  1G8M A;  2QTO A;  2ZCE A;  4OX9 B;  2X7R B;  4O2A A;  2E76 B;  2B1I A;  2Y0I A;  4JAS A;  2A9H A;  3ZN0 A;  3IC9 A;  3KKY A;  4AQY B;  4ABM A;  1FS0 G;  3O65 A;  3W7U A;  1OCO C;  2YUA A;  3VQW A;  3DXR A;  4XDJ A;  1E79 G;  2LFS A;  4HYO A;  2QKC A;  2HHH O;  4X65 O;  1KKC A;  3X2Q B;  4FMT A;  1IBK B;  4WFB V;  1H8H G;  1R3K C;  2WLK A;  3AG7 A;  4GKK O;  2Z5U A;  4LR3 A;  4FLX A;  2QJ1 A;  1US6 A;  1KB9 F;  3IC7 A;  3I55 V;  3SDL A;  5H6R A;  4FLW A;  1VP7 A;  4LF4 O;  2XTA A;  4DR5 O;  1QR8 A;  3RYF A;  2D2C B;  5C8Y A;  2GUZ B;  1NH2 D;  4MVS A;  2UU9 B;  1QLN A;  2F23 A;  4OX9 O;  3JAR B;  4J80 A;  1HNW B;  4XDL A;  3WG7 B;  5FLX N;  4QNH B;  5KUM A;  5BY1 A;  3OMA B;  1GMG A;  3GVM A;  3AK1 A;  4MSW C;  4UVA A;  2EZP A;  1TUE B;  3MHS C;  2CTR A;  5LMN B;  2EIJ C;  3K59 A;  1XMO B;  4DV5 B;  1G1X B;  2Q6A A;  4DR5 B;  2ZKO A;  4BIO A;  5LXT A;  1EN4 A;  3D36 C;  4HZ3 A;  3D3I A;  3AG2 B;  3BFR A;  4NYK A;  3WFV A;  5GTH Z;  4NB5 A;  3EVK A;  4DV3 B;  3HKD A;  3FB8 C;  1KMI Z;  4QPJ A;  5A2Q N;  4I55 B;  1Y76 A;  2FML A;  1UJW B;  4LP8 A;  5KX5 A;  2JS3 A;  2QEX V;  2A79 B;  4DV4 O;  4B3T B;  1HNW O;  4X64 B;  3FYE B;  4DR6 B;  4B3M O;  4RQF A;  2RNB A;  2QM4 A;  1YF2 A;  2CH7 A;  1Q6I A;  3OEE G;  3A0R A;  1B06 A;  4GKJ O;  1OZ0 A;  4QE7 A;  4MTX A;  2VQE O;  2ATK C;  1THZ A;  1R3L C;  4O4I B;  3ZHR A;  3CWB H;  1YJN V;  1PL0 A;  4O4L A;  3T1Y O;  2CAZ C;  2YXY A;  4UCT A;  2W0X A;  3NR7 A;  4GYC B;  3APQ A;  4X1K B;  4ZOL B;  4NKG B;  5GON B;  1F51 A;  2IH1 C;  1SQB H;  3EFF K;  2F43 G;  5EC2 C;  1S5L Z;  4YJ2 A;  1R1B A;  3ZHU A;  1NQT A;  1GM9 A;  1NZ6 A;  5J2U A;  3UCS C;  4JF3 A;  2Y4U A;  2Q7G A;  3EXA A;  1H2G A;  2FKX A;  1MZF A;  4ZIB A;  4JI1 O;  2ETN A;  1QNM A;  1E1Q G;  3JD4 A;  4O2B A;  1XNQ B;  4HNA A;  4H0L B;  3JAK B;  5BR8 O;  3ZMV A;  3SYQ A;  2W6J G;  2WLL A;  3ZRX A;  2IH3 C;  5CA0 B;  3GWO A;  2Q68 A;  1GTO A;  1M57 C;  2KSD A;  4UV9 A;  1KP2 A;  2L6L A;  1AB3 A;  4I50 A;  5J9P C;  3U0Z A;  4X62 O;  3K0G A;  4PHZ A;  1Y76 B;  4NTX A;  2R9I A;  2C2A A;  3OGI B;  4K8X A;  3L74 H;  2VQE B;  2N04 A;  3DC6 A;  3BCC H;  3KCX A;  1N33 O;  3CCM V;  3MHH C;  2A0L A;  3S3W A;  4JYY A;  1HR0 O;  4PI2 A;  3CCE V;  1PL4 A;  5JQG B;  4JYB A;  1YZB A;  1MSW D;  4I0X A;  2QA4 V;  5B1A B;  4D7S A;  2DYR C;  4YJ3 A;  2FTK A;  1JX9 A;  4BIZ A;  3JD3 A;  1A32 A;  4CC6 A;  1TAE A;  4FFK A;  2P6J A;  5LOV B;  2UXD B;  1GRJ A;  2LJ2 A;  4JI2 O;  4K8Z A;  4CS2 A;  1OV9 A;  3B2E E;  1LUW A;  1AR5 A;  2XAJ A;  4DR1 O;  1K9M W;  1UFI A;  2HG5 C;  1FXK A;  1Q7Y W;  3BVO A;  1ZL8 A;  1LR1 A;  3E22 A;  1KP3 A;  1Y66 A;  4JI4 B;  5H6Q A;  3SGI A;  2QGN A;  4X66 B;  5KUK A;  4LFB B;  3SYO A;  4J41 A;  1AI5 A;  3QVN A;  4JAV A;  3RW0 A;  3ZCC A;  1XRE A;  1VQL V;  4D6T H;  2X6C A;  5D5Q A;  5LL6 Y;  3R65 A;  5KLV H;  4YHH B;  3LUT B;  3ETQ A;  1JFF A;  4E2L A;  3LSQ A;  3BA8 A;  4R6Z A;  3A8T A;  3SJB C;  4F6E A;  4DO2 A;  3L75 H;  3CSX A;  4TV8 B;  2E3C A;  3ABL C;  3FAV A;  5H9C A;  4DUZ B;  2WLH A;  2YIC A;  1S3J A;  1L0N H;  4X1I A;  2HVJ C;  3JAW B;  1VIB A;  1K3E A;  2LFR A;  5LOV A;  1WN7 A;  5FNV A;  1N4C A;  3F5W C;  4DR2 B;  4WFA V;  1OCZ B;  3UO3 A;  3AG3 C;  4PA3 A;  1EFR G;  1NVP B;  3CRM A;  4KHP O;  1VF5 B;  2A3Q A;  3CCU V;  2LO1 A;  3KCY A;  3UO2 A;  4PDR A;  5IWA O;  3AG3 B;  1FFT B;  2YIB A;  2PUS A;  3H1H H;  3BPZ A;  2G38 A;  3APO A;  4JI8 B;  2EIJ B;  1Q8I A;  4U7O A;  1OCC C;  3CRA A;  5CA1 A;  4GKK B;  1Q5O A;  4X64 O;  2CH7 B;  1SET A;  1K97 A;  3P3N A;  1V55 C;  5BMV B;  4LWS B;  1R6K A;  2Q0O C;  2UXB O;  3K5O A;  5JVD A;  3K3W A;  5KHH A;  1MZE A;  2RCV A;  1OCZ C;  3ZN1 A;  2IBZ H;  3OGC C;  1O9G A;  4J10 A;  3F5T A;  4AQY O;  1ZSP A;  2EIL C;  4IYH A;  2OT5 A;  2ZXW B;  1M90 W;  4JV5 B;  3W7S A;  2OCC B;  1XNR B;  1Y74 B;  1NR7 A;  2H8P C;  1N34 B;  2JS5 A;  1V54 B;  4H44 B;  4JV5 O;  4MW8 A;  2HKO A;  4I55 A;  2B1G A;  3DSQ A;  1FAF A;  2CUG A;  3I5D A;  5JCO C;  4JTC B;  2V7Q G;  3H1L H;  2WPD G;  1GN3 A;  4CH5 A;  1XUQ A;  2QM8 A;  4DXW A;  3C3T A;  2UXD O;  1GK9 A;  4JZ2 A;  1HWY A;  1W0K G;  1ZWI C;  3A0H Z;  1PKX A;  2QWQ B;  2VQF B;  2ZE8 A;  4FIP C;  1N36 B;  4JI6 O;  4YY3 B;  3RYI A;  1EN5 A;  2LW1 A;  3B40 A;  4LNU A;  1T5E A;  1DGS A;  1WLE A;  1SZX A;  2IW5 A;  3OD4 A;  1HR0 B;  5LMU B;  1YSC A;  4DV2 B;  2AZ2 A;  4WBN A;  1BS3 A;  1M5I A;  1I5X A;  1I0H A;  3VQY A;  1I94 O;  2ZR3 A;  1Z5W A;  2QDO A;  2Q67 A;  1YIJ V;  5FPR A;  1GN6 A;  2XAQ A;  2NLJ C;  3RYH B;  2Q4P A;  3JD0 A;  5DED A;  3E8G A;  3TK1 A;  1N32 O;  2EUL A;  3JCZ A;  1KUQ A;  4I0X B;  3JAK A;  3QO8 A;  5EYP A;  4LF6 B;  4MVZ A;  3OE7 G;  1SRY A;  1JJ2 U;  2DQ3 A;  5E1A C;  1FXK B;  4LH7 A;  3MAQ A;  3AG4 C;  3THO A;  1K5Q A;  1Z2G A;  2R9A A;  1YJW V;  3DTU B;  4YHH O;  4QGP A;  2YEV B;  5KA5 A;  3LSS A;  3B8N A;  3E8H A;  5EZY B;  2Z3Y A;  1YEW A;  2BSK A;  2IU3 A;  1ZL8 B;  3QF7 A;  4AIL C;  1R73 A;  5LA6 A;  2R70 A;  3ML0 A;  3OUF A;  3H9V A;  4JAU A;  1HNZ O;  3T4D A;  4HBN A;  1W59 A;  5LP6 C;  3WG7 C;  5JH7 A;  4JI7 B;  4UCU A;  2B9Z A;  1K92 A;  1BMF G;  2Q8V A;  3E2E A;  2HR3 A;  3CD6 V;  3B4S A;  4B3R B;  1BQZ A;  2JJ2 G;  3OR7 C;  1RSO A;  1VF6 C;  1YJ9 V;  3NXS A;  3SPG A;  4BWA A;  2WLI B;  3OMI B;  3SYA A;  2Y69 B;  1HNZ B;  2Q0A A;  2WSS G;  4B3M B;  1XNR O;  1XEQ A;  4AHC A;  3G67 A;  2BE3 A;  5IYZ B;  3K5N A;  2IJK A;  1S5J A;  1AP5 A;  2BOB C;  3TET A;  4L87 A;  4XBF A;  3BY6 A;  4O4J A;  1KBH A;  1XHZ A;  2P90 A;  1TA8 A;  5IT9 N;  5CB4 A;  2EIN B;  2QKS A;  4DUY O;  4MW3 A;  1MG1 A;  4MVO A;  4JI1 B;  1NKD A;  1VQ4 V;  3ZHS A;  2NN4 A;  4TUY A;  3JYC A;  1WB7 A;  5KA6 A;  4CS3 A;  4WBN B;  1RM1 C;  3L72 H;  4FLU A;  1IBL O;  2DJV A;  4DW1 A;  2Z0A A;  1XDC A;  1RPR A;  3GWK C;  2QWO B;  5EBL C;  3H1I H;  4Z1M G;  5ITZ B;  4WCE V;  3ZIA G;  2P4V A;  4LF8 O;  4NTY A;  4IYI A;  5KHG A;  2CDY A;  3CRC A;  1IBM B;  2FB5 A;  1EZJ A;  1SC5 B;  2A06 H;  1XNQ O;  1FYJ A;  2KB1 A;  1SS3 A;  4YJ2 B;  5KHI A;  3MDS A;  4Z1V A;  1N0N A;  2EIK B;  3WB0 A;  4KP4 A;  5IDJ A;  4LF7 O;  1X59 A;  3HPL C;  2GUZ A;  3K9A A;  1JMK C;  3OUS A;  3IGA C;  3H1K H;  2OCC C;  4LF5 O;  5KAF Z;  1DF5 A;  2IJH A;  4D7T A;  3J7A U;  3P32 A;  2WLL B;  4FZ0 A;  3W7T A;  4O2A B;  1NBM G;  2DYS B;  2OYQ A;  1NTZ H;  1S77 D;  4WFH A;  1K4D C;  3A2F A;  1FPO A;  2YSU B;  1JJO A;  3VQV A;  1P84 F;  4JI8 O;  2NNU A;  2ITD C;  3LDD A;  1V55 B;  2CK3 G;  1B6Q A;  3K08 A;  3ASN C;  1K34 A;  4WFE A;  4I4T B;  3SPJ A;  1YIT V;  1Q86 W;  5KAI Z;  4JI7 O;  3EHB B;  2EX3 A;  2M7W A;  1OJH A;  1WP7 A;  1VQ8 V;  5GTI Z;  3ASN B;  4QE9 A;  4RQE A;  4IHJ A;  3RYI B;  1JFF B;  2UUB O;  2P22 C;  2KQX A;  4F4L A;  2PY5 A;  1EN6 A;  1JCH A;  1SQF A;  2KG7 B;  1S5H C;  1GN2 A;  4DUZ O;  5LHH A;  1SES A;  1F23 A;  2OCH A;  2Q7E A;  3LSU A;  2DYS C;  3BRC A;  4X65 B;  2YS8 A;  4X1K A;  3N2G A;  1ENV A;  1SA0 B;  5DM6 V;  3T1H B;  3CC7 V;  5KX5 B;  2EJR A;  3SJQ C;  3UT5 B;  3CHX A;  3ZRW A;  4O4H B;  3ABL B;  4MTG A;  2EIM B;  4I9W A;  5CBG A;  2QKA A;  3B77 A;  4TQD A;  4LNU B;  2EZO A;  3OTF A;  4FM1 A;  4LFA B;  1JA8 A;  3ZMT A;  2ZR2 A;  1Y4M A;  3DXR B;  4GLX A;  4B08 A;  3O9O A;  4UB6 Z;  4I5S A;  1X4T A;  4DV2 O;  3FAV B;  4DR4 O;  4YXW G;  4LWS A;  4Q6G A;  4R7C A;  1Q43 A;  4X1I B;  4EFE A;  1Q82 W;  2WLJ A;  3RYC B;  4L8J A;  1BSM A;  3AG2 C;  4MTO A;  1G6U A;  3CXH F;  1Y67 A;  2UXC B;  4KXR A;  5FNV B;  2HLD G;  1NU1 H;  5IYZ A;  4UV8 A;  1PV0 A;  2GDS A;  4FK5 C;  3ZX6 A;  1SZT A;  5LHG A;  3PN1 A;  1VQ5 V;  4DV1 B;  2E75 B;  4ZI7 B;  4FLZ A;  1OCR C;  4JI3 O;  4MVU A;  4LCU C;  1NJI W;  2QE7 G;  2UXN A;  2ZQM A;  3I56 V;  2YEV A;  3WB2 A;  1QVF U;  3ZMZ A;  5LYJ A;  5B3S B;  3CCJ V;  5L3C A;  5EBM C;  3E86 A;  1ZX3 A;  2BSK B;  3ABU A;  5CA3 A;  1J95 A;  4NXM B;  3T4Z A;  3HKB A;  3B8M A;  1L0L H;  3P30 A;  5B3S C;  1AI4 A;  2VWK A;  2GSM B;  1KC8 W;  3TXS A;  5KHJ A;  3OTO B;  3WB1 A;  1H2N A;  3H1J H;  4MS2 A;  3CRR A;  1AP6 A;  5LP6 B;  2UXC O;  1XIL A;  3ZHV A;  5L3F A;  2F95 B;  1KEC A;  2EIK C;  2WLI A;  5BXZ A;  2VQF O;  1VQ7 V;  3F7V C;  1AJQ A;  3DGE A;  3ZRV A;  1Y6X A;  3FB5 C;  2XHB A;  4GX5 A;  3VQX A;  4QPK A;  4TSF G;  2UUA O;  4RO2 A;  2LP7 A;  1PNM A;  5L3B A;  2YI9 A;  5B5E Z;  2JVD A;  5H5N A;  4GT1 A;  3CCV V;  2R9R B;  1SQP H;  1PP9 H;  3BAA A;  4DV4 B;  1RM1 B;  3RWR D;  3AG1 C;  1EM1 A;  3BEH A;  2R72 A;  4GKJ B;  2UUC B;  1XMQ O;  2ZE5 A;  3FFQ A;  1VQK V;  5BR8 B;  4FZ1 A;  4DR6 O;  4C7U A;  1VEW A;  2GTS A;  1MMM A;  1VQ9 V;  3CJH B;  3CP1 A;  4F6R A;  2X0L A;  2VWJ A;  5JJE B;  2MW2 B;  4FM0 A;  5J2T B;  1EBO A;  5ITZ A;  4KUM A;  2CTP A;  4LH6 A;  3T1Y B;  2RJZ A;  3BA9 A;  4KFM A;  1PPJ H;  3FB7 C;  1COW G;  2W0F C;  1NI8 A;  2YID A;  4HAM A;  3AG1 B;  2AGA A;  3JSN A;  2Y69 C;  2D3O W;  3ICX A;  4I9Q A;  4LF8 B;  1GO3 F;  3JCU Z;  2ZIN A;  3N2K A;  1B3Q A;  5DN6 G;  3UQ8 A;  4LFB O;  4X8A A;  4PJ0 Z;  1CEZ A;  1DF4 A;  1BT8 A;  2F66 C;  3G80 A;  5L3D A;  5KMG B;  3M7M X;  4FFB A;  2ZNI A;  3CS5 A;  4BR6 A;  3ZRS A;  3JAL B;  3N2G B;  4UCR A;  1SQG A;  3LNN A;  2JEX A;  4HNA B;  4NVP A;  4P2Z A;  1KYO F;  4X89 A;  4U3J A;  2ZM6 O;  2BTQ B;  1NS1 A;  4LF9 B;  2JGD A;  1ARO P;  2KKW A;  4K35 A;  2FL4 A;  4DV7 B;  1HDJ A;  5LMN O;  2UUB B;  3UT5 A;  5BMV A;  2F93 B;  5L3E A;  1QBZ A;  4EKW A;  1JOY A;  5CA1 B;  2K9P A;  4U7N A;  4PEL A;  1S0V A;  2WLN A;  4DV6 B;  2ZIM A;  1QVG U;  1SF9 A;  3DC5 A;  5IJ9 B;  3CC4 V;  1IZ3 A;  2EIN C;  1NTM H;  5B1B C;  3JD1 A;  2JJ1 G;  4GX1 A;  1OCR B;  1IBM O;  2JDI G;  4FVM A;  2UU9 O;  1BHA A;  3G6E V;  1IUR A;  3STL C;  4FFB B;  4LFC B;  4JI3 B;  4UB8 Z;  4JTA B;  4Z2W A;  1G4Y B;  1YXB A;  2JIZ G;  4OPH A;  2WLM A;  5K1X A;  4DR7 O;  1IXB A; 
#chains in the Genus database with same CATH homology
 1L1F A;  2F43 G;  4G28 B;  5EC2 C;  1K4C C;  2IJJ A;  3OEH G;  1NQT A;  3RVY A;  3VBB A;  1GM9 A;  1OHH G;  4RUF A;  1RPR A;  4JF3 A;  3ABK B;  1XL4 A;  2MK3 A;  4P9O A;  4UVB A;  5EBW C;  2Y48 A;  1R3J C;  2XAF A;  1H2G A;  3CC2 V;  3PJS K;  5EBL C;  1BL8 A;  1PD3 A;  3ABT A;  4Z1M G;  4WCE V;  3ZIA G;  3CCR V;  3ABM C;  1E1Q G;  3JD4 A;  2XAG A;  4MVR A;  3GB7 C;  4J9Z B;  1EZJ A;  1I5Y A;  3ZMV A;  3T1C A;  1NVP D;  1PNL A;  3SYQ A;  2W6J G;  2WLL A;  4R8C A;  2KB1 A;  1JQ0 A;  1R3I C;  2IH3 C;  3ZRX A;  2Q69 A;  3GWO A;  2Q68 A;  1VQM V;  2AHZ A;  1GTO A;  3STZ C;  3G71 V;  1DTO A;  2B5U A;  1M57 C;  2EIK B;  2HVK C;  2W6I G;  4KP4 A;  4UV9 A;  5IDJ A;  1MOF A;  1KP2 A;  3ETD A;  3HPL C;  3M99 B;  5J9P C;  3K9A A;  4GX2 A;  3LNM B;  3K0G A;  3OUS A;  4BIU A;  3IGA C;  5IY5 C;  4N21 A;  3W7X A;  3K0D A;  1M1K W;  2R9I A;  2C2A A;  2OCC C;  1DF5 A;  2IJH A;  1FXK C;  1LNQ A;  2IJI A;  3VOU A;  5IYD O;  3P32 A;  2WLL B;  1XL6 A;  3KG2 A;  3W7T A;  2OTJ V;  1NBM G;  3CCM V;  2DYS B;  3MHH C;  2A0L A;  4WF9 V;  1S77 D;  3FB6 C;  3H01 A;  4WFH A;  2GHY A;  4QJF B;  1K4D C;  1AI6 A;  2YSU B;  4Q20 A;  5LGU A;  3CCE V;  5IY5 B;  4JYB A;  2NNU A;  4PA6 A;  2ITD C;  1MSW D;  3OM3 B;  1QLE B;  1YTF D;  3CME V;  3LDD A;  2EBO A;  1V55 B;  3FKS G;  3UKM A;  2QA4 V;  2CK3 G;  5B1A B;  5GW7 A;  1B6Q A;  2H94 A;  3K08 A;  1K5S A;  3RVZ A;  3ASN C;  3K03 A;  1K33 A;  1K73 W;  1K34 A;  2DYR C;  4WFE A;  3CYO A;  3SPJ A;  2FTK A;  1YIT V;  3K79 A;  1Q86 W;  1JX9 A;  4BIZ A;  3EHB B;  3JD3 A;  2M7W A;  2P6J A;  4J9Y B;  2DQ0 A;  3ZMS A;  3OFN G;  4QIW F;  2XAS A;  1M9N A;  2XAJ A;  1VQ8 V;  1VQN V;  4WFG A;  1K9M W;  3ASN B;  2HG5 C;  1FXK A;  4N23 A;  4QE9 A;  4RQE A;  1Q7Y W;  1MAB G;  1M56 B;  4WFF A;  4JYC A;  5CN0 A;  3E89 A;  1KP3 A;  4F4L A;  1Y66 A;  1JCH A;  5CBF A;  4CBC A;  5H6Q A;  1S5H C;  1GM7 A;  5LHI A;  1N8R W;  4UVC A;  1WPX A;  5KUK A;  5LHH A;  1AI7 A;  1SES A;  1F23 A;  3F7Y C;  2ZXW C;  3E35 A;  2XOK G;  3SYO A;  3SPC A;  2EIL B;  1AI5 A;  2DYS C;  3CCQ V;  2X6B A;  4JAV A;  2IU0 A;  3RW0 A;  3K04 A;  2UXX A;  1ENV A;  3ZCC A;  3E8B A;  1VQL V;  2X6C A;  5FL7 G;  5DM6 V;  4PA7 A;  3R65 A;  1DLB A;  1KKD A;  1CPY A;  3CC7 V;  3LUT B;  4E2L A;  2EJR A;  3LSQ A;  2JK5 C;  2HJF C;  4R6Z A;  4ZBM A;  3SJQ C;  3ZRW A;  3ABL B;  4MTG A;  2EIM B;  4I9W A;  4LBE C;  4DO2 A;  5CBG A;  1K8A W;  2EIM C;  3ABL C;  3LDE A;  5H9C A;  3B77 A;  4MT8 A;  2WLH A;  1S76 D;  1S3J A;  2EZO A;  4UUJ C;  2HVJ C;  2XND G;  4FPP A;  2ZDI A;  4XDK A;  1K3E A;  2LFR A;  3HB3 B;  3ZMT A;  2K1E A;  2JEU A;  3SYP A;  3OW2 U;  2ZR2 A;  1Y4M A;  3F5W C;  4WFA V;  1OCZ B;  4CZZ A;  1SER A;  4P9P A;  1E1R G;  3AG3 C;  1ORQ C;  1YI2 V;  4PA3 A;  2PI5 A;  1PNK A;  4I5S A;  1EFR G;  3OMN B;  3TCU A;  4RAI A;  1BHB A;  1CP9 A;  4YXW G;  1NVP B;  5EK0 A;  4MTF A;  4R7C A;  2DW4 A;  3CCL V;  1Q82 W;  3CCU V;  2WLJ A;  3QO5 A;  3AG2 C;  4PDR A;  2BOC C;  3AG3 B;  1FFT B;  4MTO A;  5B1N A;  1F4N A;  4TT3 G;  5HFM A;  1QR9 A;  1P7B A;  1VQO V;  2HLD G;  1KQS U;  2EIJ B;  1AJN A;  4UV8 A;  4U7O A;  3SPI A;  2ZD9 A;  1OCC C;  4FK5 C;  1SZT A;  5LHG A;  4PA9 A;  1RPO A;  1SET A;  1K97 A;  3CXC U;  1S72 V;  1VQ5 V;  4ASU G;  1V55 C;  4GX0 A;  1R6K A;  5B1A C;  1IXM A;  1QLE C;  1QCE A;  1OCR C;  4MVU A;  4LCU C;  1NJI W;  2QE7 G;  3K3W A;  2UXN A;  2ZQM A;  3D36 A;  3I56 V;  1OCZ C;  1AR1 B;  2YEV A;  3ZN1 A;  3OGC C;  3ZMZ A;  1QVF U;  5B3S B;  3CCJ V;  5L3C A;  3IFX A;  2WAM A;  5EBM C;  3E86 A;  1YTF B;  1GKF A;  2DWD C;  3FYI B;  3ABU A;  5CA3 A;  1J95 A;  1NH2 B;  1JPX A;  3T4Z A;  3E83 A;  2AHY A;  2EIL C;  3B8M A;  1W0J G;  3P30 A;  2OT5 A;  5B3S C;  5L3G A;  1AI4 A;  2ZXW B;  2GSM B;  3OAA G;  1KC8 W;  1M90 W;  3W7S A;  2OCC B;  1YHQ V;  5LGN A;  1Q81 W;  1NR7 A;  1H8E G;  3ETE A;  4MS2 A;  2H8P C;  2HFE C;  1GM8 A;  1V54 B;  5HFL A;  1KD1 W;  4MW8 A;  1M57 B;  2HKO A;  5L3F A;  2B1G A;  5EC1 C;  1KEC A;  2EIK C;  1FXH A;  2WLI A;  2WWW A;  1ROP A;  3RBZ A;  3CPW U;  5C93 A;  4R50 A;  4JTC B;  3F7V C;  4JTD B;  1AJQ A;  2V7Q G;  4H37 A;  1VQ7 V;  4PDM A;  3DGE A;  2WPD G;  4DXW A;  2QM8 A;  3ZRV A;  5IYC O;  4JPR A;  3FB5 C;  4PDL A;  2PI4 A;  1GK9 A;  3SYC A;  1HWY A;  1W0K G;  1ZWI C;  3ABM B;  4GX5 A;  4MVQ A;  1PKX A;  4QPK A;  4TSF G;  4FIP C;  4RO2 A;  3QO7 A;  4GCZ A;  2LP7 A;  5CMU A;  3ZMU A;  1PNM A;  2DWE C;  5L3B A;  3MD0 A;  5BZB A;  3ABK C;  3AG4 B;  4GT1 A;  1M56 C;  3CCV V;  1G8M A;  2R9R B;  2QTO A;  3G4S V;  4TWK A;  2X7R B;  1WLE A;  2IW5 A;  1RM1 B;  1YSC A;  4UXN A;  2B1I A;  4JAS A;  3AG1 C;  5B1O A;  3BEH A;  2A9H A;  3ZN0 A;  1I5X A;  4JGS A;  3ETG A;  1FS0 G;  3W7U A;  5LBQ A;  2DYR B;  2ZR3 A;  3CMA V;  1VQK V;  1OCO C;  5LGT A;  4XDJ A;  2Q67 A;  1E79 G;  3ASO B;  2LFS A;  4HYO A;  2P67 A;  1YIJ V;  3QNE A;  1VQP V;  2ITC C;  2XAQ A;  2NLJ C;  1R6N A;  3CP1 A;  3X2Q B;  1VQ9 V;  2X0L A;  4FMT A;  3JD0 A;  2X6A A;  1W2B U;  3TK1 A;  3E8G A;  3ASO C;  1EBO A;  4KUM A;  4WFB V;  1H8H G;  1R3K C;  1H38 A;  4KFM A;  3JCZ A;  3FB7 C;  2WLK A;  1COW G;  3JD2 A;  2W0F C;  3QO8 A;  3E8F A;  2Z5U A;  4X88 A;  4HAM A;  4MVZ A;  3AG1 B;  3ZRW B;  1NR1 A;  3OE7 G;  4PA4 A;  1SRY A;  3IC7 A;  3I55 V;  1JJ2 U;  5H6R A;  2DQ3 A;  2Y69 C;  5E1A C;  1FXK B;  2D3O W;  2V1D A;  1GO3 F;  1QR8 A;  3AG4 C;  5DN6 G;  3X2Q C;  4RUE A;  4MVS A;  1NH2 D;  1K5Q A;  4FJC C;  4X8A A;  1QLN A;  2QM7 A;  1CEZ A;  1DF4 A;  3UM7 A;  5L3D A;  4XDL A;  3WG7 B;  4P30 A;  1YJW V;  4QNH B;  3DTU B;  5KUM A;  5KA5 A;  2YEV B;  3OMA B;  1GMG A;  3ZRS A;  5IYB O;  3LSS A;  4MSW C;  3B8N A;  4UVA A;  2EZP A;  3E8H A;  1TUE B;  2Z3Y A;  3MHS C;  2EIJ C;  4PDV A;  2IU3 A;  2JEX A;  4P2Z A;  1R73 A;  2Q6A A;  3ML0 A;  3OUF A;  4X89 A;  1F4M A;  4HZ3 A;  3D3I A;  4JAU A;  3AG2 B;  3K06 A;  3T4D A;  3WFV A;  3WG7 C;  2OTL V;  1ARO P;  4G27 B;  1K92 A;  1BMF G;  3E2E A;  1FXV A;  2HR3 A;  4BW5 A;  3CD6 V;  3W7W A;  3FB8 C;  4G2K A;  5B1B B;  2JJ2 G;  2XAH A;  3OR7 C;  4OXS A;  5L3E A;  4LC1 A;  4QPJ A;  1YJ9 V;  1QBZ A;  3NXS A;  3SPG A;  2WLI B;  1P4R A;  4EKW A;  3OMI B;  1UJW B;  3SYA A;  1JOY A;  2Y69 B;  4LP8 A;  2ZDI C;  3CCS V;  2WSS G;  2QEX V;  2A79 B;  4U7N A;  1VQ6 V;  4PEL A;  3FYE B;  1S0V A;  2WLN A;  2IJK A;  4H33 A;  3LDC A;  4RQF A;  2BOB C;  1QVG U;  3TET A;  4ZKI A;  4L87 A;  4XBF A;  3OEE G;  3A0R A;  3SPH A;  5CBH A;  1K7D A;  2EIN C;  3CC4 V;  1V54 C;  5B1B C;  1OZ0 A;  3JD1 A;  2JJ1 G;  4GX1 A;  3BY6 A;  1JVM A;  4QE7 A;  1OCR B;  4MTX A;  2ATK C;  2P90 A;  4BAY A;  1THZ A;  3OR6 C;  3ZJZ A;  1R3L C;  2EIN B;  2JDI G;  2QKS A;  1BHA A;  3G6E V;  4MVM A;  4MW3 A;  1MG1 A;  4MVO A;  3STL C;  3AEI A;  1PL0 A;  1YJN V;  1AJP A;  1OCO B;  4JTA B;  1NKD A;  1VQ4 V;  1G4Y B;  2P7T C;  1OCC B;  2JIZ G;  3JYC A;  5KA6 A;  2WLM A;  1F51 A;  2IH1 C;  1RM1 C;  3T2M A;  3EFF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...