1ZWIC

Structure of mutant kcsa potassium channel
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody, heavy chain
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1zwiC00
3EFFK 2WLMA 4KFMA 3OR7C 2YEVA 3FB7C 3IFXA 2JK5C 3STZC 3SYOA 3T2MA 3SYQA 3ZRSA 2DWEC 3LDEA 2DYSC 2NLJC 3F5WC 3R65A 2EIKC 2ITDC 4GX0A 2DWDC 4GX1A 1J95A 3IGAC 4PA4A 3E89A 4QE9A 5IY5C 3SYCA 4QE7A 3ABLC 1OCZC 2P7TC 4PA9A 4QNHB 3WG7C 4MTFA 4RUEA 3KG2A 3VOUA 4MTGA 3E83A 1M56C 4R6ZA 3FB8C 4HZ3A 3OR6C 4RAIA 4R8CA 4UUJC 4X89A 2OCCC 3ASNC 5B1BC 3E8BA 3K04A 1BL8A 3K06A 1R3KC 2K1EA 2W0FC 2WLKA 3GB7C 4MVZA 4TWKA 1OCCC 2Y69C 2A0LA 3OGCC 2HVJC 2WLHA 2WLIA 2KB1A 1ORQC 2WLJA 4J9ZB 4LP8A 4JTAB 4MVUA 3T4DA 5EC2C 3RVYA 4P9PA 4MVOA 3SJQC 1K4DC 4MVSA 2ITCC 2AHYA 2A79B 4XDJA 4LCUC 4RUFA 3X2QC 4WFFA 5CBFA 4HYOA 3LDDA 1M57C 1OCRC 4MVRA 4R7CA 4WFGA 2WLLA 3JYCA 3E8HA 3UM7A 3ASOC 3T1CA 3AG3C 3RW0A 2EINC 3SPJA 3T4ZA 5KUKA 4XDLA 2HFEC 4MS2A 2HVKC 4P30A 4P9OA 4X8AA 1QLEC 4LBEC 5BZBA 3SYAA 2ZXWC 4MVQA 3STLC 4DXWA 1KKDA 1V55C 3AG2C 3PJSK 4PDLA 2H8PC 3LDCA 2R9RB 3SPHA 3OUFA 2X6BA 3SPCA 4MW3A 3AG1C 3SPIA 3UKMA 3RBZA 4PA3A 4PA7A 3SPGA 3FB6C 4PDVA 1LNQA 2X6AA 4ZBMA 2EILC 4XDKA 4OXSA 5E1AC 4G28B 3BEHA 2ATKC 3AG4C 4H33A 4F4LA 4PDMA 2DYRC 4R50A 2A9HA 2WLIB 2Q69A 4I9WA 1R3IC 2EIJC 4H37A 4G27B 2QKSA 2ZD9A 4PA6A 2QTOA 3TETA 1S5HC 3LUTB 2BOBC 2EIMC 1G4YB 5J9PC 4MVMA 1XL4A 3F7YC 4JTDB 2HJFC 2IH3C 3LNMB 2WLLB 2Q68A 3ABMC 4J9YB 5EBLC 4P2ZA 5KUMA 4CBCA 1ZWIC 3E86A 4EKWA 2X6CA 3K0DA 5EK0A 5B1AC 1XL6A 3E8GA 3OUSA 4X88A 1OCOC 3ZJZA 5CBGA 4WFEA 1V54C 3K0GA 4PDRA 5EBWC 5EBMC 2BOCC 3RVZA 5CBHA 4MTOA 4GX5A 3K03A 2WLNA 4JTCB 2AHZA 4WFHA 1JVMA 3F7VC 5EC1C 2Q67A 3K08A 3FB5C 4MW8A 5B3SC 4RO2A 1R3JC 2IH1C 1K4CC 3SYPA 3E8FA 1R3LC 4BW5A 3TCUA 3ABKC 2HG5C 2Q6AA 4MSWC 3HPLC 1P7BA 4GX2A
chains in the Genus database with same CATH superfamily
5KHGA 3BVOA 1JOYA 5IWAB 1HW7A 3RYFA 4JI4O 4JZ2A 5FNVA 3M7MX 5IJ9B 2O57A 3HKCA 2XASA 3CX5F 5JQGB 2ILMA 2F4VO 2HEPA 1K8AW 3IJ4A 1HNZB 5DM6V 4CS4A 3OTOB 2KQXA 2UXBO 1R1BA 4FK5C 2W0FC 4ZIBA 1OCCC 3X2QB 2WLIA 2PUSA 4MVSA 2AHYA 1TVKB 3QTCA 3ASOB 2EULA 4ZI7A 1X4TA 4FLYA 5LGUA 4MVRA 1NT2B 4WFGA 1BQZA 2NN4A 2IJKA 4FLZA 4AILC 3AG1B 1I7FA 3FFQA 1KMIZ 2JGUA 2UXDO 3M99B 1PD3A 1PM9A 1IDSA 4BIZA 4B7KA 1LNQA 2IU3A 4DV6O 3IC7A 1IBLO 2XT9A 4AHCA 2N74A 4LH7A 5CA1B 4U3FH 1VQNV 2Y4TA 4BW9A 4EB6A 2P67A 4JYAO 4TV9A 2UUCB 3CC7V 2YIBA 1LUVA 2LJ2A 1ZL8B 3A8TA 4JAAA 4P2ZA 2C2AA 4CBCA 1AI6A 3JCUZ 3OUSA 4FLTA 4WFAV 4YJ3A 4QJFB 4LF5B 3VQVA 2XNDG 1GRJA 1R6TA 4LF4O 3ZRXA 3F7VC 4JI8B 1FJGO 1XNQB 1K4CC 1K7DA 1SQBH 1J5EO 1R6NA 2Q6AA 1VQOV 4GX2A 3CYOA 1AR4A 3OW2U 1NS1A 2R9IA 2ZM6B 4NXNB 2N04A 3GWKC 3JD1A 1YCIA 1K3EA 4DV0O 1EM1A 2JRIA 5L3FA 2BSKA 2Y48A 1YITV 5LL6Y 4QE7A 2CTPA 4ZOLA 1OCZC 3QG5A 1MMMA 1QU7A 3C90A 4RUEA 3LSQA 1ZTEA 2QWPB 4DV7B 2ZT9B 3CCVV 3OR6C 4TT3G 4FZ0A 2A0LA 4N21A 5KAIZ 1YI2V 2OT5A 1K92A 4LCUC 3HKBB 1PL0A 3VBBA 5LHGA 4NXMO 2XTAA 2CGNA 2YXYA 3RYFB 1F4NA 3RW0A 4NTWA 3UO3A 1VQKV 5FNVB 4BIOA 1FAFA 3HKCB 3OT7A 2QWRB 3MD0A 4GKJB 3CP1A 1UFIA 4B3RO 2EILB 4DV5B 4PA3A 3TXSA 3FB6C 1NH2B 3LSSA 3WB1A 4X65O 4GLXA 4H33A 2EJRA 4F6RA 1JA8A 4K8ZA 2WLIB 2QKCA 2BTOA 3QO8A 2JDIG 1PNKA 4JGSA 4ZI7B 4FJCC 1V54B 1DF5A 3H1LH 5LYJA 1XUQA 4LF9O 5KA6A 5L3DA 1Q43A 3ABKB 3K03A 2XAJA 3NXSA 1N0JA 1NVPB 3W7SA 5B1NA 4JI4B 3RWRD 3CCJV 1RPRA 2PI5A 1M90W 2IJIA 1IURA 4O2AA 5HFMA 3S3XA 3AEIA 4DR2O 4EB6B 2F4VB 3W7WA 4TV9B 2IW5A 2GHYA 4GX1A 2UXBB 3OMNB 1IBKO 2V4DA 1AP6A 4PA4A 4QE9A 5IY5C 3VQWA 3N2KA 2XHBA 1COWG 5LBQA 1FFXA 1SQXH 4X1IA 1N8RW 4YJ3B 1OCCB 3UCSC 4HZ3A 4OX9O 1M4UA 4FMTA 1JQ0A 4GUNA 4UUJC 3G6EV 1WNSA 4TWKA 4JI3O 2Y69C 3JSNA 5JVDA 4AQYO 1VF6C 5DN6G 4DR3B 2CDYA 1B6QA 2E76B 2D3OW 4X1KA 1OCRC 2Y0PA 3K9SA 3E8HA 2NNUA 3SJAC 1BHBA 5LMNO 3ZIAG 4WCEV 2BSKB 4DV6B 4MVQA 1NZ6A 3FYEB 2F95B 4UV9A 5KHKA 1S5LZ 5IE9A 2QM8A 1TUBA 4G28B 3CPWU 1GKFA 5BMVA 4PDMA 4UB8Z 1SKVA 1AI4A 4UVAA 3EHBB 5L3BA 1WN7A 2M7WA 3BFRA 3K5NA 3F7YC 2QA4V 4CS3A 3LNMB 1YHQV 4U3JA 2DW4A 5KUMA 4DK1A 4X20B 1H2LA 1VF6A 4JYCA 1AI5A 3SYOA 1JVMA 1NTKH 2FL4A 3AG7A 4E4EA 4FM2A 4YJ2A 1WP7A 1CP9A 5LP6C 2UXXA 4BIUA 1K5SA 3ZHTA 1OCZB 3ZS8C 4B3SB 5LYJB 1N33B 2OWOA 4PA9A 3W7XA 3F5TA 4PELA 3UO2A 3CRRA 2DOSA 4I4TA 1SF9A 4PV1B 2R9AA 1I94O 1P49A 3K5MA 1YVWA 4BWAA 4IYHA 2A79B 1K73W 4DW1A 3LDDA 2CTRA 3CRQA 5GTHZ 3Q4HA 5FPRA 3MAQA 2GUZA 4UFZA 2UUAB 3UQ8A 4YHHO 4X65B 3CC4V 3DC5A 4MS2A 4P30A 4P9OA 1AILA 1QLEC 2LW1A 4LBEC 1MSWD 3N2KB 4OGQB 2JS5A 3C3TA 3OEHG 4NR1A 1FFXB 4X1IB 3RBZA 2PTMA 2Q0AA 3H9VA 2X6AA 1GN4A 2YC0A 1BT8A 1P4RA 2DYRC 3UT5A 5JVDB 3BY6A 1VQMV 1GMGA 4HNAA 5LXTA 1ROPA 1S5HC 4X1KB 2OTLV 2PY5A 5H5NA 4UCVA 4KHPO 2F66C 4X9QA 3MHSC 2B9ZA 1EZJA 1NR7A 2UXCO 1Q6HA 4GT1A 4GZRB 1JPXA 2YI9A 4K35A 4MT8A 3OAAG 2DQ0A 4DK0A 1FXKC 1H8HG 4QPJA 3DSQA 5LMUO 1FFTB 4X64O 5GONA 5HFLA 3ML0A 1E79G 2Q7HA 4FZ1A 5BMVB 4KFMA 2V7QG 4RWUA 1MABG 3DXRB 3T2MA 3SYQA 4JI7O 2HHHB 3D36C 5LA6B 5IY5B 3QO5A 1I08A 1IBMB 3RT3C 1SZTA 2DWDC 2GDSA 4OX9B 5FLXN 2AW9A 5K1XA 1QHTA 3L9DA 4IL6Z 4JI3B 4DR4O 1E1RG 1N4CA 2Y69B 4DRXA 3BAAA 3CCUV 3CCLV 3D8CA 1WB7A 3FKSG 2FMLA 4I55A 3K5OA 1QR9A 2VQEB 1VQ7V 1WA8A 3QNEA 2HVJC 4LP8A 4YJ2B 1OCRB 4RUFA 2FB5A 4HYOA 1M9NA 3JYCA 1FD9A 3ABTA 1NU1H 3JD3A 3A0RA 2EINC 1FXKA 2HVKC 4W4LA 4X1YA 5CB4A 4F6EA 1WJZA 2ZE5A 1P7GA 5KAFZ 1EBOA 1MZEA 2CK3G 4I4TB 3FX7A 1SESA 2ATKC 3D36A 2B1GA 3K79A 4H37A 4G27B 5H6RA 4DR7O 2Z0AA 5IYZA 4I50A 4IGGA 4DV4O 1XL4A 2GUZB 4DUZO 3L72H 1GTOA 3OMIB 5EBWC 2Y0IA 2BOCC 2EX3A 1G8MA 5BXZA 5KLVH 3CRMA 4KXRA 4DR5O 4DV3B 2JEXA 4GCZA 2ZIOA 5LP6B 4NKGB 1PP9H 2HG5C 1W0KG 2P6JA 2EZPA 3UT5B 4K3AA 4CZZA 1HDJA 1HR0O 3STZC 4HNAB 1JR9A 3CMEV 2EIKC 4WF9V 1KU9A 4X62O 1J95A 1D2DA 3E89A 2HJDA 2XOKG 3BHPA 2YIDA 3EVKA 4PI2A 3E83A 1RM1C 4R6ZA 3L75H 2LGWA 4R8CA 5H9CA 3SR2C 3DGEA 1ENVA 1Y66A 1GM9A 4K8XA 3HKBA 5J2UA 5BR8B 5GONB 4LFBB 4ZHQA 1K4DC 4XDJA 4YHHB 2DJVA 3KZIZ 2JJ2G 4PJ0Z 1WP8A 4I0XA 4FLUA 1QLEB 1Y6XA 3CSXA 1I5YA 2OCHA 1TA8A 1W0JG 1Q5OA 1SQGA 4X8AA 3TJTA 3JSLA 4QGPA 2R9RB 2X6BA 3APOA 4LF8B 3UKMA 2ARHA 1VF7A 1JMKC 2DYRB 5IJ0A 1XMQO 4DRXB 3CEIA 5A9GA 1KP3A 2UU9O 4JI5O 2ZR3A 3OFNG 4I55B 1WA8B 2QE7G 3JARA 1TGOA 2FYUH 2QTOA 2CGOA 2OIGA 2QWNB 4DV2B 2IU0A 4TOIA 5EBLC 4EKWA 1VEWA 3FYIB 4K0KB 1FXKB 4X1YB 3T1HO 5CB4B 4JTCB 4O4HB 1BCCH 1AJPA 4BW5A 1N34B 2Y4UA 3B8MA 5LHHA 2OYQA 3JCZA 4DR1O 1URFA 1X59A 3CWBH 4TUYA 5IYZB 4I50B 2ZKOA 5LGNA 3A2FA 2JIZG 1VQ4V 2CE4A 4LFCB 1CEZA 1HNXO 2DMXA 1OV9A 1AR1B 1N36B 1S5JA 4D7TA 5FPOA 3JAWA 4J9ZB 4MVUA 4P9PA 1PV0A 3SJQC 2MK3A 2D2CB 4JV5O 2YXLA 1NI8A 2EINB 1NBMG 4FIPC 1Q3EA 4OPAA 2E3CA 5LHIA 1SS3A 1KBHA 3SPJA 4LNUB 1VQLV 4DYLA 1R73A 3THOA 2RN9A 2LO1A 3JATA 3ZRVA 3D3QA 4DR7B 4FLVA 4H13B 4DV4B 1AJNA 1S72V 2EBOA 1YJWV 3ZCCA 4BAYA 5J2UB 2EIJC 4ZHQB 2ADQB 4HBNA 1AROP 2KKWA 2YIAA 2Q9LA 4X20A 3U0ZA 2EIMC 2P4KA 4I0XB 5JCOC 4DV1O 1FXVA 2X6CA 2UUBO 3ZX6A 1RSOB 2QTSA 1YTFD 2P22C 1H2KA 3N2GA 3ZHSA 4WFHA 5IJ0B 3ETEA 4B7EA 1VQPV 3HPLC 1P7BA 3JARB 2EIKB 1XILA 1XEQA 3ZRSA 1MNGA 4EEQA 1DLBA 4KL1A 1XMOO 1RM1B 2ZINA 4MTGA 1IX9A 5CBHA 1JFFB 2QKAA 3ASNC 3ZMZA 4Z2WA 3TXQA 3K04A 5B1OA 3GB7C 3CCSV 3HKEB 2YDEA 3OGCC 2P90A 3MHHC 5JCOA 4UCSA 4CC5A 2VQFO 3ZHRA 2R72A 1VQ9V 3WB2A 1M57C 2Q7EA 1YZBA 4R7CA 4TUYB 2WLLA 3GWOA 3AG3C 1R6KA 4JI5B 4ABMA 5B66Z 4B3MO 3I55V 3HR0A 1V55C 4UB6Z 2ETNA 4PD4F 2F93B 3D3IA 4D7SA 5JWPA 5EZYA 3AK1A 2F1MA 4XDKA 3BPZA 5KMGA 1Z2GA 2UXDB 3JAWB 3B77A 1R3IC 1DTOA 5GTIZ 2QR4A 4JI2O 1GH6A 3T1HB 1G4YB 1Y67A 1IBLB 2ZCEA 1SA0A 2HJFC 4ZKIA 5C93A 4GYCB 4IIJA 2UXNA 4JF3A 5J2TB 4WFEA 4JYAB 2WA3A 4DR6O 3ZMSA 4MTOA 1AVMA 2LW7A 2PF4E 5B5EZ 4DUYO 1N0NA 2AHZA 5IYDO 3K08A 3JATB 1QVFU 1YF2A 3DXRA 1FXHA 5LA6A 3JD2A 4MSWC 4Q6GA 1ZLZA 1NH2D 1GK9A 1HNXB 3ICXA 4LF4B 2GTSA 1FJGB 1H38A 3F5WC 1M93A 3I5DA 3CCQV 4GX0A 1J5EB 5LOVA 4LF7O 1VQ6V 3OEEG 1GN6A 3VOUA 1QVGU 1IXBA 1US6A 3N2GB 1W2BU 4X89A 4CH5A 1N32O 4JV5B 1SQPH 1R3KC 4MVZA 4DV0B 1XHZA 1PNLA 2WLJA 5L3CA 4JTAB 4CS2A 5EC2C 4YIOA 5LGTA 5DEDA 4OPHA 1NVPD 1F4MA 3M8AA 3BA9A 2YS8A 4NVPA 2M6YA 5C8YA 1GN3A 2RCVA 4UCOA 5JH7A 3PJSK 2YIBD 2H8PC 3OUFA 1QBZA 1NTMH 4NXMB 1SQFA 2ZE6A 1VF5B 4CC6A 2EIJB 3AG4C 4F4LA 3H1IH 1AI7A 4O4LA 2HKOA 2EIMB 4I9WA 4B3RB 2GV9A 3RGBA 4J41A 3J7AU 1V9PA 1Z5WA 4MVMA 1Y74A 3W7UA 2F43G 3NR7A 2WLLB 2BTQA 2Z5UA 4J9YB 3DTUB 5B1AC 1SRYA 3K0GA 3E2EA 3L74H 1BZKA 5EBMC 5LP6A 3RVZA 4J10A 3DC6A 3LSUA 2G38A 3B4SA 2WLNA 5ITZA 5B3SC 5IWAO 2PGGA 5EZYB 3CHXA 3RYHA 3ZN1A 4LF9B 5KMGB 1S76D 1K33A 3P3PA 3L71H 2BCCH 2JK5C 2W0XA 4TQFA 1HNZO 1L0LH 1CXZB 4CH3A 2IJHA 3OTOO 2Q5ZA 3A0HZ 3I56V 1SA0B 3SYCA 4IIJB 3ASNB 4DR2B 2VRZA 2KSDA 4J7JA 4FM1A 4J7ZA 2OCCC 3E8BA 2Q8VA 3K06A 1IBKB 1SQVH 4JYYA 1M57B 1KYOF 4NTYA 1KP2A 2CAZC 4PHZA 3AG3B 4I5SA 4QIWF 3CS5A 3WFVA 1V55B 4AQYB 1Q82W 3K57A 4J11A 3KCXA 2HFEC 3JALA 3FAVA 5LOVB 2ZXWC 1IXMA 3JASA 1KKDA 2Z3YA 2OIEA 3SPHA 1CPYA 4L8JA 3VQXA 2AZ2A 2UUCO 1UPGA 1WLEA 2R70A 2RQ6A 5LMNB 2HP8A 3QF7A 4IHJA 2L35A 3QO7A 1EZVH 2YXHA 5L3GA 1YEWA 4PA6A 3OM3B 4J80A 3ZMUA 2QM7A 3ZHQA 3K58A 4O2BA 5EYPA 3FD9A 5DECA 4DR6B 1FKAO 5D5QA 1PKXA 4UV8A 4JI8O 2CH7A 3ABMC 3RYIA 5C8YB 2Q7GA 4FPPA 2Q4PA 1A32A 3JAKA 1XL6A 2WA4A 3ZJZA 4O4HA 2BE3A 2AZ0A 3SGIA 5JH7B 1L1FA 4HAMA 2PYLA 4RQEA 5JJJB 3SYPA 4NXNO 3E8FA 4Z1MG 1XBLA 2YUAA 4O4LB 2YSUB 2GSMB 4JI0O 5IT9N 3HKDA 3OR7C 4C7UA 1S3JA 5GW7A 2WWWA 2WSSG 4DV7O 1GO3F 2ITDC 5TISZ 1Y74B 2LQTA 3CMAV 3IGAC 1SC5B 1N32B 2F23A 2BTQB 5L3EA 4UVCA 2CTWA 4LH6A 4QNHB 1Q6IA 1DF4A 1M56C 3E22A 3CJHA 5B1BC 4FM0A 5ITZB 1F7YA 3BA8A 3RYHB 1XDCA 3CRAA 2WAMA 4FVMA 3ZMTA 4LNUA 4DV5O 3CCMV 3UM7A 3RYCA 1I94B 3B2EE 2E74B 3WU2Z 1ZUQA 1FPOA 1OHHG 4U7OA 4RQFA 3STLC 1GM7A 5KA5A 3P32A 4IT5A 2PI4A 4MW3A 3AG4B 3B8NA 2ZIMA 1WAZA 4PA7A 4PDVA 4IYIA 1H2GA 3CRCA 4OXSA 3K3WA 1LUWA 1F51A 4JAVA 5EIBD 3W7TA 1T5EA 3ETGA 5B1AB 1RSOA 2DN9A 5KHHA 2Q68A 1BSMA 3MDSA 4FFKA 5B3SB 3JALB 3FAVB 4PDRA 1B06A 1U96A 3JASB 4GX5A 1VIBA 5H2FZ 2LGQA 1BS3A 2QGNA 2Q67A 4KHPB 4RO2A 4YY3O 3CCRV 1R3LC 2IBZH 1D5AA 2UXCB 1YJ9V 4IHJB 1KECA 3CXCU 1NKDA 3H1KH 4E2LA 3LDEA 1K5QA 4NTXA 4O2BB 5EYPB 5LMUB 4TSFG 4X64B 2CTQA 2E75B 2CH7B 3RYIB 1S0VA 1JFFA 3ABLC 1IVSA 1YTFB 2P7TC 3JAKB 2OCCB 5H6QA 5KX5A 3HKEA 1P84F 5FL7G 4DR3O 2DE0X 4JI7B 3KKYA 3VQYA 4RAIA 4O4JA 1NTZH 2QEXV 1Z5VA 3S3WA 2AGAA 4DR4B 3OTFA 5IDJA 4UCUA 3HKDB 4LFAO 2V1DA 1B04A 2HLDG 1WPXA 2ZXWB 1JJOA 3AK2A 4TV8A 4X66O 4B08A 2E5LO 2Q73A 3U11A 2Q0OC 1K9MW 4L87A 4O4IA 3E22B 3BABA 1YJNV 1BHAA 4ZBMA 3CJHB 5E1AC 4WBNA 1B3QA 4Q20A 1SETA 3IAYA 3U10A 2QKSA 3LNNA 2ZR2A 3OGIB 3ABMB 1M5IA 4KP4A 4JI6O 5J2TA 2X0LA 2IH3C 3ZRWA 4JYBA 3CCEV 2PZSA 1VMGA 3RYCB 1ZWIC 5EK0A 2ZDIC 4GKKO 4ICGA 2JJ1G 3C3SA 3OMAB 3P3NA 2FTKA 3G6BA 4JI0B 1UJWB 1SQQH 1Y76A 3FB5C 2JGDA 3SDLA 5E79Z 4DUZB 1ZSPA 4LWSB 1VP7A 4JASA 1M1KW 1WPBA 1XHXA 4B3SO 2H3OA 2L6LA 2P06A 1N33O 2WLMA 2YEVA 2B5UA 3K5LA 1DGSA 4EFEA 2RNBA 4DR5B 1THZA 1EN6A 2RDCA 3APQA 1AJQA 1I0HA 1M56B 1GM8A 3H01A 2XAGA 2MW2B 4Z1VA 5B1BB 1HR0B 3ZHUA 1JCHA 4X62B 2K1EA 2AXTZ 2UUAO 1KKCA 5KHIA 3T1YO 2ITCC 1OJHA 2ZDIA 3CD6V 3A0BZ 3T1CA 1XNRO 4B3TO 2LFRA 4LR3A 3T4ZA 5KUKA 2A7WA 5A2QN 5BZBA 4J7KA 5AG2A 3AG2C 1PNMA 1MZFA 5KX5B 3SPCA 2IM9A 4LC1A 1QNMA 3ZBHA 1RFYA 4O4JB 5CA0A 2EZOA 3QVNA 2QM4A 2A9HA 2WPDG 1O9GA 3BRCA 1XMQB 2BOBC 2UU9B 2QJ1A 3ZHVA 4TV8B 2YI8A 2LFSA 4YY3B 3P30A 2IJJA 1Q90D 4WFBV 3N27A 2HHHO 2W6IG 1IBMO 4O4IB 4AI8A 1L0NH 5BY1A 4WBNB 5JJEB 1H8EG 3ZMVA 2DQ3A 1Q6UA 4A5UB 5EIBC 1EN5A 2DWEC 4J42A 4FFBA 3JD4A 3ABLB 2VQEO 2VWKA 3ZRWB 1EFRG 4DR1B 3JD0A 1OZ0A 3PN1A 3KCYA 3ABUA 3WG7C 2ZE7A 1K34A 3KG2A 2LP7A 3ZEDA 5CN0A 3RFRA 4ZOLB 2RMKB 4LFAB 1Y76B 2JGDB 2ODMA 2KB1A 3WB0A 3RVYA 1HNWO 1SERA 4H44B 4WFFA 4X66B 2XAFA 1MSDA 4JI1O 2ZNIA 2YEVB 1EN4A 2A3QA 1W59A 2E5LB 2K9PA 1HP8A 2FKXA 1I5XA 3HB3B 4XDLA 1H2SB 1ZAUA 1PL4A 3SYAA 2RJZA 1YIJV 1E1QG 1YSCA 3CXHF 1JX9A 1G6UA 4JI6B 2QDOA 3L73H 1BGYH 1TUEB 3RN4A 3CB2A 4UCTA 1O9HA 1K97A 4CH4A 4UCRA 4NYKA 4GKKB 5F2VO 4DW0A 4LF6O 3B09A 4F6RB 2GBOA 2XUMA 4DV3O 2OTJV 1YXBA 1AB3A 3H1JH 1BE3H 4UVBA 4EFBA 4X88A 1OCOC 5CBGA 2CUGA 3O9OA 3ZN0A 3H1HH 1NQTA 4G2KA 2H94A 2X7RB 4DV1B 4MW8A 4I7ZB 1D5NA 3K9AA 5CA3A 2IH1C 2UUBB 3TCUA 5CA0B 1IZ3A 1VARA 3G67A 3EFFK 3FB7C 3IFXA 1Q86W 1AP5A 5IYCO 2QWOB 2DYSC 2NLJC 3R65A 4YXWG 4JAUA 1XI1A 4O2AB 5D5PA 4JPRA 5BR8O 4LFBO 1QR8A 4MTXA 4MTFA 3T1YB 1SZXA 1JJ2U 1XMOB 4QPKA 2WLHA 3T4DA 1ORQC 2B1IA 1XNRB 3IC9A 4B3TB 1HWYA 1H2MA 1G1XB 3X2QC 1XOUA 4LF8O 1F23A 4FFBB 5JJNB 3ASOC 3AG2B 5CMUA 1Q81W 1GN2A 4JZGA 2VQFB 4PDLA 2JVDA 2W6JG 3AG1C 1DK1A 2KG7A 3SPGA 4DV2O 1XQ8A 4H0LB 1BMFG 1Q8IA 4XBFA 1AR5A 1YDXA 1KB9F 4R50A 4B3MB 1XREA 2Q69A 4K0KO 1VQ5V 4FLWA 1TUBB 2P5OA 3AK3A 2VWJA 3LUTB 3G80A 4JTDB 1Q7YW 5IJ9A 3JAMN 5JQGA 1KQSU 1QCEA 3GVMA 3K0DA 4TQDA 1N34O 3E8GA 2ADPA 2P4VA 1FS0G 4JI2B 4ASUG 4I9QA 4U3JB 5EC1C 3B40A 4FLXA 3TGUH 1WB8A 4N23A 4LF5O 1S77D 3R66A 4LFCO 1TVKA 1MOFA 2JEUA 1MG1A 4KUMA 1RPOA 4DUYB 1BQ0A 1XNQO 4CH6A 3L70H 3BCCH 3WG7B 1N36O 4PI0A 1NR1A 2A06H 2EJ7A 3CE2A 1KD1W 1GAXA 4UXNA 2ZM6O 2NR5A 1ZX3A 2PYJA 3G71V 3K59A 3FB8C 5KHJA 1HNWB 1BL8A 2WLKA 4JI1B 4LF7B 4YIPA 5CA1A 1KUQA 1KC8W 4MVOA 5CBFA 4DO2A 1ZL8A 1H2NA 1FYJA 2QSAA 5IYBO 4U7NA 1VQ8V 3ETQA 3Q4HB 1RP3B 4DXWA 3LDCA 3SPIA 1QQCA 2HR3A 1MA1A 4NB5A 3O65A 1QLNA 3CC2V 2ZE8A 3J80N 1LR1A 2JS3A 4W4KA 2EILC 4LF6B 1PPJH 2XAHA 3BEHA 4BR6A 4GKJO 3ETDA 3SJBC 4D6TH 2ZD9A 3TETA 3J81N 3EXAA 5J9PC 3OE7G 1NJIW 1OCOB 3TK1A 1U97A 2XAQA 1L8DA 3OD4A 3E86A 5LXTB 2VS0A 1TAEA 3G4SV 1V54C 1Y4MA 4LWSA 3SJCC 2QWQB 3E35A 5K1PA 2KG7B 2ZNJA 1R3JC 2ZQMA 3ABKC 2GTAA 2DYSB 2YICA 2N05A
chains in the Genus database with same CATH topology
2WLMA 4KFMA 2YEVA 1GK9A 1NH2D 2B5UA 2V7QG 1JOYA 1MABG 3T2MA 3SYQA 5IY5B 3QO5A 1H38A 1THZA 3F5WC 3CCQV 4GX0A 1SZTA 2DWDC 1AJQA 1M56B 2XASA 1GM8A 3H01A 1VQ6V 2XAGA 5B1BB 1K8AW 3OEEG 1E1RG 5DM6V 3VOUA 1JCHA 2Y69B 1QVGU 3CCUV 1W2BU 4X89A 3CCLV 4FK5C 3FKSG 1R3KC 2K1EA 1QR9A 2W0FC 4MVZA 1VQ7V 3QNEA 1OCCC 1PNLA 3X2QB 2HVJC 2WLIA 2WLJA 5L3CA 4LP8A 4JTAB 1OCRB 5EC2C 4MVSA 2ITCC 2AHYA 5LGTA 4RUFA 3ASOB 1NVPD 1F4MA 2ZDIA 4HYOA 3CD6V 5LGUA 4MVRA 1M9NA 4WFGA 3JYCA 2IJKA 3ABTA 3T1CA 3JD3A 2LFRA 2EINC 3A0RA 1FXKA 3AG1B 3T4ZA 5KUKA 2HVKC 5BZBA 3AG2C 1PNMA 3M99B 3PJSK 2H8PC 1PD3A 1QBZA 1EBOA 3OUFA 3SPCA 4LC1A 4BIZA 2CK3G 1LNQA 2EIJB 2IU3A 1SESA 2EZOA 3IC7A 2ATKC 3AG4C 3D36A 1AI7A 4F4LA 2B1GA 2A9HA 2HKOA 2EIMB 2WPDG 4I9WA 3K79A 1VQNV 4H37A 4G27B 5H6RA 2P67A 3CC7V 2BOBC 4MVMA 3W7UA 1XL4A 2F43G 2WLLB 2Z5UA 4J9YB 4P2ZA 1GTOA 2C2AA 3DTUB 4CBCA 2LFSA 5B1AC 3P30A 1AI6A 3OUSA 2IJJA 4WFAV 1SRYA 3OMIB 4QJFB 3K0GA 5EBWC 3E2EA 4WFBV 5EBMC 2BOCC 3RVZA 1G8MA 2XNDG 2WLNA 3ZRXA 3F7VC 5B3SC 2JEXA 2W6IG 3ZN1A 4GCZA 1K4CC 1K7DA 1R6NA 2HG5C 2Q6AA 1W0KG 1H8EG 2P6JA 1K33A 4GX2A 2EZPA 1VQOV 3ZMVA 1S76D 3CYOA 2DQ3A 4CZZA 2JK5C 3STZC 3OW2U 2DWEC 2R9IA 2IJHA 3JD4A 3ABLB 3CMEV 2EIKC 3JD1A 4WF9V 1K3EA 1J95A 3I56V 3E89A 3ZRWB 5L3FA 1EFRG 2XOKG 2Y48A 3SYCA 1YITV 4QE7A 3JD0A 1OCZC 1OZ0A 3ASNB 3ABUA 3WG7C 1K34A 4RUEA 3LSQA 3KG2A 2LP7A 3E83A 1RM1C 4R6ZA 5CN0A 3CCVV 3OR6C 5H9CA 4R8CA 2OCCC 4TT3G 3DGEA 3E8BA 1ENVA 3K06A 1Y66A 1GM9A 2A0LA 2KB1A 4N21A 1YI2V 1M57B 3RVYA 1KP2A 2OT5A 1K4DC 1K92A 4XDJA 4LCUC 1SERA 3AG3B 4WFFA 2XAFA 1PL0A 2JJ2G 2YEVB 4I5SA 4QIWF 3VBBA 5LHGA 1QLEB 3WFVA 1F4NA 1V55B 1I5YA 3RW0A 1Q82W 1VQKV 1W0JG 1I5XA 3HB3B 4XDLA 2HFEC 4X8AA 3SYAA 2ZXWC 1IXMA 3MD0A 1KKDA 3CP1A 2Z3YA 1YIJV 3SPHA 2EILB 2R9RB 2X6BA 1E1QG 1YSCA 3UKMA 1CPYA 2DYRB 4PA3A 3FB6C 1JX9A 1NH2B 1WLEA 3LSSA 1KP3A 2ZR3A 3OFNG 4H33A 2EJRA 1TUEB 2QE7G 3QO7A 2WLIB 5L3GA 1K97A 3QO8A 2JDIG 3OM3B 4PA6A 2QTOA 3ZMUA 2QM7A 1PNKA 4JGSA 1PKXA 4FJCC 4UV8A 1V54B 2OTJV 1DF5A 3ABMC 5EBLC 2IU0A 4EKWA 4FPPA 4UVBA 1XL6A 3FYIB 1FXKB 4X88A 1OCOC 3ZJZA 5CBGA 5KA6A 5L3DA 1L1FA 3ZN0A 1NQTA 3ABKB 3K03A 2H94A 4G2KA 2X7RB 4JTCB 2XAJA 4MW8A 4HAMA 3NXSA 4RQEA 3K9AA 1NVPB 5CA3A 2IH1C 3W7SA 3SYPA 3E8FA 4Z1MG 1AJPA 4BW5A 3TCUA 5B1NA 3B8MA 5LHHA 3CCJV 3JCZA 1RPRA 2YSUB 2GSMB 2PI5A 1M90W 2IJIA 3EFFK 3OR7C 3FB7C 3IFXA 5HFMA 3AEIA 1S3JA 1Q86W 5GW7A 2WWWA 2WSSG 5IYCO 3W7WA 2DYSC 2NLJC 2IW5A 3R65A 1GO3F 2ITDC 2GHYA 4YXWG 4JAUA 4GX1A 5LGNA 3CMAV 3OMNB 2JIZG 3IGAC 1VQ4V 4PA4A 4QE9A 5IY5C 1CEZA 5L3EA 4UVCA 4JPRA 1COWG 4QNHB 5LBQA 1QR8A 4MTXA 4MTFA 1N8RW 1DF4A 1OCCB 1M56C 1JJ2U 1AR1B 4HZ3A 4UUJC 4FMTA 1JQ0A 5B1BC 3G6EV 4QPKA 4TWKA 2Y69C 2WLHA 4J9ZB 3T4DA 1ORQC 4MVUA 5DN6G 2B1IA 4P9PA 3SJQC 2MK3A 1HWYA 1B6QA 2WAMA 2D3OW 3X2QC 2EINB 3ZMTA 1NBMG 1OCRC 1F23A 4FIPC 3CCMV 3E8HA 3UM7A 2NNUA 3ASOC 3AG2B 1BHBA 5LHIA 5CMUA 3SPJA 1Q81W 3ZIAG 1OHHG 4WCEV 4U7OA 1R73A 4RQFA 4MVQA 3STLC 1VQLV 1GM7A 3FYEB 4UV9A 4PDLA 2W6JG 5KA5A 3P32A 2PI4A 4MW3A 3AG4B 3AG1C 3B8NA 4PA7A 3ZRVA 3SPGA 4PDVA 1H2GA 1BMFG 2QM8A 4OXSA 4XBFA 4G28B 3CPWU 1GKFA 3K3WA 1AJNA 4PDMA 4R50A 1F51A 1S72V 2EBOA 1YJWV 3ZCCA 2Q69A 4BAYA 4JAVA 3W7TA 2EIJC 1VQ5V 1AI4A 4UVAA 1AROP 3EHBB 5L3BA 3LUTB 2M7WA 3ETGA 5B1AB 2EIMC 3F7YC 2QA4V 4JTDB 1Q7YW 3LNMB 1FXVA 1YHQV 2Q68A 2DW4A 5KUMA 1KQSU 1QCEA 2X6CA 3K0DA 3E8GA 5B3SB 4PDRA 1YTFD 1FS0G 4GX5A 4ASUG 4JYCA 1AI5A 3SYOA 4WFHA 1JVMA 5EC1C 2Q67A 4RO2A 4N23A 3CCRV 1R3LC 1S77D 3ETEA 1YJ9V 1VQPV 3HPLC 1P7BA 1MOFA 2JEUA 1MG1A 1KECA 4KUMA 2EIKB 1CP9A 1RPOA 2UXXA 3CXCU 4BIUA 1NKDA 1K5SA 3ZRSA 4E2LA 3LDEA 1K5QA 1OCZB 4TSFG 1DLBA 3WG7B 1RM1B 1S0VA 1NR1A 3ABLC 1YTFB 2P7TC 4PA9A 3W7XA 2OCCB 5H6QA 1KD1W 4UXNA 4PELA 5FL7G 4MTGA 3G71V 3FB8C 4RAIA 5CBHA 3ASNC 3ZMZA 3K04A 1BL8A 2WLKA 5B1OA 3GB7C 3CCSV 2QEXV 3OGCC 2P90A 3MHHC 1KC8W 4MVOA 2A79B 5IDJA 1K73W 5CBFA 4DO2A 3LDDA 1VQ9V 1M57C 2V1DA 2HLDG 1WPXA 4R7CA 2WLLA 2ZXWB 3GWOA 3AG3C 5IYBO 4U7NA 1VQ8V 1R6KA 3CC4V 4MS2A 4P30A 4P9OA 1MSWD 1QLEC 4LBEC 3I55V 4DXWA 1V55C 3LDCA 3OEHG 3SPIA 3D3IA 3RBZA 1K9MW 4L87A 2HR3A 1QLNA 2X6AA 3CC2V 1YJNV 1BHAA 4ZBMA 2EILC 4XDKA 5E1AC 2XAHA 3BEHA 4Q20A 1SETA 3ETDA 1P4RA 2DYRC 3BY6A 3B77A 1R3IC 1DTOA 1VQMV 2QKSA 1GMGA 2ZD9A 2ZR2A 3ABMB 3TETA 1ROPA 1S5HC 4KP4A 2OTLV 2X0LA 1G4YB 5J9PC 3OE7G 1NJIW 1OCOB 2HJFC 2IH3C 3TK1A 4ZKIA 2XAQA 4JYBA 3ZRWA 5C93A 3CCEV 3MHSC 1ZWIC 1EZJA 3E86A 2UXNA 5EK0A 2ZDIC 1NR7A 2JJ1G 4JF3A 3G4SV 4WFEA 4GT1A 1V54C 1JPXA 1Y4MA 3OMAB 3ZMSA 4MTOA 2FTKA 4MT8A 3OAAG 3E35A 2DQ0A 1UJWB 2AHZA 5IYDO 1FXKC 3K08A 3FB5C 1H8HG 4QPJA 1R3JC 1FFTB 1QVFU 2ZQMA 5HFLA 1FXHA 3ML0A 1E79G 3ABKC 3JD2A 4JASA 1M1KW 4MSWC 2DYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFF K;  2WLM A;  4KFM A;  3OR7 C;  2YEV A;  3FB7 C;  3IFX A;  2JK5 C;  3STZ C;  3SYO A;  3T2M A;  3SYQ A;  3ZRS A;  2DWE C;  3LDE A;  2DYS C;  2NLJ C;  3F5W C;  3R65 A;  2EIK C;  2ITD C;  4GX0 A;  2DWD C;  4GX1 A;  1J95 A;  3IGA C;  4PA4 A;  3E89 A;  4QE9 A;  5IY5 C;  3SYC A;  4QE7 A;  3ABL C;  1OCZ C;  2P7T C;  4PA9 A;  4QNH B;  3WG7 C;  4MTF A;  4RUE A;  3KG2 A;  3VOU A;  4MTG A;  3E83 A;  1M56 C;  4R6Z A;  3FB8 C;  4HZ3 A;  3OR6 C;  4RAI A;  4R8C A;  4UUJ C;  4X89 A;  2OCC C;  3ASN C;  5B1B C;  3E8B A;  3K04 A;  1BL8 A;  3K06 A;  1R3K C;  2K1E A;  2W0F C;  2WLK A;  3GB7 C;  4MVZ A;  4TWK A;  1OCC C;  2Y69 C;  2A0L A;  3OGC C;  2HVJ C;  2WLH A;  2WLI A;  2KB1 A;  1ORQ C;  2WLJ A;  4J9Z B;  4LP8 A;  4JTA B;  4MVU A;  3T4D A;  5EC2 C;  3RVY A;  4P9P A;  4MVO A;  3SJQ C;  1K4D C;  4MVS A;  2ITC C;  2AHY A;  2A79 B;  4XDJ A;  4LCU C;  4RUF A;  3X2Q C;  4WFF A;  5CBF A;  4HYO A;  3LDD A;  1M57 C;  1OCR C;  4MVR A;  4R7C A;  4WFG A;  2WLL A;  3JYC A;  3E8H A;  3UM7 A;  3ASO C;  3T1C A;  3AG3 C;  3RW0 A;  2EIN C;  3SPJ A;  3T4Z A;  5KUK A;  4XDL A;  2HFE C;  4MS2 A;  2HVK C;  4P30 A;  4P9O A;  4X8A A;  1QLE C;  4LBE C;  5BZB A;  3SYA A;  2ZXW C;  4MVQ A;  3STL C;  4DXW A;  1KKD A;  1V55 C;  3AG2 C;  3PJS K;  4PDL A;  2H8P C;  3LDC A;  2R9R B;  3SPH A;  3OUF A;  2X6B A;  3SPC A;  4MW3 A;  3AG1 C;  3SPI A;  3UKM A;  3RBZ A;  4PA3 A;  4PA7 A;  3SPG A;  3FB6 C;  4PDV A;  1LNQ A;  2X6A A;  4ZBM A;  2EIL C;  4XDK A;  4OXS A;  5E1A C;  4G28 B;  3BEH A;  2ATK C;  3AG4 C;  4H33 A;  4F4L A;  4PDM A;  2DYR C;  4R50 A;  2A9H A;  2WLI B;  2Q69 A;  4I9W A;  1R3I C;  2EIJ C;  4H37 A;  4G27 B;  2QKS A;  2ZD9 A;  4PA6 A;  2QTO A;  3TET A;  1S5H C;  3LUT B;  2BOB C;  2EIM C;  1G4Y B;  5J9P C;  4MVM A;  1XL4 A;  3F7Y C;  4JTD B;  2HJF C;  2IH3 C;  3LNM B;  2WLL B;  2Q68 A;  3ABM C;  4J9Y B;  5EBL C;  4P2Z A;  5KUM A;  4CBC A;  1ZWI C;  3E86 A;  4EKW A;  2X6C A;  3K0D A;  5EK0 A;  5B1A C;  1XL6 A;  3E8G A;  3OUS A;  4X88 A;  1OCO C;  3ZJZ A;  5CBG A;  4WFE A;  1V54 C;  3K0G A;  4PDR A;  5EBW C;  5EBM C;  2BOC C;  3RVZ A;  5CBH A;  4MTO A;  4GX5 A;  3K03 A;  2WLN A;  4JTC B;  2AHZ A;  4WFH A;  1JVM A;  3F7V C;  5EC1 C;  2Q67 A;  3K08 A;  3FB5 C;  4MW8 A;  5B3S C;  4RO2 A;  1R3J C;  2IH1 C;  1K4C C;  3SYP A;  3E8F A;  1R3L C;  4BW5 A;  3TCU A;  3ABK C;  2HG5 C;  2Q6A A;  4MSW C;  3HPL C;  1P7B A;  4GX2 A; 
#chains in the Genus database with same CATH topology
 5KHG A;  3BVO A;  1JOY A;  5IWA B;  1HW7 A;  3RYF A;  4JI4 O;  4JZ2 A;  5FNV A;  3M7M X;  5IJ9 B;  2O57 A;  3HKC A;  2XAS A;  3CX5 F;  5JQG B;  2ILM A;  2F4V O;  2HEP A;  1K8A W;  3IJ4 A;  1HNZ B;  5DM6 V;  4CS4 A;  3OTO B;  2KQX A;  2UXB O;  1R1B A;  4FK5 C;  2W0F C;  4ZIB A;  1OCC C;  3X2Q B;  2WLI A;  2PUS A;  4MVS A;  2AHY A;  1TVK B;  3QTC A;  3ASO B;  2EUL A;  4ZI7 A;  1X4T A;  4FLY A;  5LGU A;  4MVR A;  1NT2 B;  4WFG A;  1BQZ A;  2NN4 A;  2IJK A;  4FLZ A;  4AIL C;  3AG1 B;  1I7F A;  3FFQ A;  1KMI Z;  2JGU A;  2UXD O;  3M99 B;  1PD3 A;  1PM9 A;  1IDS A;  4BIZ A;  4B7K A;  1LNQ A;  2IU3 A;  4DV6 O;  3IC7 A;  1IBL O;  2XT9 A;  4AHC A;  2N74 A;  4LH7 A;  5CA1 B;  4U3F H;  1VQN V;  2Y4T A;  4BW9 A;  4EB6 A;  2P67 A;  4JYA O;  4TV9 A;  2UUC B;  3CC7 V;  2YIB A;  1LUV A;  2LJ2 A;  1ZL8 B;  3A8T A;  4JAA A;  4P2Z A;  2C2A A;  4CBC A;  1AI6 A;  3JCU Z;  3OUS A;  4FLT A;  4WFA V;  4YJ3 A;  4QJF B;  4LF5 B;  3VQV A;  2XND G;  1GRJ A;  1R6T A;  4LF4 O;  3ZRX A;  3F7V C;  4JI8 B;  1FJG O;  1XNQ B;  1K4C C;  1K7D A;  1SQB H;  1J5E O;  1R6N A;  2Q6A A;  1VQO V;  4GX2 A;  3CYO A;  1AR4 A;  3OW2 U;  1NS1 A;  2R9I A;  2ZM6 B;  4NXN B;  2N04 A;  3GWK C;  3JD1 A;  1YCI A;  1K3E A;  4DV0 O;  1EM1 A;  2JRI A;  5L3F A;  2BSK A;  2Y48 A;  1YIT V;  5LL6 Y;  4QE7 A;  2CTP A;  4ZOL A;  1OCZ C;  3QG5 A;  1MMM A;  1QU7 A;  3C90 A;  4RUE A;  3LSQ A;  1ZTE A;  2QWP B;  4DV7 B;  2ZT9 B;  3CCV V;  3OR6 C;  4TT3 G;  4FZ0 A;  2A0L A;  4N21 A;  5KAI Z;  1YI2 V;  2OT5 A;  1K92 A;  4LCU C;  3HKB B;  1PL0 A;  3VBB A;  5LHG A;  4NXM O;  2XTA A;  2CGN A;  2YXY A;  3RYF B;  1F4N A;  3RW0 A;  4NTW A;  3UO3 A;  1VQK V;  5FNV B;  4BIO A;  1FAF A;  3HKC B;  3OT7 A;  2QWR B;  3MD0 A;  4GKJ B;  3CP1 A;  1UFI A;  4B3R O;  2EIL B;  4DV5 B;  4PA3 A;  3TXS A;  3FB6 C;  1NH2 B;  3LSS A;  3WB1 A;  4X65 O;  4GLX A;  4H33 A;  2EJR A;  4F6R A;  1JA8 A;  4K8Z A;  2WLI B;  2QKC A;  2BTO A;  3QO8 A;  2JDI G;  1PNK A;  4JGS A;  4ZI7 B;  4FJC C;  1V54 B;  1DF5 A;  3H1L H;  5LYJ A;  1XUQ A;  4LF9 O;  5KA6 A;  5L3D A;  1Q43 A;  3ABK B;  3K03 A;  2XAJ A;  3NXS A;  1N0J A;  1NVP B;  3W7S A;  5B1N A;  4JI4 B;  3RWR D;  3CCJ V;  1RPR A;  2PI5 A;  1M90 W;  2IJI A;  1IUR A;  4O2A A;  5HFM A;  3S3X A;  3AEI A;  4DR2 O;  4EB6 B;  2F4V B;  3W7W A;  4TV9 B;  2IW5 A;  2GHY A;  4GX1 A;  2UXB B;  3OMN B;  1IBK O;  2V4D A;  1AP6 A;  4PA4 A;  4QE9 A;  5IY5 C;  3VQW A;  3N2K A;  2XHB A;  1COW G;  5LBQ A;  1FFX A;  1SQX H;  4X1I A;  1N8R W;  4YJ3 B;  1OCC B;  3UCS C;  4HZ3 A;  4OX9 O;  1M4U A;  4FMT A;  1JQ0 A;  4GUN A;  4UUJ C;  3G6E V;  1WNS A;  4TWK A;  4JI3 O;  2Y69 C;  3JSN A;  5JVD A;  4AQY O;  1VF6 C;  5DN6 G;  4DR3 B;  2CDY A;  1B6Q A;  2E76 B;  2D3O W;  4X1K A;  1OCR C;  2Y0P A;  3K9S A;  3E8H A;  2NNU A;  3SJA C;  1BHB A;  5LMN O;  3ZIA G;  4WCE V;  2BSK B;  4DV6 B;  4MVQ A;  1NZ6 A;  3FYE B;  2F95 B;  4UV9 A;  5KHK A;  1S5L Z;  5IE9 A;  2QM8 A;  1TUB A;  4G28 B;  3CPW U;  1GKF A;  5BMV A;  4PDM A;  4UB8 Z;  1SKV A;  1AI4 A;  4UVA A;  3EHB B;  5L3B A;  1WN7 A;  2M7W A;  3BFR A;  3K5N A;  3F7Y C;  2QA4 V;  4CS3 A;  3LNM B;  1YHQ V;  4U3J A;  2DW4 A;  5KUM A;  4DK1 A;  4X20 B;  1H2L A;  1VF6 A;  4JYC A;  1AI5 A;  3SYO A;  1JVM A;  1NTK H;  2FL4 A;  3AG7 A;  4E4E A;  4FM2 A;  4YJ2 A;  1WP7 A;  1CP9 A;  5LP6 C;  2UXX A;  4BIU A;  1K5S A;  3ZHT A;  1OCZ B;  3ZS8 C;  4B3S B;  5LYJ B;  1N33 B;  2OWO A;  4PA9 A;  3W7X A;  3F5T A;  4PEL A;  3UO2 A;  3CRR A;  2DOS A;  4I4T A;  1SF9 A;  4PV1 B;  2R9A A;  1I94 O;  1P49 A;  3K5M A;  1YVW A;  4BWA A;  4IYH A;  2A79 B;  1K73 W;  4DW1 A;  3LDD A;  2CTR A;  3CRQ A;  5GTH Z;  3Q4H A;  5FPR A;  3MAQ A;  2GUZ A;  4UFZ A;  2UUA B;  3UQ8 A;  4YHH O;  4X65 B;  3CC4 V;  3DC5 A;  4MS2 A;  4P30 A;  4P9O A;  1AIL A;  1QLE C;  2LW1 A;  4LBE C;  1MSW D;  3N2K B;  4OGQ B;  2JS5 A;  3C3T A;  3OEH G;  4NR1 A;  1FFX B;  4X1I B;  3RBZ A;  2PTM A;  2Q0A A;  3H9V A;  2X6A A;  1GN4 A;  2YC0 A;  1BT8 A;  1P4R A;  2DYR C;  3UT5 A;  5JVD B;  3BY6 A;  1VQM V;  1GMG A;  4HNA A;  5LXT A;  1ROP A;  1S5H C;  4X1K B;  2OTL V;  2PY5 A;  5H5N A;  4UCV A;  4KHP O;  2F66 C;  4X9Q A;  3MHS C;  2B9Z A;  1EZJ A;  1NR7 A;  2UXC O;  1Q6H A;  4GT1 A;  4GZR B;  1JPX A;  2YI9 A;  4K35 A;  4MT8 A;  3OAA G;  2DQ0 A;  4DK0 A;  1FXK C;  1H8H G;  4QPJ A;  3DSQ A;  5LMU O;  1FFT B;  4X64 O;  5GON A;  5HFL A;  3ML0 A;  1E79 G;  2Q7H A;  4FZ1 A;  5BMV B;  4KFM A;  2V7Q G;  4RWU A;  1MAB G;  3DXR B;  3T2M A;  3SYQ A;  4JI7 O;  2HHH B;  3D36 C;  5LA6 B;  5IY5 B;  3QO5 A;  1I08 A;  1IBM B;  3RT3 C;  1SZT A;  2DWD C;  2GDS A;  4OX9 B;  5FLX N;  2AW9 A;  5K1X A;  1QHT A;  3L9D A;  4IL6 Z;  4JI3 B;  4DR4 O;  1E1R G;  1N4C A;  2Y69 B;  4DRX A;  3BAA A;  3CCU V;  3CCL V;  3D8C A;  1WB7 A;  3FKS G;  2FML A;  4I55 A;  3K5O A;  1QR9 A;  2VQE B;  1VQ7 V;  1WA8 A;  3QNE A;  2HVJ C;  4LP8 A;  4YJ2 B;  1OCR B;  4RUF A;  2FB5 A;  4HYO A;  1M9N A;  3JYC A;  1FD9 A;  3ABT A;  1NU1 H;  3JD3 A;  3A0R A;  2EIN C;  1FXK A;  2HVK C;  4W4L A;  4X1Y A;  5CB4 A;  4F6E A;  1WJZ A;  2ZE5 A;  1P7G A;  5KAF Z;  1EBO A;  1MZE A;  2CK3 G;  4I4T B;  3FX7 A;  1SES A;  2ATK C;  3D36 A;  2B1G A;  3K79 A;  4H37 A;  4G27 B;  5H6R A;  4DR7 O;  2Z0A A;  5IYZ A;  4I50 A;  4IGG A;  4DV4 O;  1XL4 A;  2GUZ B;  4DUZ O;  3L72 H;  1GTO A;  3OMI B;  5EBW C;  2Y0I A;  2BOC C;  2EX3 A;  1G8M A;  5BXZ A;  5KLV H;  3CRM A;  4KXR A;  4DR5 O;  4DV3 B;  2JEX A;  4GCZ A;  2ZIO A;  5LP6 B;  4NKG B;  1PP9 H;  2HG5 C;  1W0K G;  2P6J A;  2EZP A;  3UT5 B;  4K3A A;  4CZZ A;  1HDJ A;  1HR0 O;  3STZ C;  4HNA B;  1JR9 A;  3CME V;  2EIK C;  4WF9 V;  1KU9 A;  4X62 O;  1J95 A;  1D2D A;  3E89 A;  2HJD A;  2XOK G;  3BHP A;  2YID A;  3EVK A;  4PI2 A;  3E83 A;  1RM1 C;  4R6Z A;  3L75 H;  2LGW A;  4R8C A;  5H9C A;  3SR2 C;  3DGE A;  1ENV A;  1Y66 A;  1GM9 A;  4K8X A;  3HKB A;  5J2U A;  5BR8 B;  5GON B;  4LFB B;  4ZHQ A;  1K4D C;  4XDJ A;  4YHH B;  2DJV A;  3KZI Z;  2JJ2 G;  4PJ0 Z;  1WP8 A;  4I0X A;  4FLU A;  1QLE B;  1Y6X A;  3CSX A;  1I5Y A;  2OCH A;  1TA8 A;  1W0J G;  1Q5O A;  1SQG A;  4X8A A;  3TJT A;  3JSL A;  4QGP A;  2R9R B;  2X6B A;  3APO A;  4LF8 B;  3UKM A;  2ARH A;  1VF7 A;  1JMK C;  2DYR B;  5IJ0 A;  1XMQ O;  4DRX B;  3CEI A;  5A9G A;  1KP3 A;  2UU9 O;  4JI5 O;  2ZR3 A;  3OFN G;  4I55 B;  1WA8 B;  2QE7 G;  3JAR A;  1TGO A;  2FYU H;  2QTO A;  2CGO A;  2OIG A;  2QWN B;  4DV2 B;  2IU0 A;  4TOI A;  5EBL C;  4EKW A;  1VEW A;  3FYI B;  4K0K B;  1FXK B;  4X1Y B;  3T1H O;  5CB4 B;  4JTC B;  4O4H B;  1BCC H;  1AJP A;  4BW5 A;  1N34 B;  2Y4U A;  3B8M A;  5LHH A;  2OYQ A;  3JCZ A;  4DR1 O;  1URF A;  1X59 A;  3CWB H;  4TUY A;  5IYZ B;  4I50 B;  2ZKO A;  5LGN A;  3A2F A;  2JIZ G;  1VQ4 V;  2CE4 A;  4LFC B;  1CEZ A;  1HNX O;  2DMX A;  1OV9 A;  1AR1 B;  1N36 B;  1S5J A;  4D7T A;  5FPO A;  3JAW A;  4J9Z B;  4MVU A;  4P9P A;  1PV0 A;  3SJQ C;  2MK3 A;  2D2C B;  4JV5 O;  2YXL A;  1NI8 A;  2EIN B;  1NBM G;  4FIP C;  1Q3E A;  4OPA A;  2E3C A;  5LHI A;  1SS3 A;  1KBH A;  3SPJ A;  4LNU B;  1VQL V;  4DYL A;  1R73 A;  3THO A;  2RN9 A;  2LO1 A;  3JAT A;  3ZRV A;  3D3Q A;  4DR7 B;  4FLV A;  4H13 B;  4DV4 B;  1AJN A;  1S72 V;  2EBO A;  1YJW V;  3ZCC A;  4BAY A;  5J2U B;  2EIJ C;  4ZHQ B;  2ADQ B;  4HBN A;  1ARO P;  2KKW A;  2YIA A;  2Q9L A;  4X20 A;  3U0Z A;  2EIM C;  2P4K A;  4I0X B;  5JCO C;  4DV1 O;  1FXV A;  2X6C A;  2UUB O;  3ZX6 A;  1RSO B;  2QTS A;  1YTF D;  2P22 C;  1H2K A;  3N2G A;  3ZHS A;  4WFH A;  5IJ0 B;  3ETE A;  4B7E A;  1VQP V;  3HPL C;  1P7B A;  3JAR B;  2EIK B;  1XIL A;  1XEQ A;  3ZRS A;  1MNG A;  4EEQ A;  1DLB A;  4KL1 A;  1XMO O;  1RM1 B;  2ZIN A;  4MTG A;  1IX9 A;  5CBH A;  1JFF B;  2QKA A;  3ASN C;  3ZMZ A;  4Z2W A;  3TXQ A;  3K04 A;  5B1O A;  3GB7 C;  3CCS V;  3HKE B;  2YDE A;  3OGC C;  2P90 A;  3MHH C;  5JCO A;  4UCS A;  4CC5 A;  2VQF O;  3ZHR A;  2R72 A;  1VQ9 V;  3WB2 A;  1M57 C;  2Q7E A;  1YZB A;  4R7C A;  4TUY B;  2WLL A;  3GWO A;  3AG3 C;  1R6K A;  4JI5 B;  4ABM A;  5B66 Z;  4B3M O;  3I55 V;  3HR0 A;  1V55 C;  4UB6 Z;  2ETN A;  4PD4 F;  2F93 B;  3D3I A;  4D7S A;  5JWP A;  5EZY A;  3AK1 A;  2F1M A;  4XDK A;  3BPZ A;  5KMG A;  1Z2G A;  2UXD B;  3JAW B;  3B77 A;  1R3I C;  1DTO A;  5GTI Z;  2QR4 A;  4JI2 O;  1GH6 A;  3T1H B;  1G4Y B;  1Y67 A;  1IBL B;  2ZCE A;  1SA0 A;  2HJF C;  4ZKI A;  5C93 A;  4GYC B;  4IIJ A;  2UXN A;  4JF3 A;  5J2T B;  4WFE A;  4JYA B;  2WA3 A;  4DR6 O;  3ZMS A;  4MTO A;  1AVM A;  2LW7 A;  2PF4 E;  5B5E Z;  4DUY O;  1N0N A;  2AHZ A;  5IYD O;  3K08 A;  3JAT B;  1QVF U;  1YF2 A;  3DXR A;  1FXH A;  5LA6 A;  3JD2 A;  4MSW C;  4Q6G A;  1ZLZ A;  1NH2 D;  1GK9 A;  1HNX B;  3ICX A;  4LF4 B;  2GTS A;  1FJG B;  1H38 A;  3F5W C;  1M93 A;  3I5D A;  3CCQ V;  4GX0 A;  1J5E B;  5LOV A;  4LF7 O;  1VQ6 V;  3OEE G;  1GN6 A;  3VOU A;  1QVG U;  1IXB A;  1US6 A;  3N2G B;  1W2B U;  4X89 A;  4CH5 A;  1N32 O;  4JV5 B;  1SQP H;  1R3K C;  4MVZ A;  4DV0 B;  1XHZ A;  1PNL A;  2WLJ A;  5L3C A;  4JTA B;  4CS2 A;  5EC2 C;  4YIO A;  5LGT A;  5DED A;  4OPH A;  1NVP D;  1F4M A;  3M8A A;  3BA9 A;  2YS8 A;  4NVP A;  2M6Y A;  5C8Y A;  1GN3 A;  2RCV A;  4UCO A;  5JH7 A;  3PJS K;  2YIB D;  2H8P C;  3OUF A;  1QBZ A;  1NTM H;  4NXM B;  1SQF A;  2ZE6 A;  1VF5 B;  4CC6 A;  2EIJ B;  3AG4 C;  4F4L A;  3H1I H;  1AI7 A;  4O4L A;  2HKO A;  2EIM B;  4I9W A;  4B3R B;  2GV9 A;  3RGB A;  4J41 A;  3J7A U;  1V9P A;  1Z5W A;  4MVM A;  1Y74 A;  3W7U A;  2F43 G;  3NR7 A;  2WLL B;  2BTQ A;  2Z5U A;  4J9Y B;  3DTU B;  5B1A C;  1SRY A;  3K0G A;  3E2E A;  3L74 H;  1BZK A;  5EBM C;  5LP6 A;  3RVZ A;  4J10 A;  3DC6 A;  3LSU A;  2G38 A;  3B4S A;  2WLN A;  5ITZ A;  5B3S C;  5IWA O;  2PGG A;  5EZY B;  3CHX A;  3RYH A;  3ZN1 A;  4LF9 B;  5KMG B;  1S76 D;  1K33 A;  3P3P A;  3L71 H;  2BCC H;  2JK5 C;  2W0X A;  4TQF A;  1HNZ O;  1L0L H;  1CXZ B;  4CH3 A;  2IJH A;  3OTO O;  2Q5Z A;  3A0H Z;  3I56 V;  1SA0 B;  3SYC A;  4IIJ B;  3ASN B;  4DR2 B;  2VRZ A;  2KSD A;  4J7J A;  4FM1 A;  4J7Z A;  2OCC C;  3E8B A;  2Q8V A;  3K06 A;  1IBK B;  1SQV H;  4JYY A;  1M57 B;  1KYO F;  4NTY A;  1KP2 A;  2CAZ C;  4PHZ A;  3AG3 B;  4I5S A;  4QIW F;  3CS5 A;  3WFV A;  1V55 B;  4AQY B;  1Q82 W;  3K57 A;  4J11 A;  3KCX A;  2HFE C;  3JAL A;  3FAV A;  5LOV B;  2ZXW C;  1IXM A;  3JAS A;  1KKD A;  2Z3Y A;  2OIE A;  3SPH A;  1CPY A;  4L8J A;  3VQX A;  2AZ2 A;  2UUC O;  1UPG A;  1WLE A;  2R70 A;  2RQ6 A;  5LMN B;  2HP8 A;  3QF7 A;  4IHJ A;  2L35 A;  3QO7 A;  1EZV H;  2YXH A;  5L3G A;  1YEW A;  4PA6 A;  3OM3 B;  4J80 A;  3ZMU A;  2QM7 A;  3ZHQ A;  3K58 A;  4O2B A;  5EYP A;  3FD9 A;  5DEC A;  4DR6 B;  1FKA O;  5D5Q A;  1PKX A;  4UV8 A;  4JI8 O;  2CH7 A;  3ABM C;  3RYI A;  5C8Y B;  2Q7G A;  4FPP A;  2Q4P A;  1A32 A;  3JAK A;  1XL6 A;  2WA4 A;  3ZJZ A;  4O4H A;  2BE3 A;  2AZ0 A;  3SGI A;  5JH7 B;  1L1F A;  4HAM A;  2PYL A;  4RQE A;  5JJJ B;  3SYP A;  4NXN O;  3E8F A;  4Z1M G;  1XBL A;  2YUA A;  4O4L B;  2YSU B;  2GSM B;  4JI0 O;  5IT9 N;  3HKD A;  3OR7 C;  4C7U A;  1S3J A;  5GW7 A;  2WWW A;  2WSS G;  4DV7 O;  1GO3 F;  2ITD C;  5TIS Z;  1Y74 B;  2LQT A;  3CMA V;  3IGA C;  1SC5 B;  1N32 B;  2F23 A;  2BTQ B;  5L3E A;  4UVC A;  2CTW A;  4LH6 A;  4QNH B;  1Q6I A;  1DF4 A;  1M56 C;  3E22 A;  3CJH A;  5B1B C;  4FM0 A;  5ITZ B;  1F7Y A;  3BA8 A;  3RYH B;  1XDC A;  3CRA A;  2WAM A;  4FVM A;  3ZMT A;  4LNU A;  4DV5 O;  3CCM V;  3UM7 A;  3RYC A;  1I94 B;  3B2E E;  2E74 B;  3WU2 Z;  1ZUQ A;  1FPO A;  1OHH G;  4U7O A;  4RQF A;  3STL C;  1GM7 A;  5KA5 A;  3P32 A;  4IT5 A;  2PI4 A;  4MW3 A;  3AG4 B;  3B8N A;  2ZIM A;  1WAZ A;  4PA7 A;  4PDV A;  4IYI A;  1H2G A;  3CRC A;  4OXS A;  3K3W A;  1LUW A;  1F51 A;  4JAV A;  5EIB D;  3W7T A;  1T5E A;  3ETG A;  5B1A B;  1RSO A;  2DN9 A;  5KHH A;  2Q68 A;  1BSM A;  3MDS A;  4FFK A;  5B3S B;  3JAL B;  3FAV B;  4PDR A;  1B06 A;  1U96 A;  3JAS B;  4GX5 A;  1VIB A;  5H2F Z;  2LGQ A;  1BS3 A;  2QGN A;  2Q67 A;  4KHP B;  4RO2 A;  4YY3 O;  3CCR V;  1R3L C;  2IBZ H;  1D5A A;  2UXC B;  1YJ9 V;  4IHJ B;  1KEC A;  3CXC U;  1NKD A;  3H1K H;  4E2L A;  3LDE A;  1K5Q A;  4NTX A;  4O2B B;  5EYP B;  5LMU B;  4TSF G;  4X64 B;  2CTQ A;  2E75 B;  2CH7 B;  3RYI B;  1S0V A;  1JFF A;  3ABL C;  1IVS A;  1YTF B;  2P7T C;  3JAK B;  2OCC B;  5H6Q A;  5KX5 A;  3HKE A;  1P84 F;  5FL7 G;  4DR3 O;  2DE0 X;  4JI7 B;  3KKY A;  3VQY A;  4RAI A;  4O4J A;  1NTZ H;  2QEX V;  1Z5V A;  3S3W A;  2AGA A;  4DR4 B;  3OTF A;  5IDJ A;  4UCU A;  3HKD B;  4LFA O;  2V1D A;  1B04 A;  2HLD G;  1WPX A;  2ZXW B;  1JJO A;  3AK2 A;  4TV8 A;  4X66 O;  4B08 A;  2E5L O;  2Q73 A;  3U11 A;  2Q0O C;  1K9M W;  4L87 A;  4O4I A;  3E22 B;  3BAB A;  1YJN V;  1BHA A;  4ZBM A;  3CJH B;  5E1A C;  4WBN A;  1B3Q A;  4Q20 A;  1SET A;  3IAY A;  3U10 A;  2QKS A;  3LNN A;  2ZR2 A;  3OGI B;  3ABM B;  1M5I A;  4KP4 A;  4JI6 O;  5J2T A;  2X0L A;  2IH3 C;  3ZRW A;  4JYB A;  3CCE V;  2PZS A;  1VMG A;  3RYC B;  1ZWI C;  5EK0 A;  2ZDI C;  4GKK O;  4ICG A;  2JJ1 G;  3C3S A;  3OMA B;  3P3N A;  2FTK A;  3G6B A;  4JI0 B;  1UJW B;  1SQQ H;  1Y76 A;  3FB5 C;  2JGD A;  3SDL A;  5E79 Z;  4DUZ B;  1ZSP A;  4LWS B;  1VP7 A;  4JAS A;  1M1K W;  1WPB A;  1XHX A;  4B3S O;  2H3O A;  2L6L A;  2P06 A;  1N33 O;  2WLM A;  2YEV A;  2B5U A;  3K5L A;  1DGS A;  4EFE A;  2RNB A;  4DR5 B;  1THZ A;  1EN6 A;  2RDC A;  3APQ A;  1AJQ A;  1I0H A;  1M56 B;  1GM8 A;  3H01 A;  2XAG A;  2MW2 B;  4Z1V A;  5B1B B;  1HR0 B;  3ZHU A;  1JCH A;  4X62 B;  2K1E A;  2AXT Z;  2UUA O;  1KKC A;  5KHI A;  3T1Y O;  2ITC C;  1OJH A;  2ZDI A;  3CD6 V;  3A0B Z;  3T1C A;  1XNR O;  4B3T O;  2LFR A;  4LR3 A;  3T4Z A;  5KUK A;  2A7W A;  5A2Q N;  5BZB A;  4J7K A;  5AG2 A;  3AG2 C;  1PNM A;  1MZF A;  5KX5 B;  3SPC A;  2IM9 A;  4LC1 A;  1QNM A;  3ZBH A;  1RFY A;  4O4J B;  5CA0 A;  2EZO A;  3QVN A;  2QM4 A;  2A9H A;  2WPD G;  1O9G A;  3BRC A;  1XMQ B;  2BOB C;  2UU9 B;  2QJ1 A;  3ZHV A;  4TV8 B;  2YI8 A;  2LFS A;  4YY3 B;  3P30 A;  2IJJ A;  1Q90 D;  4WFB V;  3N27 A;  2HHH O;  2W6I G;  1IBM O;  4O4I B;  4AI8 A;  1L0N H;  5BY1 A;  4WBN B;  5JJE B;  1H8E G;  3ZMV A;  2DQ3 A;  1Q6U A;  4A5U B;  5EIB C;  1EN5 A;  2DWE C;  4J42 A;  4FFB A;  3JD4 A;  3ABL B;  2VQE O;  2VWK A;  3ZRW B;  1EFR G;  4DR1 B;  3JD0 A;  1OZ0 A;  3PN1 A;  3KCY A;  3ABU A;  3WG7 C;  2ZE7 A;  1K34 A;  3KG2 A;  2LP7 A;  3ZED A;  5CN0 A;  3RFR A;  4ZOL B;  2RMK B;  4LFA B;  1Y76 B;  2JGD B;  2ODM A;  2KB1 A;  3WB0 A;  3RVY A;  1HNW O;  1SER A;  4H44 B;  4WFF A;  4X66 B;  2XAF A;  1MSD A;  4JI1 O;  2ZNI A;  2YEV B;  1EN4 A;  2A3Q A;  1W59 A;  2E5L B;  2K9P A;  1HP8 A;  2FKX A;  1I5X A;  3HB3 B;  4XDL A;  1H2S B;  1ZAU A;  1PL4 A;  3SYA A;  2RJZ A;  1YIJ V;  1E1Q G;  1YSC A;  3CXH F;  1JX9 A;  1G6U A;  4JI6 B;  2QDO A;  3L73 H;  1BGY H;  1TUE B;  3RN4 A;  3CB2 A;  4UCT A;  1O9H A;  1K97 A;  4CH4 A;  4UCR A;  4NYK A;  4GKK B;  5F2V O;  4DW0 A;  4LF6 O;  3B09 A;  4F6R B;  2GBO A;  2XUM A;  4DV3 O;  2OTJ V;  1YXB A;  1AB3 A;  3H1J H;  1BE3 H;  4UVB A;  4EFB A;  4X88 A;  1OCO C;  5CBG A;  2CUG A;  3O9O A;  3ZN0 A;  3H1H H;  1NQT A;  4G2K A;  2H94 A;  2X7R B;  4DV1 B;  4MW8 A;  4I7Z B;  1D5N A;  3K9A A;  5CA3 A;  2IH1 C;  2UUB B;  3TCU A;  5CA0 B;  1IZ3 A;  1VAR A;  3G67 A;  3EFF K;  3FB7 C;  3IFX A;  1Q86 W;  1AP5 A;  5IYC O;  2QWO B;  2DYS C;  2NLJ C;  3R65 A;  4YXW G;  4JAU A;  1XI1 A;  4O2A B;  5D5P A;  4JPR A;  5BR8 O;  4LFB O;  1QR8 A;  4MTX A;  4MTF A;  3T1Y B;  1SZX A;  1JJ2 U;  1XMO B;  4QPK A;  2WLH A;  3T4D A;  1ORQ C;  2B1I A;  1XNR B;  3IC9 A;  4B3T B;  1HWY A;  1H2M A;  1G1X B;  3X2Q C;  1XOU A;  4LF8 O;  1F23 A;  4FFB B;  5JJN B;  3ASO C;  3AG2 B;  5CMU A;  1Q81 W;  1GN2 A;  4JZG A;  2VQF B;  4PDL A;  2JVD A;  2W6J G;  3AG1 C;  1DK1 A;  2KG7 A;  3SPG A;  4DV2 O;  1XQ8 A;  4H0L B;  1BMF G;  1Q8I A;  4XBF A;  1AR5 A;  1YDX A;  1KB9 F;  4R50 A;  4B3M B;  1XRE A;  2Q69 A;  4K0K O;  1VQ5 V;  4FLW A;  1TUB B;  2P5O A;  3AK3 A;  2VWJ A;  3LUT B;  3G80 A;  4JTD B;  1Q7Y W;  5IJ9 A;  3JAM N;  5JQG A;  1KQS U;  1QCE A;  3GVM A;  3K0D A;  4TQD A;  1N34 O;  3E8G A;  2ADP A;  2P4V A;  1FS0 G;  4JI2 B;  4ASU G;  4I9Q A;  4U3J B;  5EC1 C;  3B40 A;  4FLX A;  3TGU H;  1WB8 A;  4N23 A;  4LF5 O;  1S77 D;  3R66 A;  4LFC O;  1TVK A;  1MOF A;  2JEU A;  1MG1 A;  4KUM A;  1RPO A;  4DUY B;  1BQ0 A;  1XNQ O;  4CH6 A;  3L70 H;  3BCC H;  3WG7 B;  1N36 O;  4PI0 A;  1NR1 A;  2A06 H;  2EJ7 A;  3CE2 A;  1KD1 W;  1GAX A;  4UXN A;  2ZM6 O;  2NR5 A;  1ZX3 A;  2PYJ A;  3G71 V;  3K59 A;  3FB8 C;  5KHJ A;  1HNW B;  1BL8 A;  2WLK A;  4JI1 B;  4LF7 B;  4YIP A;  5CA1 A;  1KUQ A;  1KC8 W;  4MVO A;  5CBF A;  4DO2 A;  1ZL8 A;  1H2N A;  1FYJ A;  2QSA A;  5IYB O;  4U7N A;  1VQ8 V;  3ETQ A;  3Q4H B;  1RP3 B;  4DXW A;  3LDC A;  3SPI A;  1QQC A;  2HR3 A;  1MA1 A;  4NB5 A;  3O65 A;  1QLN A;  3CC2 V;  2ZE8 A;  3J80 N;  1LR1 A;  2JS3 A;  4W4K A;  2EIL C;  4LF6 B;  1PPJ H;  2XAH A;  3BEH A;  4BR6 A;  4GKJ O;  3ETD A;  3SJB C;  4D6T H;  2ZD9 A;  3TET A;  3J81 N;  3EXA A;  5J9P C;  3OE7 G;  1NJI W;  1OCO B;  3TK1 A;  1U97 A;  2XAQ A;  1L8D A;  3OD4 A;  3E86 A;  5LXT B;  2VS0 A;  1TAE A;  3G4S V;  1V54 C;  1Y4M A;  4LWS A;  3SJC C;  2QWQ B;  3E35 A;  5K1P A;  2KG7 B;  2ZNJ A;  1R3J C;  2ZQM A;  3ABK C;  2GTA A;  2DYS B;  2YIC A;  2N05 A; 
#chains in the Genus database with same CATH homology
 2WLM A;  4KFM A;  2YEV A;  1GK9 A;  1NH2 D;  2B5U A;  2V7Q G;  1JOY A;  1MAB G;  3T2M A;  3SYQ A;  5IY5 B;  3QO5 A;  1H38 A;  1THZ A;  3F5W C;  3CCQ V;  4GX0 A;  1SZT A;  2DWD C;  1AJQ A;  1M56 B;  2XAS A;  1GM8 A;  3H01 A;  1VQ6 V;  2XAG A;  5B1B B;  1K8A W;  3OEE G;  1E1R G;  5DM6 V;  3VOU A;  1JCH A;  2Y69 B;  1QVG U;  3CCU V;  1W2B U;  4X89 A;  3CCL V;  4FK5 C;  3FKS G;  1R3K C;  2K1E A;  1QR9 A;  2W0F C;  4MVZ A;  1VQ7 V;  3QNE A;  1OCC C;  1PNL A;  3X2Q B;  2HVJ C;  2WLI A;  2WLJ A;  5L3C A;  4LP8 A;  4JTA B;  1OCR B;  5EC2 C;  4MVS A;  2ITC C;  2AHY A;  5LGT A;  4RUF A;  3ASO B;  1NVP D;  1F4M A;  2ZDI A;  4HYO A;  3CD6 V;  5LGU A;  4MVR A;  1M9N A;  4WFG A;  3JYC A;  2IJK A;  3ABT A;  3T1C A;  3JD3 A;  2LFR A;  2EIN C;  3A0R A;  1FXK A;  3AG1 B;  3T4Z A;  5KUK A;  2HVK C;  5BZB A;  3AG2 C;  1PNM A;  3M99 B;  3PJS K;  2H8P C;  1PD3 A;  1QBZ A;  1EBO A;  3OUF A;  3SPC A;  4LC1 A;  4BIZ A;  2CK3 G;  1LNQ A;  2EIJ B;  2IU3 A;  1SES A;  2EZO A;  3IC7 A;  2ATK C;  3AG4 C;  3D36 A;  1AI7 A;  4F4L A;  2B1G A;  2A9H A;  2HKO A;  2EIM B;  2WPD G;  4I9W A;  3K79 A;  1VQN V;  4H37 A;  4G27 B;  5H6R A;  2P67 A;  3CC7 V;  2BOB C;  4MVM A;  3W7U A;  1XL4 A;  2F43 G;  2WLL B;  2Z5U A;  4J9Y B;  4P2Z A;  1GTO A;  2C2A A;  3DTU B;  4CBC A;  2LFS A;  5B1A C;  3P30 A;  1AI6 A;  3OUS A;  2IJJ A;  4WFA V;  1SRY A;  3OMI B;  4QJF B;  3K0G A;  5EBW C;  3E2E A;  4WFB V;  5EBM C;  2BOC C;  3RVZ A;  1G8M A;  2XND G;  2WLN A;  3ZRX A;  3F7V C;  5B3S C;  2JEX A;  2W6I G;  3ZN1 A;  4GCZ A;  1K4C C;  1K7D A;  1R6N A;  2HG5 C;  2Q6A A;  1W0K G;  1H8E G;  2P6J A;  1K33 A;  4GX2 A;  2EZP A;  1VQO V;  3ZMV A;  1S76 D;  3CYO A;  2DQ3 A;  4CZZ A;  2JK5 C;  3STZ C;  3OW2 U;  2DWE C;  2R9I A;  2IJH A;  3JD4 A;  3ABL B;  3CME V;  2EIK C;  3JD1 A;  4WF9 V;  1K3E A;  1J95 A;  3I56 V;  3E89 A;  3ZRW B;  5L3F A;  1EFR G;  2XOK G;  2Y48 A;  3SYC A;  1YIT V;  4QE7 A;  3JD0 A;  1OCZ C;  1OZ0 A;  3ASN B;  3ABU A;  3WG7 C;  1K34 A;  4RUE A;  3LSQ A;  3KG2 A;  2LP7 A;  3E83 A;  1RM1 C;  4R6Z A;  5CN0 A;  3CCV V;  3OR6 C;  5H9C A;  4R8C A;  2OCC C;  4TT3 G;  3DGE A;  3E8B A;  1ENV A;  3K06 A;  1Y66 A;  1GM9 A;  2A0L A;  2KB1 A;  4N21 A;  1YI2 V;  1M57 B;  3RVY A;  1KP2 A;  2OT5 A;  1K4D C;  1K92 A;  4XDJ A;  4LCU C;  1SER A;  3AG3 B;  4WFF A;  2XAF A;  1PL0 A;  2JJ2 G;  2YEV B;  4I5S A;  4QIW F;  3VBB A;  5LHG A;  1QLE B;  3WFV A;  1F4N A;  1V55 B;  1I5Y A;  3RW0 A;  1Q82 W;  1VQK V;  1W0J G;  1I5X A;  3HB3 B;  4XDL A;  2HFE C;  4X8A A;  3SYA A;  2ZXW C;  1IXM A;  3MD0 A;  1KKD A;  3CP1 A;  2Z3Y A;  1YIJ V;  3SPH A;  2EIL B;  2R9R B;  2X6B A;  1E1Q G;  1YSC A;  3UKM A;  1CPY A;  2DYR B;  4PA3 A;  3FB6 C;  1JX9 A;  1NH2 B;  1WLE A;  3LSS A;  1KP3 A;  2ZR3 A;  3OFN G;  4H33 A;  2EJR A;  1TUE B;  2QE7 G;  3QO7 A;  2WLI B;  5L3G A;  1K97 A;  3QO8 A;  2JDI G;  3OM3 B;  4PA6 A;  2QTO A;  3ZMU A;  2QM7 A;  1PNK A;  4JGS A;  1PKX A;  4FJC C;  4UV8 A;  1V54 B;  2OTJ V;  1DF5 A;  3ABM C;  5EBL C;  2IU0 A;  4EKW A;  4FPP A;  4UVB A;  1XL6 A;  3FYI B;  1FXK B;  4X88 A;  1OCO C;  3ZJZ A;  5CBG A;  5KA6 A;  5L3D A;  1L1F A;  3ZN0 A;  1NQT A;  3ABK B;  3K03 A;  2H94 A;  4G2K A;  2X7R B;  4JTC B;  2XAJ A;  4MW8 A;  4HAM A;  3NXS A;  4RQE A;  3K9A A;  1NVP B;  5CA3 A;  2IH1 C;  3W7S A;  3SYP A;  3E8F A;  4Z1M G;  1AJP A;  4BW5 A;  3TCU A;  5B1N A;  3B8M A;  5LHH A;  3CCJ V;  3JCZ A;  1RPR A;  2YSU B;  2GSM B;  2PI5 A;  1M90 W;  2IJI A;  3EFF K;  3OR7 C;  3FB7 C;  3IFX A;  5HFM A;  3AEI A;  1S3J A;  1Q86 W;  5GW7 A;  2WWW A;  2WSS G;  5IYC O;  3W7W A;  2DYS C;  2NLJ C;  2IW5 A;  3R65 A;  1GO3 F;  2ITD C;  2GHY A;  4YXW G;  4JAU A;  4GX1 A;  5LGN A;  3CMA V;  3OMN B;  2JIZ G;  3IGA C;  1VQ4 V;  4PA4 A;  4QE9 A;  5IY5 C;  1CEZ A;  5L3E A;  4UVC A;  4JPR A;  1COW G;  4QNH B;  5LBQ A;  1QR8 A;  4MTX A;  4MTF A;  1N8R W;  1DF4 A;  1OCC B;  1M56 C;  1JJ2 U;  1AR1 B;  4HZ3 A;  4UUJ C;  4FMT A;  1JQ0 A;  5B1B C;  3G6E V;  4QPK A;  4TWK A;  2Y69 C;  2WLH A;  4J9Z B;  3T4D A;  1ORQ C;  4MVU A;  5DN6 G;  2B1I A;  4P9P A;  3SJQ C;  2MK3 A;  1HWY A;  1B6Q A;  2WAM A;  2D3O W;  3X2Q C;  2EIN B;  3ZMT A;  1NBM G;  1OCR C;  1F23 A;  4FIP C;  3CCM V;  3E8H A;  3UM7 A;  2NNU A;  3ASO C;  3AG2 B;  1BHB A;  5LHI A;  5CMU A;  3SPJ A;  1Q81 W;  3ZIA G;  1OHH G;  4WCE V;  4U7O A;  1R73 A;  4RQF A;  4MVQ A;  3STL C;  1VQL V;  1GM7 A;  3FYE B;  4UV9 A;  4PDL A;  2W6J G;  5KA5 A;  3P32 A;  2PI4 A;  4MW3 A;  3AG4 B;  3AG1 C;  3B8N A;  4PA7 A;  3ZRV A;  3SPG A;  4PDV A;  1H2G A;  1BMF G;  2QM8 A;  4OXS A;  4XBF A;  4G28 B;  3CPW U;  1GKF A;  3K3W A;  1AJN A;  4PDM A;  4R50 A;  1F51 A;  1S72 V;  2EBO A;  1YJW V;  3ZCC A;  2Q69 A;  4BAY A;  4JAV A;  3W7T A;  2EIJ C;  1VQ5 V;  1AI4 A;  4UVA A;  1ARO P;  3EHB B;  5L3B A;  3LUT B;  2M7W A;  3ETG A;  5B1A B;  2EIM C;  3F7Y C;  2QA4 V;  4JTD B;  1Q7Y W;  3LNM B;  1FXV A;  1YHQ V;  2Q68 A;  2DW4 A;  5KUM A;  1KQS U;  1QCE A;  2X6C A;  3K0D A;  3E8G A;  5B3S B;  4PDR A;  1YTF D;  1FS0 G;  4GX5 A;  4ASU G;  4JYC A;  1AI5 A;  3SYO A;  4WFH A;  1JVM A;  5EC1 C;  2Q67 A;  4RO2 A;  4N23 A;  3CCR V;  1R3L C;  1S77 D;  3ETE A;  1YJ9 V;  1VQP V;  3HPL C;  1P7B A;  1MOF A;  2JEU A;  1MG1 A;  1KEC A;  4KUM A;  2EIK B;  1CP9 A;  1RPO A;  2UXX A;  3CXC U;  4BIU A;  1NKD A;  1K5S A;  3ZRS A;  4E2L A;  3LDE A;  1K5Q A;  1OCZ B;  4TSF G;  1DLB A;  3WG7 B;  1RM1 B;  1S0V A;  1NR1 A;  3ABL C;  1YTF B;  2P7T C;  4PA9 A;  3W7X A;  2OCC B;  5H6Q A;  1KD1 W;  4UXN A;  4PEL A;  5FL7 G;  4MTG A;  3G71 V;  3FB8 C;  4RAI A;  5CBH A;  3ASN C;  3ZMZ A;  3K04 A;  1BL8 A;  2WLK A;  5B1O A;  3GB7 C;  3CCS V;  2QEX V;  3OGC C;  2P90 A;  3MHH C;  1KC8 W;  4MVO A;  2A79 B;  5IDJ A;  1K73 W;  5CBF A;  4DO2 A;  3LDD A;  1VQ9 V;  1M57 C;  2V1D A;  2HLD G;  1WPX A;  4R7C A;  2WLL A;  2ZXW B;  3GWO A;  3AG3 C;  5IYB O;  4U7N A;  1VQ8 V;  1R6K A;  3CC4 V;  4MS2 A;  4P30 A;  4P9O A;  1MSW D;  1QLE C;  4LBE C;  3I55 V;  4DXW A;  1V55 C;  3LDC A;  3OEH G;  3SPI A;  3D3I A;  3RBZ A;  1K9M W;  4L87 A;  2HR3 A;  1QLN A;  2X6A A;  3CC2 V;  1YJN V;  1BHA A;  4ZBM A;  2EIL C;  4XDK A;  5E1A C;  2XAH A;  3BEH A;  4Q20 A;  1SET A;  3ETD A;  1P4R A;  2DYR C;  3BY6 A;  3B77 A;  1R3I C;  1DTO A;  1VQM V;  2QKS A;  1GMG A;  2ZD9 A;  2ZR2 A;  3ABM B;  3TET A;  1ROP A;  1S5H C;  4KP4 A;  2OTL V;  2X0L A;  1G4Y B;  5J9P C;  3OE7 G;  1NJI W;  1OCO B;  2HJF C;  2IH3 C;  3TK1 A;  4ZKI A;  2XAQ A;  4JYB A;  3ZRW A;  5C93 A;  3CCE V;  3MHS C;  1ZWI C;  1EZJ A;  3E86 A;  2UXN A;  5EK0 A;  2ZDI C;  1NR7 A;  2JJ1 G;  4JF3 A;  3G4S V;  4WFE A;  4GT1 A;  1V54 C;  1JPX A;  1Y4M A;  3OMA B;  3ZMS A;  4MTO A;  2FTK A;  4MT8 A;  3OAA G;  3E35 A;  2DQ0 A;  1UJW B;  2AHZ A;  5IYD O;  1FXK C;  3K08 A;  3FB5 C;  1H8H G;  4QPJ A;  1R3J C;  1FFT B;  1QVF U;  2ZQM A;  5HFL A;  1FXH A;  3ML0 A;  1E79 G;  3ABK C;  3JD2 A;  4JAS A;  1M1K W;  4MSW C;  2DYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...