1ZWIC

Structure of mutant kcsa potassium channel
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1zwiC00
2H8PC 2EINC 4X89A 5KUMA 3VOUA 3T1CA 5EC1C 2ZXWC 3K03A 2HG5C 4PA4A 1JVMA 2X6CA 2Q68A 4MW8A 3SPHA 2W0FC 4BW5A 2IH1C 3K0GA 4P30A 5EBLC 2A9HA 3LDCA 3R65A 4WFHA 2P7TC 1BL8A 3AG2C 2EIJC 4PA9A 2WLNA 3E89A 3SPGA 2WLMA 4RO2A 3UM7A 4JTDB 2DWEC 2EILC 2QKSA 4CBCA 4QNHB 4MVQA 2DWDC 4PA3A 3K06A 2IH3C 3FB7C 3JYCA 1V55C 4PDMA 5B1AC 2R9RB 2EIMC 3FB6C 4RAIA 5EBMC 3SYAA 3OR6C 2ZD9A 2EIKC 1P7BA 2WLIA 4RUEA 3FB5C 4WFEA 3ZJZA 3OR7C 4MVZA 4MTGA 4OXSA 5EK0A 3T2MA 4X88A 3RVYA 2BOBC 2QTOA 4HZ3A 4P9OA 4MVMA 2WLJA 3OUFA 2HVKC 4MTFA 3STZC 1M57C 1KKDA 3E83A 4PA6A 1OCRC 1K4DC 1S5HC 2WLLA 4LBEC 5CBFA 4WFFA 5EC2C 3F5WC 4QE7A 2NLJC 3E8BA 3K08A 4XDJA 3SYCA 2WLLB 4XDKA 4LP8A 4DXWA 1R3IC 4RUFA 4GX1A 4P9PA 4EKWA 3K0DA 4I9WA 5E1AC 4PDRA 5IY5C 3SPIA 3SYPA 2ITDC 4P2ZA 4H33A 2Y69C 3HPLC 3ZRSA 4PA7A 3OGCC 1J95A 4H37A 2AHZA 3T4DA 1ORQC 2AHYA 3LDEA 3ABMC 3BEHA 3ASNC 2WLIB 2WLKA 4J9ZB 2DYSC 5J9PC 4R6ZA 1XL4A 4R7CA 3F7YC 1R3LC 1R3JC 3SPJA 2BOCC 3AG3C 4MW3A 3E8FA 3AG4C 3K04A 2A0LA 4KFMA 3KG2A 3STLC 2Q6AA 4HYOA 2WLHA 3AG1C 3E86A 1M56C 1QLEC 1R3KC 4G28B 1G4YB 5EBWC 4X8AA 3SPCA 3UKMA 1OCOC 1OCZC 4PDLA 2X6AA 3IGAC 4WFGA 3IFXA 4J9YB 1OCCC 3ABLC 3SJQC 4ZBMA 4MTOA 4R50A 2HFEC 1V54C 3ABKC 4TWKA 4UUJC 5CBHA 2ATKC 2YEVA 5KUKA 4LCUC 1XL6A 3OUSA 3F7VC 4MS2A 4R8CA 3RW0A 4JTCB 2HVJC 2JK5C 4G27B 4MVOA 2OCCC 5BZBA 1K4CC 3TCUA 4MVUA 2Q69A 4JTAB 3LNMB 2ITCC 3RBZA 3SYQA 3SYOA 3RVZA 4MVSA 1ZWIC 2K1EA 3EFFK 3WG7C 4PDVA 2Q67A 4QE9A 4XDLA 2A79B 3E8HA 1LNQA 3X2QC 2X6BA 5B1BC 5CBGA 2DYRC 2KB1A 3E8GA 3GB7C 3LDDA 4F4LA 5B3SC 3LUTB 4GX0A 4GX5A 2HJFC 4GX2A 4MSWC 4MVRA 3TETA 3T4ZA 3FB8C 3ASOC 3PJSK
chains in the Genus database with same CATH superfamily
1XNQO 5LHHA 3QO7A 1WB8A 5EBLC 5CB4B 4WFHA 2EIJC 4IHJB 3ABLB 4YY3B 3PN1A 4RO2A 1HP8A 4I4TB 2QKSA 4O2BA 2DWDC 3ZMUA 1NR1A 4RQEA 1V55C 4PDMA 3DC5A 4DUYB 3N2KA 3QF7A 1H2GA 5LYJB 1K34A 1GK9A 2PF4E 2QM8A 1JFFB 2G38A 4FK5C 1D2DA 4X66O 2QTOA 2BTQA 4ZHQB 3A8TA 5B1BB 4KL1A 3MD0A 5LHGA 1PNLA 5B66Z 5EC2C 4DRXB 1M1KW 5FNVB 3F5WC 1BZKA 5BR8B 4X65O 3D3QA 3ZHSA 1M4UA 2ILMA 2OTJV 2QKAA 4RUFA 3JAKA 2ITDC 5DM6V 4H37A 4TV9A 3LDEA 3UO2A 1HNWB 2AGAA 2VQEB 1R1BA 2XUMA 3AG4C 1NKDA 1S5JA 4X9QA 1XUQA 2X7RB 1G6UA 1KP2A 3STLC 4JI8B 4K35A 2GBOA 2F1MA 2HR3A 2QWOB 1ZLZA 3ML0A 4O4HA 5KHKA 3K5MA 4HAMA 5IYCO 5IJ0A 1SF9A 5CA3A 1AI5A 1HR0O 4QJFB 4JYYA 4DK0A 3N2GB 1OJHA 1DLBA 4NXNO 1UFIA 1XREA 1R6NA 1VQOV 3UO3A 3GB7C 4KXRA 3AEIA 2OT5A 1R6TA 3WB2A 2H8PC 3T1CA 4YHHB 3RWRD 4B3TB 1B06A 2IU3A 5BXZA 4FFKA 3R65A 2IJHA 4DV6B 3UM7A 2DW4A 5LBQA 1H2LA 4MVQA 3RN4A 1VMGA 1PV0A 1S5LZ 1O9HA 2ZD9A 1SQFA 1P7BA 3W7UA 4UB8Z 1JA8A 4OXSA 2Q5ZA 3HB3B 1J5EB 3X2QB 5L3CA 1B6QA 3E83A 3ZHUA 3ASOB 5KMGA 4FZ1A 2XTAA 3SJAC 1KECA 3K08A 4D6TH 1JX9A 1KB9F 4JF3A 1H8EG 1YCIA 1RFYA 3HKEB 3L71H 1DF5A 1QVFU 3CYOA 3T4DA 3ABMC 3ASNC 4LFAO 1VF7A 3F7YC 3FYIB 1S76D 1F4NA 4ZI7A 3E8FA 2P22C 2A0LA 5KA6A 5EIBC 1XNRB 3JASB 1E79G 2YUAA 3JATA 1P84F 3UKMA 2W0XA 1X59A 1IBLO 3RFRA 4ZBMA 3ZHTA 1GN4A 3CCMV 3G80A 2XNDG 3DXRA 1LUWA 1ZTEA 5FPOA 3GWKC 2HVJC 3CXCU 2JK5C 4FLVA 2OCCC 4JI4B 4LF8O 2EX3A 1NTMH 4RQFA 2FL4A 4UCUA 3F5TA 2Z0AA 5L3DA 1KMIZ 2X6BA 2BSKB 3JD3A 1N33B 4DR1B 4LFCO 2BCCH 1M9NA 1TUBA 2RQ6A 4UXNA 5CA1B 4AQYO 1K9MW 1SQVH 1GM7A 2X6CA 2W0FC 3OTOB 2XAQA 3K59A 4ZIBA 2UXDB 4LF5O 3DGEA 4JPRA 3E22A 1E1RG 2JEUA 2LGWA 4X1KA 4QPJA 2CGNA 4PELA 3FAVA 3VQWA 2HVKC 5IJ9A 4FLZA 5LA6A 2NR5A 3BFRA 2D3OW 4B08A 2NLJC 3JD0A 2ZXWB 1SC5B 4X62O 3JAWA 2H3OA 5L3EA 3MAQA 1NI8A 5LP6B 1VQ7V 2ZINA 1TVKB 3ZRSA 4I9QA 1L1FA 5LL6Y 2QE7G 3BAAA 1QNMA 1SQXH 3K5OA 5C8YA 2Q6AA 2GV9A 1M56C 1XHZA 1IURA 3THOA 4O4JA 1THZA 3QNEA 5IWAB 2X6AA 4GT1A 2EZOA 1QVGU 5F2VO 5LXTB 4MTOA 4FFBB 3HKBA 1VQ4V 2UU9B 3ZCCA 1IDSA 1FJGO 3OUSA 3QG5A 4B3MB 3WB1A 3EFFK 4LC1A 1K3EA 2JGUA 4RWUA 5IDJA 2Q7HA 1PNKA 3AG3B 3CC4V 3OAAG 4GX0A 2Y4UA 3ZRWB 3I55V 3T4ZA 5GTIZ 3L9DA 5EYPB 3K03A 4PA4A 5KAIZ 1QR9A 4UB6Z 4CS2A 5IYZB 3BY6A 2WLMA 4H44B 1WLEA 2ADPA 1GTOA 2JGDB 1VF6A 3JALB 4RAIA 1H2KA 2ZQMA 3RGBA 3AG1B 5JH7A 2WLJA 5H5NA 2DYRB 1M57C 1OHHG 1K7DA 2WLLA 4DYLA 4UCTA 3G67A 4WF9V 1PP9H 4NXMB 4DXWA 4G2KA 2RJZA 1NS1A 1VQKV 1T5EA 1SETA 1AP5A 1CEZA 4H33A 1G8MA 5J2UA 4FM0A 1I94B 4HNAA 3CEIA 1SQGA 2CTRA 2WLIB 3RYIB 1WP7A 2YI9A 4R7CA 2UUCO 3FD9A 4DK1A 4FPPA 3K04A 4X64B 1RM1C 1HDJA 1HNXO 4CC6A 1QU7A 1R3KC 2ZE5A 4WCEV 4TOIA 4YIPA 1WPXA 4X1IB 3MHHC 4JI5O 3K58A 4J80A 4MS2A 4O2AA 2IU0A 3K9AA 3CCQV 4LNUA 3LNMB 3OMAB 2LGQA 5KHGA 1XDCA 3B8NA 3CHXA 1N4CA 3G6BA 4DR7B 3D36C 5KHJA 3JD4A 4DV3B 2CUGA 1RP3B 1NH2B 2M7WA 4O4LB 2EINC 4X89A 5KUMA 4F6EA 2IJIA 2LJ2A 1NU1H 3ZIAG 2P06A 1FXKB 2HLDG 1OCZB 3T1YO 1K8AW 1S0VA 2DMXA 4DV7B 5JVDB 2OWOA 1R73A 2YEVB 4KP4A 5DEDA 4CH4A 2ZNJA 4YJ2B 2HHHO 1MOFA 2IJKA 4CBCA 4CS3A 3A0BZ 5LOVB 3VBBA 3K5LA 2Q0AA 2EIKC 4Q20A 3UT5A 2Q0OC 4U3JA 4X1YB 4OX9B 1IZ3A 3RVYA 3NXSA 1Y6XA 4HZ3A 1IBMB 2PGGA 5GONB 3OUFA 4JYAO 2MW2B 1Q7YW 1Z2GA 1LR1A 5B3SB 1K4DC 1AP6A 3C3TA 3SDLA 3AK2A 4DR4O 2DQ0A 3AK3A 5J2TA 1MSWD 3BA8A 4XDJA 4NTXA 3CE2A 4ZOLB 2EIJB 3U0ZA 5IY5C 4BWAA 3CRQA 3HPLC 4DR6B 3OGCC 3I56V 3IC9A 4DV0O 1V55B 3B4SA 2DYSC 5LMNO 3L74H 4DV5B 4DW0A 3SR2C 2F4VO 1WPBA 1SA0A 4JV5O 1COWG 1O9GA 3OW2U 3MHSC 3OEEG 2XAJA 1N0NA 2WLHA 4F6RA 3L72H 2XOKG 2O57A 4FJCC 1R6KA 4J9YB 1MZEA 1ZL8B 3D8CA 5AG2A 4TUYB 4R8CA 2ZE8A 4XBFA 2QWPB 1Y74A 5BZBA 2Q8VA 3SYOA 3RBZA 1P49A 5LYJA 4JI6O 1JFFA 3BCCH 1Q6UA 2VWJA 2PI4A 3CRRA 4ZHQA 2KB1A 1KU9A 4MT8A 2LW1A 2LW7A 1AJQA 3CCUV 4B7EA 3TETA 3FB8C 5LGUA 4DRXA 1JVMA 3K5NA 5DN6G 4P30A 4JI2O 1AJNA 3CRAA 2WWWA 3ZS8C 1YJWV 3ZX6A 1Q8IA 4H0LB 3A2FA 2DWEC 2VRZA 5B1OA 3JD1A 3SYAA 4JI3B 2YXYA 2RN9A 4RUEA 4IT5A 1WNSA 2H94A 4P9OA 2VQFO 2AZ0A 2YSUB 1OCRC 1YTFD 2RCVA 1AR1B 1IXBA 3FYEB 4NKGB 2Q4PA 4LWSB 3G4SV 3A0HZ 2F66C 1QLNA 1D5AA 4PDRA 3SPIA 5IE9A 1J95A 2A7WA 3N2GA 5J9PC 4YY3O 2WLKA 4X66B 3TGUH 3SPJA 1YSCA 4ASUG 3IAYA 2VS0A 5D5PA 3KG2A 4DUYO 2IW5A 1JQ0A 1Q90D 1OCOC 1Y4MA 1KUQA 4DR5B 1Q81W 1OCCC 4IGGA 3K9SA 3CJHB 2HFEC 3ABKC 2ADQB 4QGPA 3ZMSA 2PUSA 1KQSU 2ZNIA 4NR1A 5JWPA 1GN3A 1L8DA 2WA3A 3T1HO 3ABMB 3ASNB 1VEWA 4FMTA 2ARHA 5GW7A 1YEWA 2UXCB 2QA4V 2GUZA 3W7SA 1KBHA 4JYCA 5HFMA 2FTKA 2YC0A 2R70A 3SPHA 1OZ0A 1BHAA 2A9HA 4JI8O 3AG2C 4LF7O 4JAAA 1HR0B 1Y67A 3GWOA 4PD4F 3AG7A 2IH3C 3HKEA 4NXNB 3CRCA 2OCCB 3FB5C 3VQYA 2ODMA 4GKJB 4X88A 3N2KB 4ICGA 2F23A 5LHIA 4I0XA 2CE4A 3M99B 1US6A 2CGOA 2WPDG 3OE7G 3U10A 2W6IG 4YJ3B 1BCCH 2FB5A 3ZN0A 3HKCA 4J41A 5LMUB 3P30A 3WG7B 3JAKB 4UVBA 3CC2V 2AHYA 3O9OA 4CH3A 4U7OA 4R6ZA 3OEHG 4DV6O 1GO3F 3RYCA 2L6LA 2KKWA 2QM4A 4EB6A 5CA1A 3ICXA 1N34B 3H1LH 1J5EO 1N32O 1CPYA 2Z3YA 1VQ9V 2KG7B 1FFXA 2ZIMA 3M7MX 2ZDIA 1DK1A 3D3IA 3F7VC 2LFRA 1VP7A 4JTCB 2E5LB 4G27B 1PPJH 2FMLA 4O4HB 1B3QA 1Y76B 2PYJA 1YIJV 5E79Z 5IJ0B 2Q9LA 2XAFA 4PDVA 2A79B 3ABTA 2UUAO 2QKCA 4PI0A 3L75H 4GX5A 1IXMA 1MNGA 2ZE7A 1W2BU 2Z5UA 3PJSK 1M56B 1IBLB 1AJPA 4I50A 4IIJB 2DJVA 2IH1C 1BL8A 2WLNA 1XNRO 5LP6A 1G1XB 4QNHB 1RPOA 1TVKA 4PA3A 3H1KH 5B1AC 5EBMC 3OR6C 3OGIB 1I7FA 4LF6O 3B77A 4IYHA 5EK0A 4LFCB 2BOBC 2ZCEA 3FKSG 3ZHVA 3JCZA 4AQYB 4JI4O 2CH7B 3B2EE 4LFBO 1N33O 4DR1O 1SS3A 1URFA 1F51A 4GX1A 2YICA 1WB7A 4L8JA 4I9WA 3OM3B 1GAXA 2ZT9B 3ABUA 3B8MA 2Q7GA 4PA7A 3OTOO 3LNNA 4MTXA 3BEHA 5IYBO 3ETEA 1R3LC 4TQFA 2BE3A 3ZRWA 4HYOA 1M57B 4W4KA 4G28B 4X62B 2FYUH 3IGAC 1GKFA 3SJQC 3OMIB 3JATB 4TWKA 2LFSA 4WBNA 5JQGB 3EHBB 2JIZG 4LCUC 3ZHQA 1WA8B 2HJDA 3DXRB 2PZSA 4UFZA 3JALA 1NZ6A 2P4KA 3EXAA 1NTKH 4QE9A 4XDLA 1Q86W 3APOA 3DSQA 1EM1A 1K5QA 1D5NA 4D7SA 3S3XA 2QWRB 1JMKC 1SQPH 4MTGA 2YIDA 3FFQA 5FPRA 2EZPA 3KCYA 1TUBB 3RYHB 1FJGB 1XI1A 2CTQA 1IX9A 3H1IH 1FYJA 3E35A 1K92A 1LUVA 1VF5B 3BABA 3FB7C 2EIMC 3FB6C 3APQA 1WN7A 2WLIA 3H1HH 1TUEB 3LSUA 4MVZA 5KHIA 1QR8A 1NTZH 1MABG 4PA6A 5K1XA 1Y66A 2EINB 5IJ9B 5L3FA 4X20A 4K3AA 1Q82W 5JJJB 5CA0B 2EJRA 1SESA 4UVAA 4FLXA 1RSOB 4EKWA 1Q6IA 5DECA 1EZJA 4EEQA 2ZDIC 2ZKOA 3CC7V 3CX5F 1ORQC 3B09A 3QO5A 2EIKB 3CCSV 4UCSA 3JARB 4LF4B 4O4IB 4X8AA 3LSSA 5C8YB 1FXKA 3ETQA 2R72A 3WU2Z 4O4JB 5JVDA 1IBKO 3K57A 2YEVA 1AI4A 2CDYA 5EZYA 1NH2D 1NT2B 3HKBB 1ZX3A 4JI1B 4JTAB 1NR7A 4CH5A 1YJNV 3RYFB 5LP6C 5KX5B 2UUCB 4NXMO 4DUZB 1ZWIC 1K73W 3CCRV 1IVSA 2DYSB 1YXBA 5GONA 4DV2O 4MVRA 3SJCC 4YXWG 4DW1A 3RT3C 2LQTA 2P7TC 3G71V 2B9ZA 2Y69B 3E89A 1JPXA 2D2CB 1XHXA 2EILC 1KP3A 2K9PA 5FL7G 1AROP 4B3RB 2OYQA 3WFVA 3IC7A 3ETDA 2XASA 4DR3O 1VQ8V 1QLEB 4EFBA 4BAYA 2YXHA 1H2SB 2CK3G 1SQBH 4GZRB 5JH7B 5B5EZ 4WFFA 1JCHA 2F95B 4DR7O 4DV4B 1BGYH 3QTCA 2WLLB 2JJ2G 2HHHB 1ZL8A 4J7JA 5BY1A 2HKOA 2A06H 1XMQB 3P3PA 5ITZB 4FZ0A 3DTUB 2Y48A 4DV7O 4UV8A 2PTMA 4J9ZB 4JI0O 4JYAB 4HNAB 2GDSA 2UUBB 2P4VA 3HKDA 4U3FH 3JCUZ 1M93A 3AG1C 3E86A 1H8HG 1OCRB 1EFRG 4OX9O 1I0HA 5L3BA 1EZVH 4TV8A 1V54C 1YDXA 2YDEA 3A0RA 4FM1A 4LH6A 4K0KB 2M6YA 1WAZA 2R9AA 2JDIG 3Q4HB 4KHPB 1VQMV 3ZN1A 2F43G 2ITCC 3FX7A 4GUNA 1N36B 4LNUB 4JV5B 3C3SA 2AXTZ 1AB3A 2EULA 4DR6O 3E8GA 1JJ2U 4DV1O 3LUTB 2XAHA 5A9GA 4GX2A 1AI6A 5CB4A 3BPZA 2UXBB 3WB0A 4IHJA 1YI2V 2Q68A 1OCOB 4I4TA 1BSMA 1OCCB 4PA9A 2KQXA 1H2NA 2AZ2A 3ABKB 1MA1A 4I55B 1FFTB 1VF6C 1SKVA 4GKKO 4JI6B 1GN2A 4LF9B 1QBZA 3I5DA 3AG4B 3ZJZA 2PI5A 3OR7C 1QHTA 2DE0X 4DR2B 2ZM6B 3OMNB 3ZRVA 4WFAV 4GLXA 4JI7O 5FNVA 3ZMZA 4U3JB 3DC6A 1S5HC 2QEXV 1CP9A 2QTSA 1YJ9V 5H9CA 5HFLA 4QE7A 2LO1A 3L73H 1BMFG 4NYKA 1V9PA 3CJHA 4K8XA 2QGNA 4TT3G 1HNZO 4OPHA 5J2TB 5BMVB 3AG2B 4P9PA 1VQNV 3K0DA 3CP1A 4B3SO 1Q43A 5JJEB 1K33A 4FLYA 4JGSA 3JAMN 2QM7A 4JZGA 3CCVV 2P6JA 5H2FZ 3UCSC 1XNQB 3CD6V 5JCOA 2VQFB 3W7XA 4AILC 2E76B 1P4RA 3NR7A 2F93B 1SA0B 2EBOA 1S3JA 1H38A 3L70H 3KZIZ 1NVPB 1VQ6V 1XMOO 2IM9A 4FIPC 4F6RB 1EBOA 4IYIA 1SERA 3H9VA 4UUJC 4WFBV 5EIBD 1XL6A 3RW0A 4MVOA 5LGNA 2ZR3A 3OT7A 3TCUA 3SYQA 1Y74B 3CB2A 4NB5A 5C93A 3KCXA 1LNQA 1UPGA 4X65B 4FLUA 4JZ2A 1B04A 3LDDA 2KSDA 2DOSA 2DQ3A 3J7AU 4BIZA 1I5XA 4PHZA 5BR8O 4YJ3A 3HR0A 4J7ZA 5D5QA 4DR5O 3SGIA 3T1HB 1AI7A 2ZE6A 4EFEA 4FLTA 4UCVA 4J7KA 5H6RA 1N0JA 2OCHA 3CSXA 3P32A 3T2MA 1VIBA 1YHQV 1FS0G 1YTFB 4K8ZA 1HNWO 2VQEO 4ZKIA 1KKDA 1Q3EA 2JRIA 4LBEC 2B1IA 1F7YA 2B5UA 2X0LA 4LF7B 3E2EA 2UXCO 3H1JH 1R3IC 2KG7A 4JAUA 4O2BB 3SYPA 2AW9A 1BQZA 1Y76A 1N8RW 1OV9A 2JJ1G 5B1AB 1ZUQA 4C7UA 4JAVA 2RDCA 3EVKA 2NNUA 1PL4A 3JASA 4MW3A 2LP7A 4I5SA 2BTQB 2XHBA 5GTHZ 4GKJO 3BVOA 4WFGA 4IIJA 3ZMVA 4YHHO 3ABLC 1AR5A 1W59A 4B3TO 4R50A 2Y4TA 5IT9N 1WJZA 1U96A 1M5IA 4BIOA 1L0LH 2YS8A 1FKAO 1FPOA 4TV9B 3UQ8A 5A2QN 2BSKA 3GVMA 2V4DA 5LMUO 1AILA 5B1BC 2A3QA 2N04A 2Q73A 4UVCA 1CXZB 1FAFA 3VOUA 4FLWA 2CH7A 2JS3A 4CC5A 1N32B 1AVMA 3ZRXA 2JS5A 2GUZB 3VQVA 2Y0PA 1GM9A 4LFAB 1N34O 2XT9A 4CZZA 3B40A 2NN4A 2UUAB 5IYDO 4B7KA 2CTPA 2E5LO 2E3CA 4LH7A 5JCOC 3CPWU 1BT8A 5CBFA 4IL6Z 3W7TA 4J10A 2BTOA 4I0XB 4XDKA 3CCEV 5JQGA 4LF8B 1S77D 3P3NA 1P7GA 1H2MA 1WA8A 4P2ZA 4GYCB 1TGOA 3C90A 4LF6B 1JOYA 1PD3A 1VARA 3HKCB 2EIMB 1MSDA 1KKCA 3ZEDA 1A32A 4H13B 1HWYA 1F23A 1HW7A 4LF5B 1ZAUA 2WA4A 3BA9A 3BHPA 3CRMA 1K97A 2QWNB 3RYCB 5LXTA 5KHHA 4LFBB 5KMGB 4FFBA 4KUMA 4TSFG 4EB6B 1M90W 4TQDA 3RYHA 1BQ0A 3OD4A 1GM8A 2UXDO 3MDSA 4BIUA 1GN6A 4UCRA 1FFXB 1E1QG 3SJBC 5LGTA 4MVSA 4AHCA 4I7ZB 3WG7C 4NTWA 3TK1A 4ZI7B 3X2QC 4J11A 5CBGA 3D36A 4F4LA 3K79A 5EYPA 5B1NA 4MSWC 4PV1B 2GHYA 3JSLA 3ASOC 3H01A 2P90A 1PNMA 4N21A 5EC1C 4BR6A 5IYZA 3IJ4A 1SZTA 4MW8A 2CAZC 3K0GA 5CA0A 1MMMA 1VQLV 4PJ0Z 2JGDA 4I50B 1RSOA 2P67A 1XQ8A 1XILA 1GRJA 2EJ7A 1JJOA 1K5SA 3TJTA 4WFEA 2V1DA 1RM1B 1JR9A 4L87A 4PI2A 1FXVA 4UV9A 3JARA 1NJIW 1MG1A 2QWQB 4O4IA 1VQ5V 3CXHF 2QSAA 1BS3A 5IWAO 1GH6A 1QQCA 1XEQA 2HP8A 3E22B 4OGQB 2UU9O 3RYIA 2EILB 2IJJA 3OFNG 4BW9A 2AHZA 3RYFA 4X1KB 5KX5A 2UXNA 4B3MO 2GTSA 1R3JC 1ROPA 2BOCC 3FAVB 2JVDA 1F4MA 1XBLA 2OIGA 3K3WA 2JEXA 3CWBH 4CH6A 1TA8A 5LA6B 4X1IA 2ZIOA 2QDOA 5EBWC 3R66A 3SPCA 4PDLA 5K1PA 3JAWB 3J81N 5KUKA 1SQQH 1K4CC 4WBNB 2XAGA 4MVUA 3J80N 4Z1MG 2K1EA 1WP8A 2Q67A 4UCOA 5CMUA 1ENVA 4Q6GA 4O4LA 2YIAA 2HJFC 1FD9A 3AK1A 2ZXWC 5TISZ 4QIWF 1IBKB 1PL0A 4BW5A 5JJNB 4YJ2A 3ZMTA 5IY5B 3JD2A 4LF4O 3SPGA 5LOVA 1V54B 1DTOA 1PKXA 2GSMB 5ITZA 3K06A 4X1YA 3OTFA 1HNXB 5L3GA 1TAEA 1I94O 2Q7EA 2N74A 3ZBHA 3BRCA 4DV2B 1GMGA 2P5OA 4JI1O 4MTFA 3STZC 1FXHA 1X4TA 4DUZO 4X64O 1MZFA 1Z5WA 4JI5B 3ZHRA 1SZXA 4ZOLA 2N05A 3E8BA 4AI8A 3SYCA 1VQPV 4LP8A 3O65A 4OPAA 1UJWB 3KKYA 3TXSA 2YI8A 4X20B 1Q5OA 1NBMG 1YF2A 2WAMA 3Q4HA 3CMEV 4LR3A 1QCEA 2B1GA 4U7NA 1XL4A 4QPKA 4DR3B 3AG3C 5FLXN 5CN0A 2OTLV 3T1YB 2E75B 1ZSPA 1YZBA 4NTYA 2IBZH 4B3RO 3M8AA 3CMAV 1G4YB 4CS4A 4DV3O 1XOUA 2CTWA 1EN5A 3VQXA 4TUYA 4J42A 2W6JG 1EN4A 1Q6HA 2ATKC 1Z5VA 4I55A 3QO8A 4DV4O 4YIOA 3QVNA 5J2UB 4JI0B 2Q69A 3RVZA 1BE3H 5EZYB 3U11A 4DR4B 3G6EV 2E74B 1YITV 3E8HA 2DN9A 1XMQO 5KLVH 2DYRC 1IBMO 2YIBA 2HG5C 4W4LA 2QJ1A 2UXXA 2UUBO 1KC8W 2RNBA 3LDCA 4DV0B 1DF4A 5BMVA 5LMNB 4ABMA 4FVMA 2QR4A 4O2AB 2F4VB 2YIBD 3CS5A 4JTDB 2PYLA 3CCJV 1YVWA 1RPRA 4Z2WA 2OIEA 3JYCA 2R9RB 1KD1W 1EN6A 2Y0IA 1DGSA 4K0KO 1L0NH 4DV1B 4KHPO 4DV5O 2L35A 4MVMA 4DO2A 1S72V 4A5UB 1N36O 4LWSA 2YXLA 4HBNA 3TXQA 3CCLV 4JYBA 3W7WA 1PM9A 3LSQA 4E2LA 1BHBA 2FKXA 2UXBO 5E1AC 2PY5A 4GKKB 2GTAA 2MK3A 2Y69C 4FM2A 1NVPD 4Z1VA 3UT5B 1AR4A 2ETNA 4JI7B 4E4EA 1W0JG 4KFMA 4JI2B 4LF9O 1QLEC 2C2AA 1W0KG 3HKDB 1FXKC 1OCZC 1U97A 4DR2O 2ZM6O 4NVPA 1HNZB 3IFXA 4JASA 2VWKA 5CBHA 4B3SB 3N27A 2V7QG 2WSSG 4TV8B 3JSNA 2ZR2A 4N23A 2HEPA 3S3WA 5H6QA 2R9IA 5KAFZ 4GCZA 5KA5A 4JI3O 2RMKB 1NQTA 1KYOF 1I08A 1I5YA 1SRYA 5B3SC 4D7TA 3ETGA 1XMOB
chains in the Genus database with same CATH topology
2EINC 4X89A 5KUMA 3VOUA 2IJIA 5LHHA 2EZPA 3QO7A 3ZIAG 1FXKB 2HLDG 1OCZB 3ZRXA 1K8AW 1S0VA 5EBLC 4WFHA 2EIJC 3ABLB 1GM9A 1R73A 3E35A 2YEVB 4KP4A 1K92A 4RO2A 1MOFA 2IJKA 2QKSA 4CBCA 4CZZA 2DWDC 3ZMUA 1NR1A 3FB7C 3VBBA 1V55C 4PDMA 4RQEA 2EIMC 3FB6C 1H2GA 2EIKC 4Q20A 2WLIA 1K34A 5IYDO 1GK9A 2QM8A 1TUEB 4MVZA 4FK5C 3RVYA 3NXSA 2QTOA 4HZ3A 1QR8A 3OUFA 1Q7YW 5B1BB 3CPWU 1MABG 5B3SB 4PA6A 3MD0A 1K4DC 5CBFA 5LHGA 2DQ0A 1PNLA 3W7TA 5EC2C 1M1KW 1Y66A 2EINB 3F5WC 1MSWD 5L3FA 4XDJA 1Q82W 4XDKA 3CCEV 2OTJV 1S77D 2EJRA 1SESA 4UVAA 4RUFA 2EIJB 4EKWA 1EZJA 5IY5C 2ITDC 4P2ZA 3HPLC 2ZDIC 3OGCC 5DM6V 4H37A 1JOYA 1PD3A 3I56V 3CC7V 1ORQC 1V55B 3LDEA 3QO5A 2EIMB 2DYSC 2EIKB 3CCSV 1HWYA 1F23A 3AG4C 1NKDA 1COWG 2X7RB 3OW2U 1KP2A 3STLC 3MHSC 3OEEG 2XAJA 2WLHA 1K97A 4X8AA 3LSSA 4KUMA 4TSFG 2XOKG 2HR3A 1FXKA 4FJCC 1R6KA 4J9YB 1M90W 3ML0A 2YEVA 1AI4A 1GM8A 4HAMA 4R8CA 5IYCO 4XBFA 1NH2D 4BIUA 5CA3A 5BZBA 1AI5A 1E1QG 4QJFB 4JTAB 1NR7A 3RBZA 3SYOA 1YJNV 5LGTA 1DLBA 1ZWIC 4MVSA 1K73W 3CCRV 1R6NA 3WG7C 2DYSB 1VQOV 3TK1A 2PI4A 3X2QC 5CBGA 2KB1A 4MT8A 3D36A 3GB7C 3K79A 5B1NA 4F4LA 1AJQA 4MVRA 3AEIA 4MSWC 3CCUV 2OT5A 2GHYA 3TETA 3FB8C 3ASOC 2H8PC 5LGUA 3H01A 2P90A 4YXWG 3T1CA 1PNMA 4N21A 5EC1C 1JVMA 4MW8A 1SZTA 5DN6G 2IU3A 3K0GA 4P30A 3R65A 1AJNA 2P7TC 2IJHA 2WWWA 3G71V 3E89A 2Y69B 1VQLV 1YJWV 3UM7A 1JPXA 2DW4A 2P67A 5LBQA 2DWEC 2EILC 1KP3A 4MVQA 5B1OA 3JD1A 1K5SA 3SYAA 5FL7G 1AROP 2ZD9A 4RUEA 1P7BA 4WFEA 3W7UA 2V1DA 1RM1B 3WFVA 3IC7A 3ETDA 4L87A 2H94A 4OXSA 1FXVA 2XASA 3HB3B 4P9OA 1QLEB 1VQ8V 4BAYA 3X2QB 4UV9A 5L3CA 1B6QA 2YSUB 2CK3G 1NJIW 3E83A 1MG1A 1OCRC 1YTFD 4WFFA 1JCHA 3ASOB 1VQ5V 1KECA 3K08A 1AR1B 3FYEB 2WLLB 1JX9A 3G4SV 2JJ2G 4JF3A 1H8EG 2HKOA 1QLNA 4PDRA 3SPIA 2EILB 1DF5A 1J95A 2IJJA 3DTUB 3OFNG 1QVFU 2Y48A 3CYOA 2AHZA 4UV8A 3T4DA 4J9ZB 3ABMC 5J9PC 3ASNC 2WLKA 2UXNA 3F7YC 3FYIB 1R3JC 1S76D 1ROPA 3SPJA 1YSCA 2BOCC 4ASUG 1F4NA 3E8FA 2A0LA 5KA6A 1F4MA 3KG2A 3K3WA 2JEXA 3AG1C 3E86A 1H8HG 2IW5A 1E79G 1OCRB 5EBWC 1JQ0A 1EFRG 3SPCA 3UKMA 1OCOC 1Y4MA 4PDLA 1Q81W 5L3BA 1OCCC 4ZBMA 2HFEC 1V54C 3ABKC 3CCMV 2XNDG 5KUKA 3A0RA 2HVJC 3ZMSA 2JK5C 3CXCU 2JDIG 1KQSU 2OCCC 1K4CC 2XAGA 1VQMV 4MVUA 3ZN1A 2F43G 2ITCC 4Z1MG 2K1EA 4RQFA 3ABMB 3ASNB 4FMTA 2Q67A 5CMUA 5L3DA 1ENVA 2X6BA 5GW7A 3ETGA 3JD3A 3E8GA 1JJ2U 3LUTB 2XAHA 2HJFC 4GX2A 2QA4V 1AI6A 3W7SA 1M9NA 4JYCA 4UXNA 5HFMA 2FTKA 1K9MW 1GM7A 1YI2V 2ZXWC 2X6CA 4QIWF 2Q68A 1OCOB 3SPHA 1PL0A 1OZ0A 2W0FC 4BW5A 1BHAA 2XAQA 2A9HA 3ZMTA 5IY5B 3DGEA 1OCCB 3AG2C 4JPRA 4PA9A 3JD2A 3SPGA 1V54B 3ABKB 1DTOA 1PKXA 2GSMB 3GWOA 1FFTB 3K06A 2IH3C 2OCCB 1E1RG 2JEUA 5L3GA 1QBZA 3AG4B 3FB5C 4QPJA 3ZJZA 2PI5A 3OR7C 4PELA 4X88A 3OMNB 1GMGA 3ZRVA 4WFAV 2HVKC 4MTFA 3STZC 3ZMZA 5LHIA 1FXHA 1S5HC 2QEXV 3M99B 1CP9A 1YJ9V 5H9CA 5HFLA 2WPDG 2NLJC 3JD0A 4QE7A 3E8BA 2D3OW 2ZXWB 3SYCA 1VQPV 1BMFG 4LP8A 3OE7G 2W6IG 4TT3G 5L3EA 3AG2B 1UJWB 4P9PA 1VQNV 3K0DA 3CP1A 3ZN0A 1NBMG 1VQ7V 2WAMA 3ZRSA 3CMEV 1K33A 3P30A 4JGSA 3WG7B 4UVBA 3CC2V 2AHYA 2QM7A 3CCVV 1QCEA 4U7OA 2B1GA 2P6JA 3OEHG 4R6ZA 1XL4A 4QPKA 4U7NA 1GO3F 3CD6V 1L1FA 3AG3C 2QE7G 3W7XA 5CN0A 2OTLV 1P4RA 2Q6AA 2EBOA 1M56C 3CMAV 1S3JA 1G4YB 1H38A 1THZA 3QNEA 2X6AA 1NVPB 1VQ6V 4GT1A 4FIPC 2EZOA 1QVGU 1EBOA 2W6JG 4MTOA 1SERA 1CPYA 2Z3YA 4UUJC 1VQ4V 1VQ9V 3ZCCA 2ATKC 4WFBV 2ZDIA 3D3IA 1XL6A 3OUSA 3F7VC 2LFRA 3RW0A 4JTCB 4G27B 4MVOA 3QO8A 5LGNA 2ZR3A 3TCUA 2Q69A 3SYQA 3RVZA 1YIJV 3EFFK 4LC1A 1K3EA 3G6EV 2XAFA 5C93A 4PDVA 5IDJA 2A79B 3ABTA 3E8HA 1YITV 1LNQA 1PNKA 3AG3B 3CC4V 2DYRC 3LDDA 3OAAG 4GX0A 3ZRWB 4GX5A 3I55V 1IXMA 1W2BU 3T4ZA 2Z5UA 3PJSK 1M56B 3K03A 2HG5C 1AJPA 4PA4A 2UXXA 2DQ3A 4BIZA 2IH1C 1I5XA 1QR9A 1KC8W 3LDCA 1BL8A 2WLNA 1DF4A 3BY6A 2WLMA 4JTDB 4QNHB 1RPOA 1WLEA 4PA3A 3CCJV 1RPRA 1GTOA 3JYCA 1AI7A 5B1AC 2R9RB 5EBMC 4RAIA 1KD1W 3OR6C 5H6RA 2ZQMA 3B77A 3P32A 5EK0A 3T2MA 1YHQV 1FS0G 2BOBC 1YTFB 3AG1B 4MVMA 2WLJA 3FKSG 4ZKIA 4DO2A 3JCZA 2DYRB 1M57C 1OHHG 1KKDA 1K7DA 1S72V 2WLLA 4LBEC 2B1IA 2B5UA 4JYBA 3CCLV 2X0LA 3E2EA 3W7WA 4WF9V 3LSQA 4DXWA 4E2LA 4G2KA 1R3IC 4JAUA 1VQKV 1BHBA 1F51A 4GX1A 4I9WA 3OM3B 5E1AC 1SETA 3SYPA 3ABUA 3B8MA 1CEZA 4H33A 2MK3A 2Y69C 1G8MA 4PA7A 4MTXA 1N8RW 1NVPD 2JJ1G 5B1AB 3BEHA 2WLIB 5IYBO 4R7CA 3ETEA 1R3LC 4JAVA 2NNUA 4MW3A 2LP7A 4I5SA 1W0JG 4FPPA 3K04A 4KFMA 1RM1C 3ZRWA 4HYOA 1M57B 1QLEC 1R3KC 4G28B 4WCEV 2C2AA 1W0KG 1FXKC 1OCZC 3IGAC 4WFGA 1GKFA 3IFXA 3ZMVA 1WPXA 3ABLC 3MHHC 3OMIB 4JASA 3SJQC 4R50A 4TWKA 2LFSA 5CBHA 3EHBB 2JIZG 4LCUC 4MS2A 2V7QG 2IU0A 3K9AA 2WSSG 3CCQV 2ZR2A 4N23A 2R9IA 3LNMB 3OMAB 5H6QA 4GCZA 5KA5A 3B8NA 4QE9A 4XDLA 1Q86W 5B1BC 1NQTA 1K5QA 3JD4A 1I5YA 1SRYA 5B3SC 1NH2B 4UVCA 2M7WA 4MTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  2EIN C;  4X89 A;  5KUM A;  3VOU A;  3T1C A;  5EC1 C;  2ZXW C;  3K03 A;  2HG5 C;  4PA4 A;  1JVM A;  2X6C A;  2Q68 A;  4MW8 A;  3SPH A;  2W0F C;  4BW5 A;  2IH1 C;  3K0G A;  4P30 A;  5EBL C;  2A9H A;  3LDC A;  3R65 A;  4WFH A;  2P7T C;  1BL8 A;  3AG2 C;  2EIJ C;  4PA9 A;  2WLN A;  3E89 A;  3SPG A;  2WLM A;  4RO2 A;  3UM7 A;  4JTD B;  2DWE C;  2EIL C;  2QKS A;  4CBC A;  4QNH B;  4MVQ A;  2DWD C;  4PA3 A;  3K06 A;  2IH3 C;  3FB7 C;  3JYC A;  1V55 C;  4PDM A;  5B1A C;  2R9R B;  2EIM C;  3FB6 C;  4RAI A;  5EBM C;  3SYA A;  3OR6 C;  2ZD9 A;  2EIK C;  1P7B A;  2WLI A;  4RUE A;  3FB5 C;  4WFE A;  3ZJZ A;  3OR7 C;  4MVZ A;  4MTG A;  4OXS A;  5EK0 A;  3T2M A;  4X88 A;  3RVY A;  2BOB C;  2QTO A;  4HZ3 A;  4P9O A;  4MVM A;  2WLJ A;  3OUF A;  2HVK C;  4MTF A;  3STZ C;  1M57 C;  1KKD A;  3E83 A;  4PA6 A;  1OCR C;  1K4D C;  1S5H C;  2WLL A;  4LBE C;  5CBF A;  4WFF A;  5EC2 C;  3F5W C;  4QE7 A;  2NLJ C;  3E8B A;  3K08 A;  4XDJ A;  3SYC A;  2WLL B;  4XDK A;  4LP8 A;  4DXW A;  1R3I C;  4RUF A;  4GX1 A;  4P9P A;  4EKW A;  3K0D A;  4I9W A;  5E1A C;  4PDR A;  5IY5 C;  3SPI A;  3SYP A;  2ITD C;  4P2Z A;  4H33 A;  2Y69 C;  3HPL C;  3ZRS A;  4PA7 A;  3OGC C;  1J95 A;  4H37 A;  2AHZ A;  3T4D A;  1ORQ C;  2AHY A;  3LDE A;  3ABM C;  3BEH A;  3ASN C;  2WLI B;  2WLK A;  4J9Z B;  2DYS C;  5J9P C;  4R6Z A;  1XL4 A;  4R7C A;  3F7Y C;  1R3L C;  1R3J C;  3SPJ A;  2BOC C;  3AG3 C;  4MW3 A;  3E8F A;  3AG4 C;  3K04 A;  2A0L A;  4KFM A;  3KG2 A;  3STL C;  2Q6A A;  4HYO A;  2WLH A;  3AG1 C;  3E86 A;  1M56 C;  1QLE C;  1R3K C;  4G28 B;  1G4Y B;  5EBW C;  4X8A A;  3SPC A;  3UKM A;  1OCO C;  1OCZ C;  4PDL A;  2X6A A;  3IGA C;  4WFG A;  3IFX A;  4J9Y B;  1OCC C;  3ABL C;  3SJQ C;  4ZBM A;  4MTO A;  4R50 A;  2HFE C;  1V54 C;  3ABK C;  4TWK A;  4UUJ C;  5CBH A;  2ATK C;  2YEV A;  5KUK A;  4LCU C;  1XL6 A;  3OUS A;  3F7V C;  4MS2 A;  4R8C A;  3RW0 A;  4JTC B;  2HVJ C;  2JK5 C;  4G27 B;  4MVO A;  2OCC C;  5BZB A;  1K4C C;  3TCU A;  4MVU A;  2Q69 A;  4JTA B;  3LNM B;  2ITC C;  3RBZ A;  3SYQ A;  3SYO A;  3RVZ A;  4MVS A;  1ZWI C;  2K1E A;  3EFF K;  3WG7 C;  4PDV A;  2Q67 A;  4QE9 A;  4XDL A;  2A79 B;  3E8H A;  1LNQ A;  3X2Q C;  2X6B A;  5B1B C;  5CBG A;  2DYR C;  2KB1 A;  3E8G A;  3GB7 C;  3LDD A;  4F4L A;  5B3S C;  3LUT B;  4GX0 A;  4GX5 A;  2HJF C;  4GX2 A;  4MSW C;  4MVR A;  3TET A;  3T4Z A;  3FB8 C;  3ASO C;  3PJS K; 
#chains in the Genus database with same CATH topology
 1XNQ O;  5LHH A;  3QO7 A;  1WB8 A;  5EBL C;  5CB4 B;  4WFH A;  2EIJ C;  4IHJ B;  3ABL B;  4YY3 B;  3PN1 A;  4RO2 A;  1HP8 A;  4I4T B;  2QKS A;  4O2B A;  2DWD C;  3ZMU A;  1NR1 A;  4RQE A;  1V55 C;  4PDM A;  3DC5 A;  4DUY B;  3N2K A;  3QF7 A;  1H2G A;  5LYJ B;  1K34 A;  1GK9 A;  2PF4 E;  2QM8 A;  1JFF B;  2G38 A;  4FK5 C;  1D2D A;  4X66 O;  2QTO A;  2BTQ A;  4ZHQ B;  3A8T A;  5B1B B;  4KL1 A;  3MD0 A;  5LHG A;  1PNL A;  5B66 Z;  5EC2 C;  4DRX B;  1M1K W;  5FNV B;  3F5W C;  1BZK A;  5BR8 B;  4X65 O;  3D3Q A;  3ZHS A;  1M4U A;  2ILM A;  2OTJ V;  2QKA A;  4RUF A;  3JAK A;  2ITD C;  5DM6 V;  4H37 A;  4TV9 A;  3LDE A;  3UO2 A;  1HNW B;  2AGA A;  2VQE B;  1R1B A;  2XUM A;  3AG4 C;  1NKD A;  1S5J A;  4X9Q A;  1XUQ A;  2X7R B;  1G6U A;  1KP2 A;  3STL C;  4JI8 B;  4K35 A;  2GBO A;  2F1M A;  2HR3 A;  2QWO B;  1ZLZ A;  3ML0 A;  4O4H A;  5KHK A;  3K5M A;  4HAM A;  5IYC O;  5IJ0 A;  1SF9 A;  5CA3 A;  1AI5 A;  1HR0 O;  4QJF B;  4JYY A;  4DK0 A;  3N2G B;  1OJH A;  1DLB A;  4NXN O;  1UFI A;  1XRE A;  1R6N A;  1VQO V;  3UO3 A;  3GB7 C;  4KXR A;  3AEI A;  2OT5 A;  1R6T A;  3WB2 A;  2H8P C;  3T1C A;  4YHH B;  3RWR D;  4B3T B;  1B06 A;  2IU3 A;  5BXZ A;  4FFK A;  3R65 A;  2IJH A;  4DV6 B;  3UM7 A;  2DW4 A;  5LBQ A;  1H2L A;  4MVQ A;  3RN4 A;  1VMG A;  1PV0 A;  1S5L Z;  1O9H A;  2ZD9 A;  1SQF A;  1P7B A;  3W7U A;  4UB8 Z;  1JA8 A;  4OXS A;  2Q5Z A;  3HB3 B;  1J5E B;  3X2Q B;  5L3C A;  1B6Q A;  3E83 A;  3ZHU A;  3ASO B;  5KMG A;  4FZ1 A;  2XTA A;  3SJA C;  1KEC A;  3K08 A;  4D6T H;  1JX9 A;  1KB9 F;  4JF3 A;  1H8E G;  1YCI A;  1RFY A;  3HKE B;  3L71 H;  1DF5 A;  1QVF U;  3CYO A;  3T4D A;  3ABM C;  3ASN C;  4LFA O;  1VF7 A;  3F7Y C;  3FYI B;  1S76 D;  1F4N A;  4ZI7 A;  3E8F A;  2P22 C;  2A0L A;  5KA6 A;  5EIB C;  1XNR B;  3JAS B;  1E79 G;  2YUA A;  3JAT A;  1P84 F;  3UKM A;  2W0X A;  1X59 A;  1IBL O;  3RFR A;  4ZBM A;  3ZHT A;  1GN4 A;  3CCM V;  3G80 A;  2XND G;  3DXR A;  1LUW A;  1ZTE A;  5FPO A;  3GWK C;  2HVJ C;  3CXC U;  2JK5 C;  4FLV A;  2OCC C;  4JI4 B;  4LF8 O;  2EX3 A;  1NTM H;  4RQF A;  2FL4 A;  4UCU A;  3F5T A;  2Z0A A;  5L3D A;  1KMI Z;  2X6B A;  2BSK B;  3JD3 A;  1N33 B;  4DR1 B;  4LFC O;  2BCC H;  1M9N A;  1TUB A;  2RQ6 A;  4UXN A;  5CA1 B;  4AQY O;  1K9M W;  1SQV H;  1GM7 A;  2X6C A;  2W0F C;  3OTO B;  2XAQ A;  3K59 A;  4ZIB A;  2UXD B;  4LF5 O;  3DGE A;  4JPR A;  3E22 A;  1E1R G;  2JEU A;  2LGW A;  4X1K A;  4QPJ A;  2CGN A;  4PEL A;  3FAV A;  3VQW A;  2HVK C;  5IJ9 A;  4FLZ A;  5LA6 A;  2NR5 A;  3BFR A;  2D3O W;  4B08 A;  2NLJ C;  3JD0 A;  2ZXW B;  1SC5 B;  4X62 O;  3JAW A;  2H3O A;  5L3E A;  3MAQ A;  1NI8 A;  5LP6 B;  1VQ7 V;  2ZIN A;  1TVK B;  3ZRS A;  4I9Q A;  1L1F A;  5LL6 Y;  2QE7 G;  3BAA A;  1QNM A;  1SQX H;  3K5O A;  5C8Y A;  2Q6A A;  2GV9 A;  1M56 C;  1XHZ A;  1IUR A;  3THO A;  4O4J A;  1THZ A;  3QNE A;  5IWA B;  2X6A A;  4GT1 A;  2EZO A;  1QVG U;  5F2V O;  5LXT B;  4MTO A;  4FFB B;  3HKB A;  1VQ4 V;  2UU9 B;  3ZCC A;  1IDS A;  1FJG O;  3OUS A;  3QG5 A;  4B3M B;  3WB1 A;  3EFF K;  4LC1 A;  1K3E A;  2JGU A;  4RWU A;  5IDJ A;  2Q7H A;  1PNK A;  3AG3 B;  3CC4 V;  3OAA G;  4GX0 A;  2Y4U A;  3ZRW B;  3I55 V;  3T4Z A;  5GTI Z;  3L9D A;  5EYP B;  3K03 A;  4PA4 A;  5KAI Z;  1QR9 A;  4UB6 Z;  4CS2 A;  5IYZ B;  3BY6 A;  2WLM A;  4H44 B;  1WLE A;  2ADP A;  1GTO A;  2JGD B;  1VF6 A;  3JAL B;  4RAI A;  1H2K A;  2ZQM A;  3RGB A;  3AG1 B;  5JH7 A;  2WLJ A;  5H5N A;  2DYR B;  1M57 C;  1OHH G;  1K7D A;  2WLL A;  4DYL A;  4UCT A;  3G67 A;  4WF9 V;  1PP9 H;  4NXM B;  4DXW A;  4G2K A;  2RJZ A;  1NS1 A;  1VQK V;  1T5E A;  1SET A;  1AP5 A;  1CEZ A;  4H33 A;  1G8M A;  5J2U A;  4FM0 A;  1I94 B;  4HNA A;  3CEI A;  1SQG A;  2CTR A;  2WLI B;  3RYI B;  1WP7 A;  2YI9 A;  4R7C A;  2UUC O;  3FD9 A;  4DK1 A;  4FPP A;  3K04 A;  4X64 B;  1RM1 C;  1HDJ A;  1HNX O;  4CC6 A;  1QU7 A;  1R3K C;  2ZE5 A;  4WCE V;  4TOI A;  4YIP A;  1WPX A;  4X1I B;  3MHH C;  4JI5 O;  3K58 A;  4J80 A;  4MS2 A;  4O2A A;  2IU0 A;  3K9A A;  3CCQ V;  4LNU A;  3LNM B;  3OMA B;  2LGQ A;  5KHG A;  1XDC A;  3B8N A;  3CHX A;  1N4C A;  3G6B A;  4DR7 B;  3D36 C;  5KHJ A;  3JD4 A;  4DV3 B;  2CUG A;  1RP3 B;  1NH2 B;  2M7W A;  4O4L B;  2EIN C;  4X89 A;  5KUM A;  4F6E A;  2IJI A;  2LJ2 A;  1NU1 H;  3ZIA G;  2P06 A;  1FXK B;  2HLD G;  1OCZ B;  3T1Y O;  1K8A W;  1S0V A;  2DMX A;  4DV7 B;  5JVD B;  2OWO A;  1R73 A;  2YEV B;  4KP4 A;  5DED A;  4CH4 A;  2ZNJ A;  4YJ2 B;  2HHH O;  1MOF A;  2IJK A;  4CBC A;  4CS3 A;  3A0B Z;  5LOV B;  3VBB A;  3K5L A;  2Q0A A;  2EIK C;  4Q20 A;  3UT5 A;  2Q0O C;  4U3J A;  4X1Y B;  4OX9 B;  1IZ3 A;  3RVY A;  3NXS A;  1Y6X A;  4HZ3 A;  1IBM B;  2PGG A;  5GON B;  3OUF A;  4JYA O;  2MW2 B;  1Q7Y W;  1Z2G A;  1LR1 A;  5B3S B;  1K4D C;  1AP6 A;  3C3T A;  3SDL A;  3AK2 A;  4DR4 O;  2DQ0 A;  3AK3 A;  5J2T A;  1MSW D;  3BA8 A;  4XDJ A;  4NTX A;  3CE2 A;  4ZOL B;  2EIJ B;  3U0Z A;  5IY5 C;  4BWA A;  3CRQ A;  3HPL C;  4DR6 B;  3OGC C;  3I56 V;  3IC9 A;  4DV0 O;  1V55 B;  3B4S A;  2DYS C;  5LMN O;  3L74 H;  4DV5 B;  4DW0 A;  3SR2 C;  2F4V O;  1WPB A;  1SA0 A;  4JV5 O;  1COW G;  1O9G A;  3OW2 U;  3MHS C;  3OEE G;  2XAJ A;  1N0N A;  2WLH A;  4F6R A;  3L72 H;  2XOK G;  2O57 A;  4FJC C;  1R6K A;  4J9Y B;  1MZE A;  1ZL8 B;  3D8C A;  5AG2 A;  4TUY B;  4R8C A;  2ZE8 A;  4XBF A;  2QWP B;  1Y74 A;  5BZB A;  2Q8V A;  3SYO A;  3RBZ A;  1P49 A;  5LYJ A;  4JI6 O;  1JFF A;  3BCC H;  1Q6U A;  2VWJ A;  2PI4 A;  3CRR A;  4ZHQ A;  2KB1 A;  1KU9 A;  4MT8 A;  2LW1 A;  2LW7 A;  1AJQ A;  3CCU V;  4B7E A;  3TET A;  3FB8 C;  5LGU A;  4DRX A;  1JVM A;  3K5N A;  5DN6 G;  4P30 A;  4JI2 O;  1AJN A;  3CRA A;  2WWW A;  3ZS8 C;  1YJW V;  3ZX6 A;  1Q8I A;  4H0L B;  3A2F A;  2DWE C;  2VRZ A;  5B1O A;  3JD1 A;  3SYA A;  4JI3 B;  2YXY A;  2RN9 A;  4RUE A;  4IT5 A;  1WNS A;  2H94 A;  4P9O A;  2VQF O;  2AZ0 A;  2YSU B;  1OCR C;  1YTF D;  2RCV A;  1AR1 B;  1IXB A;  3FYE B;  4NKG B;  2Q4P A;  4LWS B;  3G4S V;  3A0H Z;  2F66 C;  1QLN A;  1D5A A;  4PDR A;  3SPI A;  5IE9 A;  1J95 A;  2A7W A;  3N2G A;  5J9P C;  4YY3 O;  2WLK A;  4X66 B;  3TGU H;  3SPJ A;  1YSC A;  4ASU G;  3IAY A;  2VS0 A;  5D5P A;  3KG2 A;  4DUY O;  2IW5 A;  1JQ0 A;  1Q90 D;  1OCO C;  1Y4M A;  1KUQ A;  4DR5 B;  1Q81 W;  1OCC C;  4IGG A;  3K9S A;  3CJH B;  2HFE C;  3ABK C;  2ADQ B;  4QGP A;  3ZMS A;  2PUS A;  1KQS U;  2ZNI A;  4NR1 A;  5JWP A;  1GN3 A;  1L8D A;  2WA3 A;  3T1H O;  3ABM B;  3ASN B;  1VEW A;  4FMT A;  2ARH A;  5GW7 A;  1YEW A;  2UXC B;  2QA4 V;  2GUZ A;  3W7S A;  1KBH A;  4JYC A;  5HFM A;  2FTK A;  2YC0 A;  2R70 A;  3SPH A;  1OZ0 A;  1BHA A;  2A9H A;  4JI8 O;  3AG2 C;  4LF7 O;  4JAA A;  1HR0 B;  1Y67 A;  3GWO A;  4PD4 F;  3AG7 A;  2IH3 C;  3HKE A;  4NXN B;  3CRC A;  2OCC B;  3FB5 C;  3VQY A;  2ODM A;  4GKJ B;  4X88 A;  3N2K B;  4ICG A;  2F23 A;  5LHI A;  4I0X A;  2CE4 A;  3M99 B;  1US6 A;  2CGO A;  2WPD G;  3OE7 G;  3U10 A;  2W6I G;  4YJ3 B;  1BCC H;  2FB5 A;  3ZN0 A;  3HKC A;  4J41 A;  5LMU B;  3P30 A;  3WG7 B;  3JAK B;  4UVB A;  3CC2 V;  2AHY A;  3O9O A;  4CH3 A;  4U7O A;  4R6Z A;  3OEH G;  4DV6 O;  1GO3 F;  3RYC A;  2L6L A;  2KKW A;  2QM4 A;  4EB6 A;  5CA1 A;  3ICX A;  1N34 B;  3H1L H;  1J5E O;  1N32 O;  1CPY A;  2Z3Y A;  1VQ9 V;  2KG7 B;  1FFX A;  2ZIM A;  3M7M X;  2ZDI A;  1DK1 A;  3D3I A;  3F7V C;  2LFR A;  1VP7 A;  4JTC B;  2E5L B;  4G27 B;  1PPJ H;  2FML A;  4O4H B;  1B3Q A;  1Y76 B;  2PYJ A;  1YIJ V;  5E79 Z;  5IJ0 B;  2Q9L A;  2XAF A;  4PDV A;  2A79 B;  3ABT A;  2UUA O;  2QKC A;  4PI0 A;  3L75 H;  4GX5 A;  1IXM A;  1MNG A;  2ZE7 A;  1W2B U;  2Z5U A;  3PJS K;  1M56 B;  1IBL B;  1AJP A;  4I50 A;  4IIJ B;  2DJV A;  2IH1 C;  1BL8 A;  2WLN A;  1XNR O;  5LP6 A;  1G1X B;  4QNH B;  1RPO A;  1TVK A;  4PA3 A;  3H1K H;  5B1A C;  5EBM C;  3OR6 C;  3OGI B;  1I7F A;  4LF6 O;  3B77 A;  4IYH A;  5EK0 A;  4LFC B;  2BOB C;  2ZCE A;  3FKS G;  3ZHV A;  3JCZ A;  4AQY B;  4JI4 O;  2CH7 B;  3B2E E;  4LFB O;  1N33 O;  4DR1 O;  1SS3 A;  1URF A;  1F51 A;  4GX1 A;  2YIC A;  1WB7 A;  4L8J A;  4I9W A;  3OM3 B;  1GAX A;  2ZT9 B;  3ABU A;  3B8M A;  2Q7G A;  4PA7 A;  3OTO O;  3LNN A;  4MTX A;  3BEH A;  5IYB O;  3ETE A;  1R3L C;  4TQF A;  2BE3 A;  3ZRW A;  4HYO A;  1M57 B;  4W4K A;  4G28 B;  4X62 B;  2FYU H;  3IGA C;  1GKF A;  3SJQ C;  3OMI B;  3JAT B;  4TWK A;  2LFS A;  4WBN A;  5JQG B;  3EHB B;  2JIZ G;  4LCU C;  3ZHQ A;  1WA8 B;  2HJD A;  3DXR B;  2PZS A;  4UFZ A;  3JAL A;  1NZ6 A;  2P4K A;  3EXA A;  1NTK H;  4QE9 A;  4XDL A;  1Q86 W;  3APO A;  3DSQ A;  1EM1 A;  1K5Q A;  1D5N A;  4D7S A;  3S3X A;  2QWR B;  1JMK C;  1SQP H;  4MTG A;  2YID A;  3FFQ A;  5FPR A;  2EZP A;  3KCY A;  1TUB B;  3RYH B;  1FJG B;  1XI1 A;  2CTQ A;  1IX9 A;  3H1I H;  1FYJ A;  3E35 A;  1K92 A;  1LUV A;  1VF5 B;  3BAB A;  3FB7 C;  2EIM C;  3FB6 C;  3APQ A;  1WN7 A;  2WLI A;  3H1H H;  1TUE B;  3LSU A;  4MVZ A;  5KHI A;  1QR8 A;  1NTZ H;  1MAB G;  4PA6 A;  5K1X A;  1Y66 A;  2EIN B;  5IJ9 B;  5L3F A;  4X20 A;  4K3A A;  1Q82 W;  5JJJ B;  5CA0 B;  2EJR A;  1SES A;  4UVA A;  4FLX A;  1RSO B;  4EKW A;  1Q6I A;  5DEC A;  1EZJ A;  4EEQ A;  2ZDI C;  2ZKO A;  3CC7 V;  3CX5 F;  1ORQ C;  3B09 A;  3QO5 A;  2EIK B;  3CCS V;  4UCS A;  3JAR B;  4LF4 B;  4O4I B;  4X8A A;  3LSS A;  5C8Y B;  1FXK A;  3ETQ A;  2R72 A;  3WU2 Z;  4O4J B;  5JVD A;  1IBK O;  3K57 A;  2YEV A;  1AI4 A;  2CDY A;  5EZY A;  1NH2 D;  1NT2 B;  3HKB B;  1ZX3 A;  4JI1 B;  4JTA B;  1NR7 A;  4CH5 A;  1YJN V;  3RYF B;  5LP6 C;  5KX5 B;  2UUC B;  4NXM O;  4DUZ B;  1ZWI C;  1K73 W;  3CCR V;  1IVS A;  2DYS B;  1YXB A;  5GON A;  4DV2 O;  4MVR A;  3SJC C;  4YXW G;  4DW1 A;  3RT3 C;  2LQT A;  2P7T C;  3G71 V;  2B9Z A;  2Y69 B;  3E89 A;  1JPX A;  2D2C B;  1XHX A;  2EIL C;  1KP3 A;  2K9P A;  5FL7 G;  1ARO P;  4B3R B;  2OYQ A;  3WFV A;  3IC7 A;  3ETD A;  2XAS A;  4DR3 O;  1VQ8 V;  1QLE B;  4EFB A;  4BAY A;  2YXH A;  1H2S B;  2CK3 G;  1SQB H;  4GZR B;  5JH7 B;  5B5E Z;  4WFF A;  1JCH A;  2F95 B;  4DR7 O;  4DV4 B;  1BGY H;  3QTC A;  2WLL B;  2JJ2 G;  2HHH B;  1ZL8 A;  4J7J A;  5BY1 A;  2HKO A;  2A06 H;  1XMQ B;  3P3P A;  5ITZ B;  4FZ0 A;  3DTU B;  2Y48 A;  4DV7 O;  4UV8 A;  2PTM A;  4J9Z B;  4JI0 O;  4JYA B;  4HNA B;  2GDS A;  2UUB B;  2P4V A;  3HKD A;  4U3F H;  3JCU Z;  1M93 A;  3AG1 C;  3E86 A;  1H8H G;  1OCR B;  1EFR G;  4OX9 O;  1I0H A;  5L3B A;  1EZV H;  4TV8 A;  1V54 C;  1YDX A;  2YDE A;  3A0R A;  4FM1 A;  4LH6 A;  4K0K B;  2M6Y A;  1WAZ A;  2R9A A;  2JDI G;  3Q4H B;  4KHP B;  1VQM V;  3ZN1 A;  2F43 G;  2ITC C;  3FX7 A;  4GUN A;  1N36 B;  4LNU B;  4JV5 B;  3C3S A;  2AXT Z;  1AB3 A;  2EUL A;  4DR6 O;  3E8G A;  1JJ2 U;  4DV1 O;  3LUT B;  2XAH A;  5A9G A;  4GX2 A;  1AI6 A;  5CB4 A;  3BPZ A;  2UXB B;  3WB0 A;  4IHJ A;  1YI2 V;  2Q68 A;  1OCO B;  4I4T A;  1BSM A;  1OCC B;  4PA9 A;  2KQX A;  1H2N A;  2AZ2 A;  3ABK B;  1MA1 A;  4I55 B;  1FFT B;  1VF6 C;  1SKV A;  4GKK O;  4JI6 B;  1GN2 A;  4LF9 B;  1QBZ A;  3I5D A;  3AG4 B;  3ZJZ A;  2PI5 A;  3OR7 C;  1QHT A;  2DE0 X;  4DR2 B;  2ZM6 B;  3OMN B;  3ZRV A;  4WFA V;  4GLX A;  4JI7 O;  5FNV A;  3ZMZ A;  4U3J B;  3DC6 A;  1S5H C;  2QEX V;  1CP9 A;  2QTS A;  1YJ9 V;  5H9C A;  5HFL A;  4QE7 A;  2LO1 A;  3L73 H;  1BMF G;  4NYK A;  1V9P A;  3CJH A;  4K8X A;  2QGN A;  4TT3 G;  1HNZ O;  4OPH A;  5J2T B;  5BMV B;  3AG2 B;  4P9P A;  1VQN V;  3K0D A;  3CP1 A;  4B3S O;  1Q43 A;  5JJE B;  1K33 A;  4FLY A;  4JGS A;  3JAM N;  2QM7 A;  4JZG A;  3CCV V;  2P6J A;  5H2F Z;  3UCS C;  1XNQ B;  3CD6 V;  5JCO A;  2VQF B;  3W7X A;  4AIL C;  2E76 B;  1P4R A;  3NR7 A;  2F93 B;  1SA0 B;  2EBO A;  1S3J A;  1H38 A;  3L70 H;  3KZI Z;  1NVP B;  1VQ6 V;  1XMO O;  2IM9 A;  4FIP C;  4F6R B;  1EBO A;  4IYI A;  1SER A;  3H9V A;  4UUJ C;  4WFB V;  5EIB D;  1XL6 A;  3RW0 A;  4MVO A;  5LGN A;  2ZR3 A;  3OT7 A;  3TCU A;  3SYQ A;  1Y74 B;  3CB2 A;  4NB5 A;  5C93 A;  3KCX A;  1LNQ A;  1UPG A;  4X65 B;  4FLU A;  4JZ2 A;  1B04 A;  3LDD A;  2KSD A;  2DOS A;  2DQ3 A;  3J7A U;  4BIZ A;  1I5X A;  4PHZ A;  5BR8 O;  4YJ3 A;  3HR0 A;  4J7Z A;  5D5Q A;  4DR5 O;  3SGI A;  3T1H B;  1AI7 A;  2ZE6 A;  4EFE A;  4FLT A;  4UCV A;  4J7K A;  5H6R A;  1N0J A;  2OCH A;  3CSX A;  3P32 A;  3T2M A;  1VIB A;  1YHQ V;  1FS0 G;  1YTF B;  4K8Z A;  1HNW O;  2VQE O;  4ZKI A;  1KKD A;  1Q3E A;  2JRI A;  4LBE C;  2B1I A;  1F7Y A;  2B5U A;  2X0L A;  4LF7 B;  3E2E A;  2UXC O;  3H1J H;  1R3I C;  2KG7 A;  4JAU A;  4O2B B;  3SYP A;  2AW9 A;  1BQZ A;  1Y76 A;  1N8R W;  1OV9 A;  2JJ1 G;  5B1A B;  1ZUQ A;  4C7U A;  4JAV A;  2RDC A;  3EVK A;  2NNU A;  1PL4 A;  3JAS A;  4MW3 A;  2LP7 A;  4I5S A;  2BTQ B;  2XHB A;  5GTH Z;  4GKJ O;  3BVO A;  4WFG A;  4IIJ A;  3ZMV A;  4YHH O;  3ABL C;  1AR5 A;  1W59 A;  4B3T O;  4R50 A;  2Y4T A;  5IT9 N;  1WJZ A;  1U96 A;  1M5I A;  4BIO A;  1L0L H;  2YS8 A;  1FKA O;  1FPO A;  4TV9 B;  3UQ8 A;  5A2Q N;  2BSK A;  3GVM A;  2V4D A;  5LMU O;  1AIL A;  5B1B C;  2A3Q A;  2N04 A;  2Q73 A;  4UVC A;  1CXZ B;  1FAF A;  3VOU A;  4FLW A;  2CH7 A;  2JS3 A;  4CC5 A;  1N32 B;  1AVM A;  3ZRX A;  2JS5 A;  2GUZ B;  3VQV A;  2Y0P A;  1GM9 A;  4LFA B;  1N34 O;  2XT9 A;  4CZZ A;  3B40 A;  2NN4 A;  2UUA B;  5IYD O;  4B7K A;  2CTP A;  2E5L O;  2E3C A;  4LH7 A;  5JCO C;  3CPW U;  1BT8 A;  5CBF A;  4IL6 Z;  3W7T A;  4J10 A;  2BTO A;  4I0X B;  4XDK A;  3CCE V;  5JQG A;  4LF8 B;  1S77 D;  3P3N A;  1P7G A;  1H2M A;  1WA8 A;  4P2Z A;  4GYC B;  1TGO A;  3C90 A;  4LF6 B;  1JOY A;  1PD3 A;  1VAR A;  3HKC B;  2EIM B;  1MSD A;  1KKC A;  3ZED A;  1A32 A;  4H13 B;  1HWY A;  1F23 A;  1HW7 A;  4LF5 B;  1ZAU A;  2WA4 A;  3BA9 A;  3BHP A;  3CRM A;  1K97 A;  2QWN B;  3RYC B;  5LXT A;  5KHH A;  4LFB B;  5KMG B;  4FFB A;  4KUM A;  4TSF G;  4EB6 B;  1M90 W;  4TQD A;  3RYH A;  1BQ0 A;  3OD4 A;  1GM8 A;  2UXD O;  3MDS A;  4BIU A;  1GN6 A;  4UCR A;  1FFX B;  1E1Q G;  3SJB C;  5LGT A;  4MVS A;  4AHC A;  4I7Z B;  3WG7 C;  4NTW A;  3TK1 A;  4ZI7 B;  3X2Q C;  4J11 A;  5CBG A;  3D36 A;  4F4L A;  3K79 A;  5EYP A;  5B1N A;  4MSW C;  4PV1 B;  2GHY A;  3JSL A;  3ASO C;  3H01 A;  2P90 A;  1PNM A;  4N21 A;  5EC1 C;  4BR6 A;  5IYZ A;  3IJ4 A;  1SZT A;  4MW8 A;  2CAZ C;  3K0G A;  5CA0 A;  1MMM A;  1VQL V;  4PJ0 Z;  2JGD A;  4I50 B;  1RSO A;  2P67 A;  1XQ8 A;  1XIL A;  1GRJ A;  2EJ7 A;  1JJO A;  1K5S A;  3TJT A;  4WFE A;  2V1D A;  1RM1 B;  1JR9 A;  4L87 A;  4PI2 A;  1FXV A;  4UV9 A;  3JAR A;  1NJI W;  1MG1 A;  2QWQ B;  4O4I A;  1VQ5 V;  3CXH F;  2QSA A;  1BS3 A;  5IWA O;  1GH6 A;  1QQC A;  1XEQ A;  2HP8 A;  3E22 B;  4OGQ B;  2UU9 O;  3RYI A;  2EIL B;  2IJJ A;  3OFN G;  4BW9 A;  2AHZ A;  3RYF A;  4X1K B;  5KX5 A;  2UXN A;  4B3M O;  2GTS A;  1R3J C;  1ROP A;  2BOC C;  3FAV B;  2JVD A;  1F4M A;  1XBL A;  2OIG A;  3K3W A;  2JEX A;  3CWB H;  4CH6 A;  1TA8 A;  5LA6 B;  4X1I A;  2ZIO A;  2QDO A;  5EBW C;  3R66 A;  3SPC A;  4PDL A;  5K1P A;  3JAW B;  3J81 N;  5KUK A;  1SQQ H;  1K4C C;  4WBN B;  2XAG A;  4MVU A;  3J80 N;  4Z1M G;  2K1E A;  1WP8 A;  2Q67 A;  4UCO A;  5CMU A;  1ENV A;  4Q6G A;  4O4L A;  2YIA A;  2HJF C;  1FD9 A;  3AK1 A;  2ZXW C;  5TIS Z;  4QIW F;  1IBK B;  1PL0 A;  4BW5 A;  5JJN B;  4YJ2 A;  3ZMT A;  5IY5 B;  3JD2 A;  4LF4 O;  3SPG A;  5LOV A;  1V54 B;  1DTO A;  1PKX A;  2GSM B;  5ITZ A;  3K06 A;  4X1Y A;  3OTF A;  1HNX B;  5L3G A;  1TAE A;  1I94 O;  2Q7E A;  2N74 A;  3ZBH A;  3BRC A;  4DV2 B;  1GMG A;  2P5O A;  4JI1 O;  4MTF A;  3STZ C;  1FXH A;  1X4T A;  4DUZ O;  4X64 O;  1MZF A;  1Z5W A;  4JI5 B;  3ZHR A;  1SZX A;  4ZOL A;  2N05 A;  3E8B A;  4AI8 A;  3SYC A;  1VQP V;  4LP8 A;  3O65 A;  4OPA A;  1UJW B;  3KKY A;  3TXS A;  2YI8 A;  4X20 B;  1Q5O A;  1NBM G;  1YF2 A;  2WAM A;  3Q4H A;  3CME V;  4LR3 A;  1QCE A;  2B1G A;  4U7N A;  1XL4 A;  4QPK A;  4DR3 B;  3AG3 C;  5FLX N;  5CN0 A;  2OTL V;  3T1Y B;  2E75 B;  1ZSP A;  1YZB A;  4NTY A;  2IBZ H;  4B3R O;  3M8A A;  3CMA V;  1G4Y B;  4CS4 A;  4DV3 O;  1XOU A;  2CTW A;  1EN5 A;  3VQX A;  4TUY A;  4J42 A;  2W6J G;  1EN4 A;  1Q6H A;  2ATK C;  1Z5V A;  4I55 A;  3QO8 A;  4DV4 O;  4YIO A;  3QVN A;  5J2U B;  4JI0 B;  2Q69 A;  3RVZ A;  1BE3 H;  5EZY B;  3U11 A;  4DR4 B;  3G6E V;  2E74 B;  1YIT V;  3E8H A;  2DN9 A;  1XMQ O;  5KLV H;  2DYR C;  1IBM O;  2YIB A;  2HG5 C;  4W4L A;  2QJ1 A;  2UXX A;  2UUB O;  1KC8 W;  2RNB A;  3LDC A;  4DV0 B;  1DF4 A;  5BMV A;  5LMN B;  4ABM A;  4FVM A;  2QR4 A;  4O2A B;  2F4V B;  2YIB D;  3CS5 A;  4JTD B;  2PYL A;  3CCJ V;  1YVW A;  1RPR A;  4Z2W A;  2OIE A;  3JYC A;  2R9R B;  1KD1 W;  1EN6 A;  2Y0I A;  1DGS A;  4K0K O;  1L0N H;  4DV1 B;  4KHP O;  4DV5 O;  2L35 A;  4MVM A;  4DO2 A;  1S72 V;  4A5U B;  1N36 O;  4LWS A;  2YXL A;  4HBN A;  3TXQ A;  3CCL V;  4JYB A;  3W7W A;  1PM9 A;  3LSQ A;  4E2L A;  1BHB A;  2FKX A;  2UXB O;  5E1A C;  2PY5 A;  4GKK B;  2GTA A;  2MK3 A;  2Y69 C;  4FM2 A;  1NVP D;  4Z1V A;  3UT5 B;  1AR4 A;  2ETN A;  4JI7 B;  4E4E A;  1W0J G;  4KFM A;  4JI2 B;  4LF9 O;  1QLE C;  2C2A A;  1W0K G;  3HKD B;  1FXK C;  1OCZ C;  1U97 A;  4DR2 O;  2ZM6 O;  4NVP A;  1HNZ B;  3IFX A;  4JAS A;  2VWK A;  5CBH A;  4B3S B;  3N27 A;  2V7Q G;  2WSS G;  4TV8 B;  3JSN A;  2ZR2 A;  4N23 A;  2HEP A;  3S3W A;  5H6Q A;  2R9I A;  5KAF Z;  4GCZ A;  5KA5 A;  4JI3 O;  2RMK B;  1NQT A;  1KYO F;  1I08 A;  1I5Y A;  1SRY A;  5B3S C;  4D7T A;  3ETG A;  1XMO B; 
#chains in the Genus database with same CATH homology
 2EIN C;  4X89 A;  5KUM A;  3VOU A;  2IJI A;  5LHH A;  2EZP A;  3QO7 A;  3ZIA G;  1FXK B;  2HLD G;  1OCZ B;  3ZRX A;  1K8A W;  1S0V A;  5EBL C;  4WFH A;  2EIJ C;  3ABL B;  1GM9 A;  1R73 A;  3E35 A;  2YEV B;  4KP4 A;  1K92 A;  4RO2 A;  1MOF A;  2IJK A;  2QKS A;  4CBC A;  4CZZ A;  2DWD C;  3ZMU A;  1NR1 A;  3FB7 C;  3VBB A;  1V55 C;  4PDM A;  4RQE A;  2EIM C;  3FB6 C;  1H2G A;  2EIK C;  4Q20 A;  2WLI A;  1K34 A;  5IYD O;  1GK9 A;  2QM8 A;  1TUE B;  4MVZ A;  4FK5 C;  3RVY A;  3NXS A;  2QTO A;  4HZ3 A;  1QR8 A;  3OUF A;  1Q7Y W;  5B1B B;  3CPW U;  1MAB G;  5B3S B;  4PA6 A;  3MD0 A;  1K4D C;  5CBF A;  5LHG A;  2DQ0 A;  1PNL A;  3W7T A;  5EC2 C;  1M1K W;  1Y66 A;  2EIN B;  3F5W C;  1MSW D;  5L3F A;  4XDJ A;  1Q82 W;  4XDK A;  3CCE V;  2OTJ V;  1S77 D;  2EJR A;  1SES A;  4UVA A;  4RUF A;  2EIJ B;  4EKW A;  1EZJ A;  5IY5 C;  2ITD C;  4P2Z A;  3HPL C;  2ZDI C;  3OGC C;  5DM6 V;  4H37 A;  1JOY A;  1PD3 A;  3I56 V;  3CC7 V;  1ORQ C;  1V55 B;  3LDE A;  3QO5 A;  2EIM B;  2DYS C;  2EIK B;  3CCS V;  1HWY A;  1F23 A;  3AG4 C;  1NKD A;  1COW G;  2X7R B;  3OW2 U;  1KP2 A;  3STL C;  3MHS C;  3OEE G;  2XAJ A;  2WLH A;  1K97 A;  4X8A A;  3LSS A;  4KUM A;  4TSF G;  2XOK G;  2HR3 A;  1FXK A;  4FJC C;  1R6K A;  4J9Y B;  1M90 W;  3ML0 A;  2YEV A;  1AI4 A;  1GM8 A;  4HAM A;  4R8C A;  5IYC O;  4XBF A;  1NH2 D;  4BIU A;  5CA3 A;  5BZB A;  1AI5 A;  1E1Q G;  4QJF B;  4JTA B;  1NR7 A;  3RBZ A;  3SYO A;  1YJN V;  5LGT A;  1DLB A;  1ZWI C;  4MVS A;  1K73 W;  3CCR V;  1R6N A;  3WG7 C;  2DYS B;  1VQO V;  3TK1 A;  2PI4 A;  3X2Q C;  5CBG A;  2KB1 A;  4MT8 A;  3D36 A;  3GB7 C;  3K79 A;  5B1N A;  4F4L A;  1AJQ A;  4MVR A;  3AEI A;  4MSW C;  3CCU V;  2OT5 A;  2GHY A;  3TET A;  3FB8 C;  3ASO C;  2H8P C;  5LGU A;  3H01 A;  2P90 A;  4YXW G;  3T1C A;  1PNM A;  4N21 A;  5EC1 C;  1JVM A;  4MW8 A;  1SZT A;  5DN6 G;  2IU3 A;  3K0G A;  4P30 A;  3R65 A;  1AJN A;  2P7T C;  2IJH A;  2WWW A;  3G71 V;  3E89 A;  2Y69 B;  1VQL V;  1YJW V;  3UM7 A;  1JPX A;  2DW4 A;  2P67 A;  5LBQ A;  2DWE C;  2EIL C;  1KP3 A;  4MVQ A;  5B1O A;  3JD1 A;  1K5S A;  3SYA A;  5FL7 G;  1ARO P;  2ZD9 A;  4RUE A;  1P7B A;  4WFE A;  3W7U A;  2V1D A;  1RM1 B;  3WFV A;  3IC7 A;  3ETD A;  4L87 A;  2H94 A;  4OXS A;  1FXV A;  2XAS A;  3HB3 B;  4P9O A;  1QLE B;  1VQ8 V;  4BAY A;  3X2Q B;  4UV9 A;  5L3C A;  1B6Q A;  2YSU B;  2CK3 G;  1NJI W;  3E83 A;  1MG1 A;  1OCR C;  1YTF D;  4WFF A;  1JCH A;  3ASO B;  1VQ5 V;  1KEC A;  3K08 A;  1AR1 B;  3FYE B;  2WLL B;  1JX9 A;  3G4S V;  2JJ2 G;  4JF3 A;  1H8E G;  2HKO A;  1QLN A;  4PDR A;  3SPI A;  2EIL B;  1DF5 A;  1J95 A;  2IJJ A;  3DTU B;  3OFN G;  1QVF U;  2Y48 A;  3CYO A;  2AHZ A;  4UV8 A;  3T4D A;  4J9Z B;  3ABM C;  5J9P C;  3ASN C;  2WLK A;  2UXN A;  3F7Y C;  3FYI B;  1R3J C;  1S76 D;  1ROP A;  3SPJ A;  1YSC A;  2BOC C;  4ASU G;  1F4N A;  3E8F A;  2A0L A;  5KA6 A;  1F4M A;  3KG2 A;  3K3W A;  2JEX A;  3AG1 C;  3E86 A;  1H8H G;  2IW5 A;  1E79 G;  1OCR B;  5EBW C;  1JQ0 A;  1EFR G;  3SPC A;  3UKM A;  1OCO C;  1Y4M A;  4PDL A;  1Q81 W;  5L3B A;  1OCC C;  4ZBM A;  2HFE C;  1V54 C;  3ABK C;  3CCM V;  2XND G;  5KUK A;  3A0R A;  2HVJ C;  3ZMS A;  2JK5 C;  3CXC U;  2JDI G;  1KQS U;  2OCC C;  1K4C C;  2XAG A;  1VQM V;  4MVU A;  3ZN1 A;  2F43 G;  2ITC C;  4Z1M G;  2K1E A;  4RQF A;  3ABM B;  3ASN B;  4FMT A;  2Q67 A;  5CMU A;  5L3D A;  1ENV A;  2X6B A;  5GW7 A;  3ETG A;  3JD3 A;  3E8G A;  1JJ2 U;  3LUT B;  2XAH A;  2HJF C;  4GX2 A;  2QA4 V;  1AI6 A;  3W7S A;  1M9N A;  4JYC A;  4UXN A;  5HFM A;  2FTK A;  1K9M W;  1GM7 A;  1YI2 V;  2ZXW C;  2X6C A;  4QIW F;  2Q68 A;  1OCO B;  3SPH A;  1PL0 A;  1OZ0 A;  2W0F C;  4BW5 A;  1BHA A;  2XAQ A;  2A9H A;  3ZMT A;  5IY5 B;  3DGE A;  1OCC B;  3AG2 C;  4JPR A;  4PA9 A;  3JD2 A;  3SPG A;  1V54 B;  3ABK B;  1DTO A;  1PKX A;  2GSM B;  3GWO A;  1FFT B;  3K06 A;  2IH3 C;  2OCC B;  1E1R G;  2JEU A;  5L3G A;  1QBZ A;  3AG4 B;  3FB5 C;  4QPJ A;  3ZJZ A;  2PI5 A;  3OR7 C;  4PEL A;  4X88 A;  3OMN B;  1GMG A;  3ZRV A;  4WFA V;  2HVK C;  4MTF A;  3STZ C;  3ZMZ A;  5LHI A;  1FXH A;  1S5H C;  2QEX V;  3M99 B;  1CP9 A;  1YJ9 V;  5H9C A;  5HFL A;  2WPD G;  2NLJ C;  3JD0 A;  4QE7 A;  3E8B A;  2D3O W;  2ZXW B;  3SYC A;  1VQP V;  1BMF G;  4LP8 A;  3OE7 G;  2W6I G;  4TT3 G;  5L3E A;  3AG2 B;  1UJW B;  4P9P A;  1VQN V;  3K0D A;  3CP1 A;  3ZN0 A;  1NBM G;  1VQ7 V;  2WAM A;  3ZRS A;  3CME V;  1K33 A;  3P30 A;  4JGS A;  3WG7 B;  4UVB A;  3CC2 V;  2AHY A;  2QM7 A;  3CCV V;  1QCE A;  4U7O A;  2B1G A;  2P6J A;  3OEH G;  4R6Z A;  1XL4 A;  4QPK A;  4U7N A;  1GO3 F;  3CD6 V;  1L1F A;  3AG3 C;  2QE7 G;  3W7X A;  5CN0 A;  2OTL V;  1P4R A;  2Q6A A;  2EBO A;  1M56 C;  3CMA V;  1S3J A;  1G4Y B;  1H38 A;  1THZ A;  3QNE A;  2X6A A;  1NVP B;  1VQ6 V;  4GT1 A;  4FIP C;  2EZO A;  1QVG U;  1EBO A;  2W6J G;  4MTO A;  1SER A;  1CPY A;  2Z3Y A;  4UUJ C;  1VQ4 V;  1VQ9 V;  3ZCC A;  2ATK C;  4WFB V;  2ZDI A;  3D3I A;  1XL6 A;  3OUS A;  3F7V C;  2LFR A;  3RW0 A;  4JTC B;  4G27 B;  4MVO A;  3QO8 A;  5LGN A;  2ZR3 A;  3TCU A;  2Q69 A;  3SYQ A;  3RVZ A;  1YIJ V;  3EFF K;  4LC1 A;  1K3E A;  3G6E V;  2XAF A;  5C93 A;  4PDV A;  5IDJ A;  2A79 B;  3ABT A;  3E8H A;  1YIT V;  1LNQ A;  1PNK A;  3AG3 B;  3CC4 V;  2DYR C;  3LDD A;  3OAA G;  4GX0 A;  3ZRW B;  4GX5 A;  3I55 V;  1IXM A;  1W2B U;  3T4Z A;  2Z5U A;  3PJS K;  1M56 B;  3K03 A;  2HG5 C;  1AJP A;  4PA4 A;  2UXX A;  2DQ3 A;  4BIZ A;  2IH1 C;  1I5X A;  1QR9 A;  1KC8 W;  3LDC A;  1BL8 A;  2WLN A;  1DF4 A;  3BY6 A;  2WLM A;  4JTD B;  4QNH B;  1RPO A;  1WLE A;  4PA3 A;  3CCJ V;  1RPR A;  1GTO A;  3JYC A;  1AI7 A;  5B1A C;  2R9R B;  5EBM C;  4RAI A;  1KD1 W;  3OR6 C;  5H6R A;  2ZQM A;  3B77 A;  3P32 A;  5EK0 A;  3T2M A;  1YHQ V;  1FS0 G;  2BOB C;  1YTF B;  3AG1 B;  4MVM A;  2WLJ A;  3FKS G;  4ZKI A;  4DO2 A;  3JCZ A;  2DYR B;  1M57 C;  1OHH G;  1KKD A;  1K7D A;  1S72 V;  2WLL A;  4LBE C;  2B1I A;  2B5U A;  4JYB A;  3CCL V;  2X0L A;  3E2E A;  3W7W A;  4WF9 V;  3LSQ A;  4DXW A;  4E2L A;  4G2K A;  1R3I C;  4JAU A;  1VQK V;  1BHB A;  1F51 A;  4GX1 A;  4I9W A;  3OM3 B;  5E1A C;  1SET A;  3SYP A;  3ABU A;  3B8M A;  1CEZ A;  4H33 A;  2MK3 A;  2Y69 C;  1G8M A;  4PA7 A;  4MTX A;  1N8R W;  1NVP D;  2JJ1 G;  5B1A B;  3BEH A;  2WLI B;  5IYB O;  4R7C A;  3ETE A;  1R3L C;  4JAV A;  2NNU A;  4MW3 A;  2LP7 A;  4I5S A;  1W0J G;  4FPP A;  3K04 A;  4KFM A;  1RM1 C;  3ZRW A;  4HYO A;  1M57 B;  1QLE C;  1R3K C;  4G28 B;  4WCE V;  2C2A A;  1W0K G;  1FXK C;  1OCZ C;  3IGA C;  4WFG A;  1GKF A;  3IFX A;  3ZMV A;  1WPX A;  3ABL C;  3MHH C;  3OMI B;  4JAS A;  3SJQ C;  4R50 A;  4TWK A;  2LFS A;  5CBH A;  3EHB B;  2JIZ G;  4LCU C;  4MS2 A;  2V7Q G;  2IU0 A;  3K9A A;  2WSS G;  3CCQ V;  2ZR2 A;  4N23 A;  2R9I A;  3LNM B;  3OMA B;  5H6Q A;  4GCZ A;  5KA5 A;  3B8N A;  4QE9 A;  4XDL A;  1Q86 W;  5B1B C;  1NQT A;  1K5Q A;  3JD4 A;  1I5Y A;  1SRY A;  5B3S C;  1NH2 B;  4UVC A;  2M7W A;  4MTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...