1ZWIC

Structure of mutant kcsa potassium channel
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
molecule keywords monoclonal antibody, heavy chain
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1zwiC00
2DWEC 1V54C 2WLIA 3IFXA 2EINC 3SPGA 4MTFA 2A79B 4LBEC 4R8CA 4X89A 4MVUA 3BEHA 1K4DC 3AG3C 3GB7C 5IY5C 4MVZA 4WFEA 3LNMB 4QNHB 4P9PA 3AG1C 3ZJZA 2EILC 2AHYA 2Q68A 3FB6C 4MS2A 1BL8A 3ABLC 3FB7C 2Q6AA 4PA7A 1LNQA 3KG2A 3OUFA 1R3JC 3IGAC 3F5WC 2DYRC 4JTDB 4WFFA 2WLIB 2A9HA 2EIKC 2KB1A 3OGCC 4RO2A 3AG2C 3E89A 5CBGA 4UUJC 2W0FC 5EBWC 2WLHA 4J9ZB 3OR6C 4PDRA 3E8HA 3RVYA 3PJSK 4I9WA 3SYAA 3SYOA 4TWKA 3STZC 4JTCB 1S5HC 5E1AC 2NLJC 1R3KC 3K0DA 4PA6A 4RUEA 2HG5C 4RAIA 1G4YB 3E83A 2R9RB 3T4ZA 1JVMA 2WLJA 4MW8A 1OCRC 2HFEC 3VOUA 4F4LA 2DWDC 1R3LC 4PA9A 2ZD9A 2BOCC 3SPHA 5B3SC 2Q69A 2P7TC 5EK0A 5J9PC 3AG4C 4J9YB 4JTAB 4PDLA 4PDVA 4P2ZA 4QE9A 1V55C 1XL4A 2X6BA 4RUFA 4QE7A 3E86A 4H37A 1R3IC 4X8AA 3T4DA 3T2MA 3UKMA 4GX0A 4DXWA 2ITDC 3F7VC 3K0GA 1P7BA 2Y69C 1OCZC 1ORQC 3K03A 4G28B 5EC2C 3RVZA 1M56C 3SYQA 3STLC 5BZBA 3ZRSA 5B1AC 3HPLC 1K4CC 5EC1C 4MVRA 3OR7C 2OCCC 4CBCA 4MVQA 2IH1C 4WFHA 3SPCA 2ZXWC 1QLEC 3ABKC 2WLMA 4MTOA 3ASOC 3RW0A 2K1EA 4MSWC 2HJFC 3RBZA 2ITCC 3SJQC 2HVJC 1M57C 2WLLA 2WLKA 1KKDA 3LDEA 4MW3A 3WG7C 2WLLB 3SYCA 2YEVA 2BOBC 3ASNC 3X2QC 4XDJA 3E8GA 4GX2A 5EBLC 4P9OA 4R6ZA 1J95A 3TCUA 4GX5A 4P30A 2X6CA 3E8BA 4BW5A 1XL6A 1OCOC 3SYPA 4EKWA 2QKSA 2ATKC 2DYSC 4MVOA 2H8PC 4MVMA 2A0LA 4LP8A 5CBFA 4R7CA 3UM7A 3K08A 4PDMA 4OXSA 4HZ3A 2QTOA 2WLNA 2IH3C 3E8FA 3K04A 3K06A 4H33A 4MVSA 4R50A 3R65A 2JK5C 5B1BC 5CBHA 3SPIA 4XDLA 4LCUC 2HVKC 3JYCA 3LUTB 1ZWIC 3FB8C 2EIMC 2X6AA 3EFFK 3T1CA 4G27B 3ABMC 3OUSA 4ZBMA 5KUMA 3SPJA 2Q67A 5KUKA 3LDCA 4KFMA 3FB5C 1OCCC 4PA4A 4X88A 4GX1A 5EBMC 4WFGA 2AHZA 4MTGA 4PA3A 3TETA 3LDDA 4XDKA 4HYOA 3F7YC 2EIJC
chains in the Genus database with same CATH superfamily
3CXCU 2JGUA 2B5UA 3TJTA 2XNDG 1I5XA 2WSSG 5IYZA 3AG3B 1K92A 1KP2A 1L0NH 4FFBA 4DR4B 4JI4O 4I0XA 4PDRA 2ZQMA 2Q7EA 5H5NA 3G6EV 4DV5B 4OX9B 4QPJA 4I7ZB 3GVMA 1YDXA 2BOCC 2QJ1A 4RWUA 4LNUB 1I08A 3CXHF 4K0KB 2IBZH 1AI6A 3L70H 2O57A 4JI4B 1FXKC 3W7WA 5B5EZ 5EYPB 1VQ5V 5E79Z 2ETNA 2XTAA 3ABUA 2HJFC 4EB6A 2XHBA 1IBLB 2HVJC 5C8YA 4BAYA 5IYCO 2GUZA 3ASNC 4MT8A 4FFKA 1NTKH 2RCVA 2QM4A 4ZIBA 1MMMA 1VIBA 2QKSA 4IYHA 5IJ0B 5LBQA 1S72V 2ILMA 1PPJH 3KCYA 1ZX3A 1US6A 3TK1A 2Q7HA 2LFSA 3M99B 2V1DA 1ZWIC 2Q9LA 1NT2B 2OYQA 3FB5C 1ZUQA 1TAEA 2DE0X 4CH6A 3CCVV 3SPGA 4YXWG 4ICGA 2R9AA 5IY5C 1P84F 4WFEA 3H1LH 4QNHB 5LYJB 3FB6C 4JI2B 1W0JG 2Q6AA 4ZOLA 4NB5A 3CCJV 5L3GA 4DR2B 1XMQB 4J9ZB 3L73H 3RVYA 4RQFA 3RYCB 2Y4UA 3BRCA 1MSWD 2R70A 2NLJC 1DF5A 2VRZA 3HR0A 2F95B 3E22B 1VQKV 1CP9A 2CTQA 3VQVA 3HKDA 4MW8A 5LHIA 4F4LA 2UXXA 4B3TO 1Q43A 1NKDA 2ZD9A 1QR8A 4JTAB 2P90A 1YI2V 1S76D 2Q7GA 1JJOA 2YIBD 3JAWB 4UCOA 5B3SB 5B1AC 3JALB 4NXNB 1Q81W 3BA9A 3SPCA 4PI0A 3ABKC 4PV1B 3ZIAG 3AK3A 2AGAA 4B7KA 3G71V 2IU0A 4ZOLB 1F4MA 2LW1A 1HW7A 5FL7G 2CDYA 1SA0A 2VS0A 1N33O 1VQNV 4J41A 4HAMA 1NVPB 5LOVA 3HKCA 2H8PC 3K5MA 3LSQA 1NZ6A 2GV9A 2EIMB 4PDMA 4OXSA 3MD0A 3ABMB 4WFAV 1SA0B 3K5LA 4LCUC 1J5EO 2PYLA 1HDJA 4JV5O 3CRCA 3CJHA 4O4HB 3ZHQA 2EINB 4GX1A 5EBMC 4IHJB 2LGWA 5D5PA 3N27A 1GTOA 4XDKA 3F7YC 1SESA 2QM7A 2ZR3A 3JARB 5LP6A 1N0JA 1M5IA 4ZI7B 4CH5A 3UQ8A 2YS8A 2IU3A 3ZJZA 4GKKB 2YEVB 1O9HA 3FB7C 1R3JC 2CK3G 1YZBA 2WLIB 2A3QA 3W7TA 1ROPA 1P7GA 3DXRB 4HNAB 4GCZA 1WA8A 5JJJB 1E1QG 1EN4A 1WP7A 4AI8A 3T1YB 3LSUA 1XHXA 1AR5A 3CX5F 1F4NA 2E5LO 4D7SA 1FPOA 4W4KA 3SPHA 5BMVB 3OMIB 1F23A 2YI8A 3CWBH 4YHHO 3F7VC 5CMUA 1YF2A 2GSMB 3F5TA 1Y6XA 2E5LB 4MVRA 3O9OA 2QR4A 5JH7B 3H1IH 3N2KB 4JAAA 1HWYA 4X9QA 4LF9B 2WLKA 4YJ3B 3SJAC 5L3DA 3WG7C 2KSDA 3RGBA 1YTFD 2EBOA 1MG1A 3DXRA 4HNAA 2QWOB 4PI2A 1OCOC 3SYPA 3IC7A 3CRRA 4YJ3A 3UO2A 4LP8A 5CBFA 1XOUA 3QG5A 3K08A 3OD4A 4H33A 2IH3C 1N8RW 3K04A 2CTPA 1SQXH 1Q86W 5CBHA 1OJHA 2FB5A 5K1PA 2M6YA 2D3OW 4ZKIA 4FLWA 3Q4HA 3CC7V 3SJBC 1W0KG 4U3JB 1GN6A 1U97A 4TV8B 2YDEA 4F6RB 2Q73A 3H1JH 3K5NA 3A2FA 4DV7O 1BHAA 1KKCA 1EFRG 1AILA 1Z5WA 3ZCCA 2R72A 2QEXV 1XNRO 1YHQV 3KG2A 3T1HO 3VBBA 3BPZA 2C2AA 3RYIB 4B3MB 4ASUG 3RYHA 1GM7A 5D5QA 4BW9A 3PN1A 3SYAA 3RYCA 3SYOA 4FLUA 3AG2B 4LF7O 4QJFB 1B6QA 4TUYB 1MSDA 1AI7A 2YIBA 2JIZG 1JA8A 2IW5A 4NVPA 1JFFA 2QWQB 2Y69B 1EZJA 1R3LC 4O4JA 5LHGA 3CCRV 4PDLA 4TQDA 3HB3B 2XT9A 4AHCA 4DV2B 1PNKA 3K58A 3B40A 3BVOA 5KX5A 1AR4A 5GONB 3J7AU 5BMVA 2HP8A 1IZ3A 4X1YB 1AJQA 3D8CA 2EZPA 2Q5ZA 5IE9A 3MHHC 1YEWA 4CH3A 1HNXO 1VMGA 4MSWC 4J7ZA 5ITZA 1XQ8A 3ZRVA 5AG2A 2BOBC 3JASB 3K59A 5LMUO 4NXMO 4YY3B 2HHHB 4FLXA 4BIOA 5KHGA 4GX5A 4P30A 2DW4A 2DYSC 1Y66A 3CRMA 4MVMA 1QVFU 3ZHVA 2P4VA 4DV4O 4UCRA 2OIGA 5B1BC 3SR2C 4H44B 4TUYA 1RM1C 1XEQA 2KG7B 3JALA 3QO5A 4G27B 3ABMC 1AI4A 4LF8O 4FZ1A 4KFMA 3ZMZA 2WPDG 2L35A 5KMGA 4B3MO 3RBZA 2H3OA 2X7RB 1JCHA 3CPWU 4FM1A 1K4DC 5EIBD 4JI0B 4P9PA 2XAFA 2CH7B 4FM2A 1FJGB 2JRIA 2CE4A 3E35A 1NVPD 3QTCA 2Z5UA 4DV7B 1UPGA 1B3QA 3THOA 3JATA 4N21A 1GH6A 4DV2O 2WA3A 1VQMV 5CA3A 1XMOO 5GTHZ 4UB8Z 2RN9A 3AG4B 2UXCB 4DUZO 3KZIZ 4I9QA 2BTQA 3ZHTA 3CD6V 1GN4A 1K5SA 2KQXA 4I4TA 3DC6A 3CRQA 1SQPH 1RFYA 4DXWA 1MABG 4DRXA 4UCVA 1N34B 3K03A 3P30A 5C8YB 4DR1B 2IJHA 2XAJA 1DK1A 3ETQA 1K4CC 2P5OA 3ZHUA 4WFHA 2IM9A 1L0LH 2JVDA 2BTOA 1JR9A 4MTOA 3ZN1A 4KXRA 2AZ0A 1OCOB 2YEVA 1Q7YW 1GM8A 1SZXA 1S0VA 3HKBA 4XDJA 3EXAA 5IJ9A 3JATB 1URFA 3OE7G 3WG7B 3BHPA 1N34O 3M8AA 5TISZ 1DF4A 1MA1A 4IHJA 5IJ9B 1JOYA 4LNUA 1L1FA 4UVAA 3T1CA 1DGSA 4D6TH 1SQFA 4NTYA 2RMKB 3K79A 4CC5A 4E4EA 2HR3A 1F51A 3AK2A 3OMNB 4LWSA 5BXZA 4LBEC 1AJPA 4X89A 5KAFZ 2HHHO 4DV5O 1Y67A 3AG1C 2ZDIC 2M7WA 3U11A 4PA7A 4FLTA 3F5WC 4X62B 1XNQB 3C3SA 3BCCH 3W7SA 1IDSA 5FNVA 4UVBA 1H8HG 1I94O 1G6UA 3RWRD 1VQ4V 4TWKA 2GHYA 2JGDA 2E76B 2WA4A 3CHXA 5JJNB 1PKXA 1WP8A 4O4JB 5JCOA 4PD4F 5JQGA 1WNSA 3QVNA 2IJKA 2LFRA 2Z3YA 5J9PC 1QHTA 2Q69A 4X8AA 1E79G 3JAKA 4H37A 1R3IC 4LF7B 2ITDC 3K0GA 2Y69C 1ORQC 1H8EG 3L72H 3R66A 1RSOA 1XMOB 3RYHB 3UCSC 4I0XB 1BS3A 3OGIB 2MK3A 1QQCA 2WLMA 4PJ0Z 3LNNA 3CCSV 1KKDA 4L87A 1FS0G 5J2TA 3SYCA 3IJ4A 3X2QC 2P6JA 1THZA 3AK1A 2HKOA 4J80A 3ZN0A 3L71H 3FD9A 1EZVH 1QU7A 2QTOA 2N74A 2CTRA 3E22A 2JK5C 4I50A 3WB2A 4GZRB 2EIMC 1NBMG 2DOSA 1YIJV 2W6IG 4X88A 3K3WA 3OM3B 4EFEA 2BCCH 4CH4A 1QCEA 4JV5B 2LP7A 4O4IA 2GUZB 2WWWA 3WB1A 1QVGU 4K0KO 1S3JA 1VARA 4DR5B 2A9HA 5LGTA 3K5OA 3OR6C 3E8HA 1IXBA 5A2QN 4DUYB 1NI8A 3CJHB 5HFMA 1D5AA 1VF6A 3CCMV 3JASA 4X20B 2FTKA 4I50B 5IYDO 2BSKB 1RPRA 2XOKG 1M56B 2LO1A 4DV0O 4JI6B 4QE9A 2CH7A 2QGNA 1V55C 1H38A 4QE7A 1AR1B 3T2MA 3T1YO 5KA6A 4AQYB 1N32B 3G6BA 3IC9A 1K8AW 2LGQA 1QLNA 3K9SA 1AJNA 3HKBB 2YSUB 1VQOV 4Q6GA 3B09A 1TVKA 4GX2A 2F4VB 2ZCEA 1XL6A 4I55B 4ABMA 1OV9A 4LR3A 2A0LA 4YIOA 4R7CA 1ENVA 1QBZA 1N0NA 4R50A 5H2FZ 4LFCO 1IBLO 1HNWO 1N32O 3CMAV 3W7UA 3ZHRA 3AEIA 1KQSU 1K9MW 1I7FA 1D5NA 3FKSG 1JPXA 3CCEV 1M9NA 1WPBA 5FPOA 4J42A 1V9PA 2FYUH 4O2BA 2YIAA 2H94A 2KKWA 2FKXA 1G8MA 3ABLB 3GWKC 3A0HZ 5LYJA 4FVMA 2F23A 1KU9A 2Q4PA 1TUEB 2K9PA 1R6NA 2VQFO 1Q6HA 3N2GB 3ZHSA 2DYRC 2UXCO 1HP8A 5FLXN 5EBWC 3PJSK 1HNZB 5KAIZ 3UT5B 3STZC 3APOA 3JD1A 4QIWF 4LH7A 3A8TA 4NTWA 3D36A 1NR1A 4I5SA 1ZAUA 5JQGB 4JF3A 5EK0A 1GN2A 3H1KH 4F6RA 4UVCA 5KA5A 1H2KA 1NQTA 3FAVB 3RVZA 4G28B 3JD2A 2QSAA 3QNEA 3EVKA 2DQ3A 2QWPB 1P49A 4PHZA 5FNVB 4A5UB 4DR6O 1I0HA 4GYCB 3X2QB 3SJCC 3K9AA 4DUYO 3SGIA 2WLLA 2AW9A 4MW3A 4CS3A 3CEIA 4NXNO 2A06H 1NTMH 4N23A 1J95A 4EKWA 4HZ3A 4MVSA 4QGPA 3QO8A 4B3RB 1YTFB 3JD4A 4B7EA 2DYSB 1TUBA 4X1IA 2JGDB 1IXMA 3EFFK 4X1YA 3QF7A 1V54B 3AG7A 4BWAA 3P32A 2AHZA 1G1XB 4X66O 1RM1B 1FJGO 1UJWB 4DV4B 4UV9A 1BCCH 1XMQO 3IAYA 4B3SB 4MTFA 2ZKOA 2RNBA 3A0BZ 3BA8A 4MVUA 3WFVA 2ADQB 2PI5A 2Y0IA 3S3XA 2YC0A 1K7DA 3RN4A 4O4LB 3JSNA 4E2LA 2OCHA 1KMIZ 4Z1VA 5JJEB 1FYJA 4GKJB 2G38A 5DN6G 4AQYO 5A9GA 4X64O 5F2VO 4UB6Z 4X65B 1S5LZ 1WLEA 1WJZA 2IJIA 1BT8A 4DRXB 1Z5VA 3I55V 2F1MA 2RDCA 1JVMA 4TV8A 1Q3EA 4J7JA 1I94B 2P7TC 5BY1A 3AG4C 5EZYA 3OTFA 4O4IB 1Q90D 3UKMA 2QKAA 4B08A 2FMLA 2QDOA 1H2LA 1SRYA 1NJIW 1V55B 3K57A 4CBCA 2GTAA 1Y76A 4J7KA 1IBMB 3RW0A 3SJQC 4DK0A 1SQVH 1CXZB 4B3SO 1MZFA 2OIEA 3CS5A 2QKCA 2E3CA 1U96A 1IBKO 2R9IA 1R73A 2NR5A 3VQWA 3CP1A 1CEZA 3SPIA 5LMNO 5DECA 3ICXA 4IT5A 4FZ0A 1H2MA 5H9CA 1KECA 2KG7A 5KUMA 4JYCA 5LHHA 1OCCC 3JARA 1TUBB 4PA4A 4X1IB 5CA1A 3G67A 3LDDA 1QR9A 5IY5B 2ZE6A 1YITV 2IJJA 1GM9A 1K34A 4FPPA 2PZSA 2A79B 1RSOB 2DJVA 3OTOO 5JWPA 2D2CB 3RT3C 2HJDA 4X1KB 4LFBO 1PV0A 1VEWA 1VP7A 4DR1O 4CS2A 2DN9A 3N2KA 3KCXA 4JZ2A 3B8MA 1QNMA 3APQA 2BE3A 4NTXA 3ETEA 1Z2GA 4DV1B 4RUEA 3JCUZ 4FLZA 3S3WA 1PNMA 2B1GA 3VOUA 2HFEC 2ZNIA 1R6TA 1PM9A 4LFAB 4UCUA 1KUQA 4WF9V 3DSQA 3T1HB 4UCTA 1A32A 1N36B 4NKGB 1AI5A 3P3NA 4LF9O 5LL6Y 3ABKB 1VF7A 5EC2C 3ASOB 4LWSB 2QWRB 1EN6A 3OR7C 1IBKB 1SKVA 2IH1C 5J2UA 2UUCB 3HKEB 1COWG 1S77D 3MAQA 4JI6O 2Q0OC 2NN4A 3CMEV 5LOVB 2WLLB 2P4KA 5EBLC 2RJZA 4P9OA 1E1RG 3CB2A 3FYEB 3TCUA 4H13B 5LGNA 4JI5O 2Z0AA 3ZX6A 4GUNA 1LUWA 2CTWA 3LSSA 2BTQB 5KHKA 3R65A 3VQYA 2CUGA 3SDLA 1BSMA 3JSLA 2XUMA 3JYCA 1ZL8A 1FAFA 1HR0O 3ZEDA 5JVDA 3JAWA 3LDCA 2JS3A 4O2AB 3ZMTA 3OAAG 4RQEA 2N04A 4O4HA 1SQQH 2EINC 4X64B 1IX9A 4NYKA 2F66C 2EULA 3DTUB 4O4LA 3CCLV 1ZTEA 2EIJB 3WB0A 2AHYA 3NXSA 4KP4A 2YXYA 2PI4A 4UCSA 1AROP 5IJ0A 1PNLA 2EIKC 3L9DA 3JAMN 2W0FC 2WLHA 1H2SB 3P3PA 2LJ2A 2DMXA 3ZRWA 3ZBHA 2F43G 2UXDO 3ZRXA 4JTCB 5E1AC 3GWOA 1NS1A 1AP6A 5DEDA 4RAIA 1G4YB 2Y0PA 4WFBV 5L3BA 3FX7A 2VQEO 1YVWA 1FFXA 1JJ2U 2DWDC 1OCZB 1XI1A 3RYFA 3H01A 3UO3A 4BR6A 4RUFA 4P2ZA 1I5YA 3JCZA 1M1KW 3JAKB 4K8ZA 5L3FA 1XBLA 2B1IA 4X65O 4ZI7A 5LMNB 1D2DA 4D7TA 3OEEG 1XHZA 4JI1O 2OCCC 4LF5O 1WAZA 4DK1A 1XREA 1YCIA 2QWNB 5KMGB 4OGQB 2ITCC 1AP5A 1M57C 3LDEA 3U10A 1K33A 1OZ0A 1MOFA 3B77A 5IYBO 1KC8W 2ATKC 3NR7A 2E74B 1VF5B 5IT9N 4X20A 2X0LA 4JYBA 1XNQO 3ABTA 2P67A 1Q8IA 3FB8C 4DR2O 2JS5A 2ZNJA 3SPJA 1AVMA 2L6LA 2YXLA 4U3FH 2QE7G 2Q8VA 2RQ6A 1BHBA 3HKEA 4PA3A 2PYJA 3I5DA 1GMGA 4OPHA 1O9GA 2XAHA 1IURA 2LW7A 4LC1A 1LNQA 1W59A 4O2BB 2JEUA 1SQGA 4B3TB 3ZMUA 4Z2WA 3AG2C 3E89A 4UUJC 2VWJA 4LF6O 4TOIA 3M7MX 4I9WA 1GO3F 2ADPA 2YI9A 3D36C 3BY6A 1XNRB 1FFTB 1B06A 4O2AA 2P22C 1IVSA 3G80A 3CYOA 1OCRC 3MHSC 4PA9A 2UXBB 2VQFB 2UUAO 2F93B 2JEXA 3E2EA 3C90A 4W4LA 5IWAO 4JI8B 1HNZO 2OTJV 3G4SV 3SYQA 2B9ZA 4LF4B 2YICA 3ZRSA 1J5EB 4JZGA 1FFXB 4LH6A 1K73W 2PGGA 3ETGA 3ASOC 1EBOA 1PL4A 5J2TB 1KYOF 5LXTA 1KD1W 4DUZB 4LF4O 5C93A 1TGOA 2CGOA 1WPXA 4FK5C 4IGGA 3OW2U 4KHPO 5L3EA 4JAVA 1ZSPA 3CE2A 3OTOB 1JX9A 1T5EA 1X59A 5KHJA 5GONA 2JJ1G 4JI3O 5KUKA 5CA0B 1N33B 1X4TA 3ZMSA 4JASA 4HYOA 2EIJC 1V54C 2ZT9B 4OPAA 4R8CA 2F4VO 4CS4A 3AG3C 1WB7A 3TXSA 1SZTA 3LNMB 5IDJA 1P4RA 2HEPA 2LQTA 5LP6C 2HLDG 2Q68A 1NTZH 3TGUH 1BE3H 2GDSA 4YIPA 4L8JA 5IWAB 3OGCC 4JI8O 4UFZA 4BIUA 1Y76B 1YJ9V 3CC4V 2Y4TA 2UXBO 1Y74A 4FMTA 5BR8B 4CC6A 2EIKB 1XUQA 2P06A 3U0ZA 4UV8A 4PA6A 1N4CA 2WAMA 4LF5B 3E83A 2BSKA 4J10A 1VF6C 4DR4O 1FXKB 4AILC 1HNXB 3D3QA 1F7YA 3JD3A 3W7XA 1RP3B 1WB8A 3E86A 4HBNA 2OCCB 1P7BA 4KUMA 4LFCB 2UUBB 5BZBA 2XAGA 1FXKA 1ZL8B 1ZLZA 2ZDIA 4K35A 4MVQA 4NR1A 1QLEC 5GW7A 1K5QA 3ASNB 1CPYA 2Q0AA 2UXDB 2CAZC 1Q82W 4X66B 2OTLV 1Y74B 3CSXA 1VQLV 3RYFB 3BFRA 4MVOA 5ITZB 2QTSA 1SERA 1BMFG 3D3IA 4XBFA 3LUTB 4ZHQB 2ZM6O 5JVDB 4ZBMA 2Q67A 3ZRWB 1VQ7V 2ODMA 3BAAA 5FPRA 4WBNB 1VQ9V 1JQ0A 2DWEC 2PF4E 5CA0A 1KP3A 2E75B 1SF9A 1OCCB 4NXMB 3H9VA 1B04A 4MVZA 1NH2D 2V7QG 2EILC 3B4SA 4MS2A 1RPOA 5LA6B 3OUFA 2UU9B 4JYYA 3OEHG 1N36O 4JTDB 3BABA 4K3AA 4WFFA 5KLVH 1FD9A 1KB9F 3AG1B 2ZIOA 5CBGA 3DC5A 5CN0A 1K97A 3UT5A 1AB3A 1DLBA 2YUAA 1M4UA 1R3KC 1TVKB 4DO2A 5KHHA 4TV9B 4DR6B 2Y48A 3H1HH 3HKCB 1VQPV 1Q6IA 3OFNG 1JFFB 5B3SC 2VWKA 1NH2B 5IYZB 2ZE5A 2X6BA 4JI5B 1Y4MA 5JH7A 4TV9A 4DW0A 1OCRB 1L8DA 5LGUA 4U3JA 4G2KA 2OWOA 3HPLC 4LF6B 1BQ0A 1W2BU 3L75H 2GTSA 2ZXWC 1OHHG 2ZIMA 3EHBB 1PL0A 1HR0B 2ZE7A 3A0RA 2K1EA 3MDSA 4DYLA 1FKAO 1GK9A 2XASA 4GLXA 3B8NA 1UFIA 5CB4A 5K1XA 1R1BA 2PY5A 4DV3O 2X6CA 1SETA 4TQFA 5EIBC 1TA8A 3UM7A 2WLNA 3FFQA 2AZ2A 4FFBB 4JAUA 2HVKC 3VQXA 5B66Z 3OUSA 2FL4A 2UUCO 4JI0O 2QA4V 1VQ6V 2JDIG 3TXQA 4JYAB 1SQBH 4TT3G 1NU1H 2OT5A 4J11A 1BGYH 3QO7A 2WLIA 3IFXA 3CCQV 4DR3B 2GBOA 3GB7C 1HNWB 2UUAB 5CB4B 5H6QA 2ZE8A 1EN5A 2XAQA 1LUVA 3IGAC 2YIDA 4JYAO 4DV1O 5LP6B 4RO2A 1PP9H 4DV0B 4X1KA 2N05A 4JI1B 4DR7O 1FXHA 2YXHA 3O65A 3CCUV 1M90W 2EJRA 2PUSA 5LA6A 3FAVA 1H2NA 2HG5C 5B1OA 4WBNA 2JJ2G 3T4ZA 3I56V 4UXNA 2UU9O 1KBHA 5CA1B 3RFRA 1XILA 4LFBB 5KHIA 3J81N 4J9YB 4F6EA 1VQ8V 3CRAA 4PDVA 4OX9O 1GN3A 3C3TA 4GX0A 4WCEV 2W6JG 4DR5O 1DTOA 1OCZC 3JD0A 1M56C 2PTMA 5L3CA 2EZOA 4YJ2A 2ARHA 3CC2V 4LFAO 1XDCA 2CGNA 2NNUA 5J2UB 1BZKA 4DV6O 1QLEB 4GT1A 4JI7B 1GAXA 4K8XA 2MW2B 2AXTZ 5DM6V 4EFBA 1M57B 3E8BA 4BW5A 1GRJA 4I4TB 4WFGA 1MZEA 2ZR2A 3E8FA 1YSCA 3B2EE 1SC5B 4XDLA 2W0XA 4DV3B 4YY3O 1IBMO 2X6AA 5LMUB 4JI2O 4H0LB 3J80N 4FJCC 4JPRA 2ZINA 1PD3A 4FIPC 5GTIZ 3TETA 4JI7O 1M93A 4DV6B 1S5JA 4FM0A 3HKDB 3N2GA 2V4DA 2EJ7A 3KKYA 3BEHA 3FYIB 5KX5B 4FLVA 1R6KA 4FLYA 1BL8A 3ABLC 2A7WA 4LF8B 1MNGA 2VQEB 4IYIA 4I55A 2KB1A 2EILB 1Q5OA 1Q6UA 4EEQA 1K3EA 1JMKC 2DYRB 3ETDA 4TSFG 5LXTB 1BQZA 2UUBO 3WU2Z 1S5HC 1LR1A 4DW1A 3K0DA 3Q4HB 4DR3O 1H2GA 2R9RB 3DGEA 5EZYB 3RYIA 2WLJA 3ZS8C 4JGSA 1FXVA 4QPKA 3OT7A 2DQ0A 1XL4A 4IIJB 5B1NA 3T4DA 4X62O 4MTXA 5EYPA 4GKJO 1NR7A 3STLC 1YJNV 3ML0A 4ZHQA 5EC1C 5BR8O 4EB6B 1WA8B 4JI3B 3L74H 4IL6Z 4YJ2B 5B1AB 3ZMVA 4B3RO 4C7UA 2ZXWB 1WN7A 3E8GA 2ZM6B 2QM8A 4R6ZA 5B1BB 1GKFA 4PELA 5H6RA 4BIZA 3K06A 4YHHB 1YJWV 4GKKO 5JCOC 4Q20A 4DR7B 3OMAB 2EX3A 1SS3A 5HFLA 1EM1A 4Z1MG 4U7OA 4MTGA 4CZZA 4IIJA 4KL1A 1YXBA 4U7NA 4KHPB 2UXNA
chains in the Genus database with same CATH topology
2X7RB 3CXCU 1V54C 1JCHA 4MTFA 3CPWU 4R8CA 4MVUA 1K4DC 2B5UA 3AG3C 1SZTA 3LNMB 3WFVA 1P4RA 4P9PA 5IDJA 2PI5A 2XAFA 2HLDG 2XNDG 2Q68A 1I5XA 2WSSG 1K7DA 4E2LA 3E35A 3AG3B 1K92A 1KP2A 1NVPD 1UJWB 2Z5UA 3OGCC 4BIUA 5DN6G 1YJ9V 4N21A 4PDRA 3CC4V 2ZQMA 4FMTA 3G6EV 1VQMV 2EIKB 1WLEA 4QPJA 5CA3A 2IJIA 4UV8A 4PA6A 3I55V 2WAMA 3AG4B 3E83A 1JVMA 3CD6V 1K5SA 1FXKB 2BOCC 2P7TC 3AG4C 3JD3A 3W7XA 3E86A 2OCCB 1MABG 3UKMA 4DXWA 1P7BA 1AI6A 3K03A 3P30A 1FXKC 4KUMA 2IJHA 2XAJA 5BZBA 2XAGA 3W7WA 1SRYA 1FXKA 1NJIW 1K4CC 1V55B 2ZDIA 1VQ5V 4CBCA 4MVQA 4WFHA 1QLEC 5GW7A 1K5QA 4MTOA 3ASNB 1CPYA 3ZN1A 3ABUA 3RW0A 2HJFC 3SJQC 2HVJC 1OCOB 4BAYA 1Q82W 2OTLV 2YEVA 5IYCO 1Q7YW 1GM8A 3ASNC 1S0VA 4XDJA 4MT8A 3OE7G 1VQLV 2R9IA 1R73A 3WG7B 2QKSA 4MVOA 5LBQA 3CP1A 1S72V 1DF4A 1SERA 1CEZA 1BMFG 1JOYA 3SPIA 3D3IA 4XBFA 3TK1A 3M99B 2LFSA 2V1DA 3LUTB 1L1FA 1ZWIC 4UVAA 5H9CA 3T1CA 1KECA 4ZBMA 5KUMA 2Q67A 4JYCA 3ZRWB 5LHHA 1VQ7V 3FB5C 1OCCC 4PA4A 3K79A 1VQ9V 3LDDA 1QR9A 2HR3A 5IY5B 1F51A 1JQ0A 3CCVV 1YITV 2IJJA 3OMNB 2DWEC 1GM9A 1KP3A 1K34A 4FPPA 1OCCB 3SPGA 2A79B 1AJPA 4LBEC 4YXWG 4X89A 5IY5C 4MVZA 4WFEA 4QNHB 1NH2D 2V7QG 3AG1C 3FB6C 2EILC 2ZDIC 4MS2A 2M7WA 1RPOA 4PA7A 1W0JG 2Q6AA 3OUFA 3F5WC 3CCJV 3OEHG 4JTDB 4WFFA 3AG1B 5CBGA 5L3GA 3W7SA 4UVBA 4J9ZB 3RVYA 3B8MA 5CN0A 1H8HG 4RQFA 1K97A 1VQ4V 1MSWD 4TWKA 2GHYA 3ETEA 1DLBA 3ZMSA 2NLJC 1DF5A 1R3KC 1PKXA 4RUEA 4DO2A 1VQKV 1CP9A 1PNMA 2B1GA 2Y48A 4MW8A 3VOUA 2HFEC 5LHIA 4F4LA 1VQPV 2UXXA 3OFNG 2IJKA 1NKDA 2LFRA 2ZD9A 2Z3YA 1QR8A 5B3SC 5J9PC 2Q69A 4WF9V 4JTAB 1NH2B 2P90A 4X8AA 1E79G 2X6BA 1AI5A 4H37A 1Y4MA 1R3IC 1YI2V 1S76D 1OCRB 2ITDC 3ABKB 3K0GA 2Y69C 1ORQC 5EC2C 5LGUA 1H8EG 3ASOB 5B3SB 4G2KA 5B1AC 3HPLC 1W2BU 1Q81W 3OR7C 2IH1C 3SPCA 2ZXWC 2MK3A 3ABKC 1COWG 1OHHG 1S77D 2WLMA 3EHBB 1PL0A 3CCSV 3A0RA 2K1EA 3ZIAG 3RBZA 3G71V 2IU0A 1GK9A 3CMEV 2XASA 1KKDA 1F4MA 4L87A 5FL7G 1FS0G 2WLLB 3B8NA 3SYCA 3X2QC 2P6JA 5EBLC 1THZA 4P9OA 1E1RG 3FYEB 3TCUA 3ZN0A 2HKOA 1VQNV 2X6CA 5LGNA 4HAMA 1SETA 1NVPB 3LSSA 2H8PC 3LSQA 3UM7A 2EIMB 4PDMA 4OXSA 2QTOA 2WLNA 3ABMB 3MD0A 4WFAV 3R65A 2JK5C 4JAUA 4LCUC 2HVKC 3JYCA 2EIMC 3OUSA 1NBMG 2QA4V 1YIJV 1VQ6V 2W6IG 3LDCA 2JDIG 4X88A 2EINB 4GX1A 5EBMC 3K3WA 4TT3G 2OT5A 1GTOA 4XDKA 3F7YC 3OM3B 3ZMTA 3OAAG 1SESA 2QM7A 2ZR3A 3QO7A 4RQEA 2WLIA 3IFXA 2EINC 3CCQV 1QCEA 3DTUB 3GB7C 3CCLV 2EIJB 2IU3A 3ZJZA 2LP7A 2AHYA 3NXSA 2YEVB 4KP4A 5H6QA 3FB7C 2WWWA 1QVGU 2PI4A 2XAQA 1R3JC 2CK3G 1S3JA 3IGAC 1AROP 2WLIB 2A9HA 1PNLA 2EIKC 3W7TA 4RO2A 1ROPA 4GCZA 2W0FC 2WLHA 5LGTA 3OR6C 3E8HA 1E1QG 1FXHA 3ZRWA 1M90W 3CCUV 2EJRA 2F43G 5HFMA 3ZRXA 4JTCB 5E1AC 3GWOA 2HG5C 3CCMV 5B1OA 4RAIA 1G4YB 4WFBV 2FTKA 5L3BA 2JJ2G 3T4ZA 3I56V 4UXNA 1F4NA 1JJ2U 5IYDO 2DWDC 1OCZB 1RPRA 2XOKG 1M56B 3SPHA 3H01A 4J9YB 4QE9A 1VQ8V 3OMIB 4PDVA 4P2ZA 4RUFA 1I5YA 1V55C 3JCZA 1H38A 4QE7A 1F23A 1AR1B 3T2MA 1M1KW 4GX0A 4WCEV 3F7VC 5L3FA 2W6JG 2B1IA 5CMUA 1DTOA 1OCZC 3JD0A 2GSMB 5KA6A 1M56C 3OEEG 5L3CA 2EZOA 4MVRA 2OCCC 1K8AW 3CC2V 2NNUA 1QLNA 1AJNA 2ITCC 1HWYA 2YSUB 1M57C 2WLKA 1VQOV 3LDEA 5L3DA 3WG7C 1QLEB 1YTFD 4GT1A 1K33A 1OZ0A 4GX2A 1MOFA 2EBOA 5DM6V 3B77A 5IYBO 1MG1A 1M57B 3E8BA 4BW5A 1XL6A 1OCOC 3SYPA 1KC8W 2ATKC 3IC7A 2A0LA 4LP8A 5CBFA 4R7CA 1ENVA 3K08A 4WFGA 2ZR2A 4H33A 2IH3C 3E8FA 3K04A 1QBZA 4R50A 1YSCA 4HYOA 1N8RW 1Q86W 2X0LA 4JYBA 5CBHA 4XDLA 3ABTA 2D3OW 2P67A 4ZKIA 3CMAV 3W7UA 3AEIA 3FB8C 2X6AA 3CC7V 1KQSU 1K9MW 1W0KG 3SPJA 3FKSG 1JPXA 3CCEV 2QE7G 4FJCC 4JPRA 1BHBA 1M9NA 1PD3A 4FIPC 4PA3A 3TETA 1GMGA 2H94A 1BHAA 1G8MA 3ABLB 1EFRG 2XAHA 3BEHA 3ZCCA 3FYIB 2QEXV 1R6KA 4LC1A 1BL8A 1TUEB 3ABLC 1YHQV 1LNQA 3KG2A 1R6NA 3VBBA 2DYRC 2JEUA 2KB1A 3ZMUA 2EILB 2C2AA 3AG2C 3E89A 4UUJC 4ASUG 5EBWC 1K3EA 1GM7A 2DYRB 3ETDA 4TSFG 3PJSK 4I9WA 3SYAA 1GO3F 3SYOA 3STZC 3AG2B 1S5HC 3JD1A 3BY6A 4QIWF 4QJFB 1B6QA 3K0DA 1FFTB 1H2GA 3D36A 1NR1A 1AI7A 2R9RB 3DGEA 2JIZG 2WLJA 3CYOA 1OCRC 4I5SA 2IW5A 4JGSA 1FXVA 4QPKA 2Y69B 1EZJA 2DQ0A 1R3LC 3MHSC 4PA9A 4JF3A 5EK0A 5LHGA 3CCRV 4PDLA 3HB3B 4UVCA 1PNKA 1XL4A 2JEXA 5B1NA 3E2EA 3T4DA 4MTXA 5KA5A 1NQTA 3RVZA 4G28B 1NR7A 2OTJV 3JD2A 3G4SV 3SYQA 3STLC 3QNEA 3ZRSA 1YJNV 1AJQA 2DQ3A 3ML0A 5EC1C 2EZPA 1K73W 3MHHC 3ETGA 3X2QB 3ASOC 3K9AA 1EBOA 4MSWC 5B1AB 3ZMVA 2WLLA 4MW3A 3ZRVA 1KD1W 2ZXWB 2BOBC 5C93A 4UV9A 3E8GA 2QM8A 4N23A 1J95A 4R6ZA 4GX5A 4P30A 5B1BB 2DW4A 1WPXA 1GKFA 4EKWA 4FK5C 4PELA 2DYSC 1Y66A 4MVMA 5H6RA 4BIZA 1QVFU 4HZ3A 3OW2U 3K06A 4MVSA 5L3EA 5B1BC 3QO8A 1YTFB 3JD4A 2DYSB 4JAVA 1RM1C 1YJWV 1IXMA 3QO5A 1JX9A 3EFFK 4G27B 3ABMC 4Q20A 3OMAB 1AI4A 1V54B 5HFLA 2JJ1G 4KFMA 5KUKA 3ZMZA 4Z1MG 2WPDG 3P32A 2AHZA 4U7OA 4MTGA 4CZZA 1RM1B 4U7NA 4JASA 2UXNA 2EIJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWE C;  1V54 C;  2WLI A;  3IFX A;  2EIN C;  3SPG A;  4MTF A;  2A79 B;  4LBE C;  4R8C A;  4X89 A;  4MVU A;  3BEH A;  1K4D C;  3AG3 C;  3GB7 C;  5IY5 C;  4MVZ A;  4WFE A;  3LNM B;  4QNH B;  4P9P A;  3AG1 C;  3ZJZ A;  2EIL C;  2AHY A;  2Q68 A;  3FB6 C;  4MS2 A;  1BL8 A;  3ABL C;  3FB7 C;  2Q6A A;  4PA7 A;  1LNQ A;  3KG2 A;  3OUF A;  1R3J C;  3IGA C;  3F5W C;  2DYR C;  4JTD B;  4WFF A;  2WLI B;  2A9H A;  2EIK C;  2KB1 A;  3OGC C;  4RO2 A;  3AG2 C;  3E89 A;  5CBG A;  4UUJ C;  2W0F C;  5EBW C;  2WLH A;  4J9Z B;  3OR6 C;  4PDR A;  3E8H A;  3RVY A;  3PJS K;  4I9W A;  3SYA A;  3SYO A;  4TWK A;  3STZ C;  4JTC B;  1S5H C;  5E1A C;  2NLJ C;  1R3K C;  3K0D A;  4PA6 A;  4RUE A;  2HG5 C;  4RAI A;  1G4Y B;  3E83 A;  2R9R B;  3T4Z A;  1JVM A;  2WLJ A;  4MW8 A;  1OCR C;  2HFE C;  3VOU A;  4F4L A;  2DWD C;  1R3L C;  4PA9 A;  2ZD9 A;  2BOC C;  3SPH A;  5B3S C;  2Q69 A;  2P7T C;  5EK0 A;  5J9P C;  3AG4 C;  4J9Y B;  4JTA B;  4PDL A;  4PDV A;  4P2Z A;  4QE9 A;  1V55 C;  1XL4 A;  2X6B A;  4RUF A;  4QE7 A;  3E86 A;  4H37 A;  1R3I C;  4X8A A;  3T4D A;  3T2M A;  3UKM A;  4GX0 A;  4DXW A;  2ITD C;  3F7V C;  3K0G A;  1P7B A;  2Y69 C;  1OCZ C;  1ORQ C;  3K03 A;  4G28 B;  5EC2 C;  3RVZ A;  1M56 C;  3SYQ A;  3STL C;  5BZB A;  3ZRS A;  5B1A C;  3HPL C;  1K4C C;  5EC1 C;  4MVR A;  3OR7 C;  2OCC C;  4CBC A;  4MVQ A;  2IH1 C;  4WFH A;  3SPC A;  2ZXW C;  1QLE C;  3ABK C;  2WLM A;  4MTO A;  3ASO C;  3RW0 A;  2K1E A;  4MSW C;  2HJF C;  3RBZ A;  2ITC C;  3SJQ C;  2HVJ C;  1M57 C;  2WLL A;  2WLK A;  1KKD A;  3LDE A;  4MW3 A;  3WG7 C;  2WLL B;  3SYC A;  2YEV A;  2BOB C;  3ASN C;  3X2Q C;  4XDJ A;  3E8G A;  4GX2 A;  5EBL C;  4P9O A;  4R6Z A;  1J95 A;  3TCU A;  4GX5 A;  4P30 A;  2X6C A;  3E8B A;  4BW5 A;  1XL6 A;  1OCO C;  3SYP A;  4EKW A;  2QKS A;  2ATK C;  2DYS C;  4MVO A;  2H8P C;  4MVM A;  2A0L A;  4LP8 A;  5CBF A;  4R7C A;  3UM7 A;  3K08 A;  4PDM A;  4OXS A;  4HZ3 A;  2QTO A;  2WLN A;  2IH3 C;  3E8F A;  3K04 A;  3K06 A;  4H33 A;  4MVS A;  4R50 A;  3R65 A;  2JK5 C;  5B1B C;  5CBH A;  3SPI A;  4XDL A;  4LCU C;  2HVK C;  3JYC A;  3LUT B;  1ZWI C;  3FB8 C;  2EIM C;  2X6A A;  3EFF K;  3T1C A;  4G27 B;  3ABM C;  3OUS A;  4ZBM A;  5KUM A;  3SPJ A;  2Q67 A;  5KUK A;  3LDC A;  4KFM A;  3FB5 C;  1OCC C;  4PA4 A;  4X88 A;  4GX1 A;  5EBM C;  4WFG A;  2AHZ A;  4MTG A;  4PA3 A;  3TET A;  3LDD A;  4XDK A;  4HYO A;  3F7Y C;  2EIJ C; 
#chains in the Genus database with same CATH topology
 3CXC U;  2JGU A;  2B5U A;  3TJT A;  2XND G;  1I5X A;  2WSS G;  5IYZ A;  3AG3 B;  1K92 A;  1KP2 A;  1L0N H;  4FFB A;  4DR4 B;  4JI4 O;  4I0X A;  4PDR A;  2ZQM A;  2Q7E A;  5H5N A;  3G6E V;  4DV5 B;  4OX9 B;  4QPJ A;  4I7Z B;  3GVM A;  1YDX A;  2BOC C;  2QJ1 A;  4RWU A;  4LNU B;  1I08 A;  3CXH F;  4K0K B;  2IBZ H;  1AI6 A;  3L70 H;  2O57 A;  4JI4 B;  1FXK C;  3W7W A;  5B5E Z;  5EYP B;  1VQ5 V;  5E79 Z;  2ETN A;  2XTA A;  3ABU A;  2HJF C;  4EB6 A;  2XHB A;  1IBL B;  2HVJ C;  5C8Y A;  4BAY A;  5IYC O;  2GUZ A;  3ASN C;  4MT8 A;  4FFK A;  1NTK H;  2RCV A;  2QM4 A;  4ZIB A;  1MMM A;  1VIB A;  2QKS A;  4IYH A;  5IJ0 B;  5LBQ A;  1S72 V;  2ILM A;  1PPJ H;  3KCY A;  1ZX3 A;  1US6 A;  3TK1 A;  2Q7H A;  2LFS A;  3M99 B;  2V1D A;  1ZWI C;  2Q9L A;  1NT2 B;  2OYQ A;  3FB5 C;  1ZUQ A;  1TAE A;  2DE0 X;  4CH6 A;  3CCV V;  3SPG A;  4YXW G;  4ICG A;  2R9A A;  5IY5 C;  1P84 F;  4WFE A;  3H1L H;  4QNH B;  5LYJ B;  3FB6 C;  4JI2 B;  1W0J G;  2Q6A A;  4ZOL A;  4NB5 A;  3CCJ V;  5L3G A;  4DR2 B;  1XMQ B;  4J9Z B;  3L73 H;  3RVY A;  4RQF A;  3RYC B;  2Y4U A;  3BRC A;  1MSW D;  2R70 A;  2NLJ C;  1DF5 A;  2VRZ A;  3HR0 A;  2F95 B;  3E22 B;  1VQK V;  1CP9 A;  2CTQ A;  3VQV A;  3HKD A;  4MW8 A;  5LHI A;  4F4L A;  2UXX A;  4B3T O;  1Q43 A;  1NKD A;  2ZD9 A;  1QR8 A;  4JTA B;  2P90 A;  1YI2 V;  1S76 D;  2Q7G A;  1JJO A;  2YIB D;  3JAW B;  4UCO A;  5B3S B;  5B1A C;  3JAL B;  4NXN B;  1Q81 W;  3BA9 A;  3SPC A;  4PI0 A;  3ABK C;  4PV1 B;  3ZIA G;  3AK3 A;  2AGA A;  4B7K A;  3G71 V;  2IU0 A;  4ZOL B;  1F4M A;  2LW1 A;  1HW7 A;  5FL7 G;  2CDY A;  1SA0 A;  2VS0 A;  1N33 O;  1VQN V;  4J41 A;  4HAM A;  1NVP B;  5LOV A;  3HKC A;  2H8P C;  3K5M A;  3LSQ A;  1NZ6 A;  2GV9 A;  2EIM B;  4PDM A;  4OXS A;  3MD0 A;  3ABM B;  4WFA V;  1SA0 B;  3K5L A;  4LCU C;  1J5E O;  2PYL A;  1HDJ A;  4JV5 O;  3CRC A;  3CJH A;  4O4H B;  3ZHQ A;  2EIN B;  4GX1 A;  5EBM C;  4IHJ B;  2LGW A;  5D5P A;  3N27 A;  1GTO A;  4XDK A;  3F7Y C;  1SES A;  2QM7 A;  2ZR3 A;  3JAR B;  5LP6 A;  1N0J A;  1M5I A;  4ZI7 B;  4CH5 A;  3UQ8 A;  2YS8 A;  2IU3 A;  3ZJZ A;  4GKK B;  2YEV B;  1O9H A;  3FB7 C;  1R3J C;  2CK3 G;  1YZB A;  2WLI B;  2A3Q A;  3W7T A;  1ROP A;  1P7G A;  3DXR B;  4HNA B;  4GCZ A;  1WA8 A;  5JJJ B;  1E1Q G;  1EN4 A;  1WP7 A;  4AI8 A;  3T1Y B;  3LSU A;  1XHX A;  1AR5 A;  3CX5 F;  1F4N A;  2E5L O;  4D7S A;  1FPO A;  4W4K A;  3SPH A;  5BMV B;  3OMI B;  1F23 A;  2YI8 A;  3CWB H;  4YHH O;  3F7V C;  5CMU A;  1YF2 A;  2GSM B;  3F5T A;  1Y6X A;  2E5L B;  4MVR A;  3O9O A;  2QR4 A;  5JH7 B;  3H1I H;  3N2K B;  4JAA A;  1HWY A;  4X9Q A;  4LF9 B;  2WLK A;  4YJ3 B;  3SJA C;  5L3D A;  3WG7 C;  2KSD A;  3RGB A;  1YTF D;  2EBO A;  1MG1 A;  3DXR A;  4HNA A;  2QWO B;  4PI2 A;  1OCO C;  3SYP A;  3IC7 A;  3CRR A;  4YJ3 A;  3UO2 A;  4LP8 A;  5CBF A;  1XOU A;  3QG5 A;  3K08 A;  3OD4 A;  4H33 A;  2IH3 C;  1N8R W;  3K04 A;  2CTP A;  1SQX H;  1Q86 W;  5CBH A;  1OJH A;  2FB5 A;  5K1P A;  2M6Y A;  2D3O W;  4ZKI A;  4FLW A;  3Q4H A;  3CC7 V;  3SJB C;  1W0K G;  4U3J B;  1GN6 A;  1U97 A;  4TV8 B;  2YDE A;  4F6R B;  2Q73 A;  3H1J H;  3K5N A;  3A2F A;  4DV7 O;  1BHA A;  1KKC A;  1EFR G;  1AIL A;  1Z5W A;  3ZCC A;  2R72 A;  2QEX V;  1XNR O;  1YHQ V;  3KG2 A;  3T1H O;  3VBB A;  3BPZ A;  2C2A A;  3RYI B;  4B3M B;  4ASU G;  3RYH A;  1GM7 A;  5D5Q A;  4BW9 A;  3PN1 A;  3SYA A;  3RYC A;  3SYO A;  4FLU A;  3AG2 B;  4LF7 O;  4QJF B;  1B6Q A;  4TUY B;  1MSD A;  1AI7 A;  2YIB A;  2JIZ G;  1JA8 A;  2IW5 A;  4NVP A;  1JFF A;  2QWQ B;  2Y69 B;  1EZJ A;  1R3L C;  4O4J A;  5LHG A;  3CCR V;  4PDL A;  4TQD A;  3HB3 B;  2XT9 A;  4AHC A;  4DV2 B;  1PNK A;  3K58 A;  3B40 A;  3BVO A;  5KX5 A;  1AR4 A;  5GON B;  3J7A U;  5BMV A;  2HP8 A;  1IZ3 A;  4X1Y B;  1AJQ A;  3D8C A;  2EZP A;  2Q5Z A;  5IE9 A;  3MHH C;  1YEW A;  4CH3 A;  1HNX O;  1VMG A;  4MSW C;  4J7Z A;  5ITZ A;  1XQ8 A;  3ZRV A;  5AG2 A;  2BOB C;  3JAS B;  3K59 A;  5LMU O;  4NXM O;  4YY3 B;  2HHH B;  4FLX A;  4BIO A;  5KHG A;  4GX5 A;  4P30 A;  2DW4 A;  2DYS C;  1Y66 A;  3CRM A;  4MVM A;  1QVF U;  3ZHV A;  2P4V A;  4DV4 O;  4UCR A;  2OIG A;  5B1B C;  3SR2 C;  4H44 B;  4TUY A;  1RM1 C;  1XEQ A;  2KG7 B;  3JAL A;  3QO5 A;  4G27 B;  3ABM C;  1AI4 A;  4LF8 O;  4FZ1 A;  4KFM A;  3ZMZ A;  2WPD G;  2L35 A;  5KMG A;  4B3M O;  3RBZ A;  2H3O A;  2X7R B;  1JCH A;  3CPW U;  4FM1 A;  1K4D C;  5EIB D;  4JI0 B;  4P9P A;  2XAF A;  2CH7 B;  4FM2 A;  1FJG B;  2JRI A;  2CE4 A;  3E35 A;  1NVP D;  3QTC A;  2Z5U A;  4DV7 B;  1UPG A;  1B3Q A;  3THO A;  3JAT A;  4N21 A;  1GH6 A;  4DV2 O;  2WA3 A;  1VQM V;  5CA3 A;  1XMO O;  5GTH Z;  4UB8 Z;  2RN9 A;  3AG4 B;  2UXC B;  4DUZ O;  3KZI Z;  4I9Q A;  2BTQ A;  3ZHT A;  3CD6 V;  1GN4 A;  1K5S A;  2KQX A;  4I4T A;  3DC6 A;  3CRQ A;  1SQP H;  1RFY A;  4DXW A;  1MAB G;  4DRX A;  4UCV A;  1N34 B;  3K03 A;  3P30 A;  5C8Y B;  4DR1 B;  2IJH A;  2XAJ A;  1DK1 A;  3ETQ A;  1K4C C;  2P5O A;  3ZHU A;  4WFH A;  2IM9 A;  1L0L H;  2JVD A;  2BTO A;  1JR9 A;  4MTO A;  3ZN1 A;  4KXR A;  2AZ0 A;  1OCO B;  2YEV A;  1Q7Y W;  1GM8 A;  1SZX A;  1S0V A;  3HKB A;  4XDJ A;  3EXA A;  5IJ9 A;  3JAT B;  1URF A;  3OE7 G;  3WG7 B;  3BHP A;  1N34 O;  3M8A A;  5TIS Z;  1DF4 A;  1MA1 A;  4IHJ A;  5IJ9 B;  1JOY A;  4LNU A;  1L1F A;  4UVA A;  3T1C A;  1DGS A;  4D6T H;  1SQF A;  4NTY A;  2RMK B;  3K79 A;  4CC5 A;  4E4E A;  2HR3 A;  1F51 A;  3AK2 A;  3OMN B;  4LWS A;  5BXZ A;  4LBE C;  1AJP A;  4X89 A;  5KAF Z;  2HHH O;  4DV5 O;  1Y67 A;  3AG1 C;  2ZDI C;  2M7W A;  3U11 A;  4PA7 A;  4FLT A;  3F5W C;  4X62 B;  1XNQ B;  3C3S A;  3BCC H;  3W7S A;  1IDS A;  5FNV A;  4UVB A;  1H8H G;  1I94 O;  1G6U A;  3RWR D;  1VQ4 V;  4TWK A;  2GHY A;  2JGD A;  2E76 B;  2WA4 A;  3CHX A;  5JJN B;  1PKX A;  1WP8 A;  4O4J B;  5JCO A;  4PD4 F;  5JQG A;  1WNS A;  3QVN A;  2IJK A;  2LFR A;  2Z3Y A;  5J9P C;  1QHT A;  2Q69 A;  4X8A A;  1E79 G;  3JAK A;  4H37 A;  1R3I C;  4LF7 B;  2ITD C;  3K0G A;  2Y69 C;  1ORQ C;  1H8E G;  3L72 H;  3R66 A;  1RSO A;  1XMO B;  3RYH B;  3UCS C;  4I0X B;  1BS3 A;  3OGI B;  2MK3 A;  1QQC A;  2WLM A;  4PJ0 Z;  3LNN A;  3CCS V;  1KKD A;  4L87 A;  1FS0 G;  5J2T A;  3SYC A;  3IJ4 A;  3X2Q C;  2P6J A;  1THZ A;  3AK1 A;  2HKO A;  4J80 A;  3ZN0 A;  3L71 H;  3FD9 A;  1EZV H;  1QU7 A;  2QTO A;  2N74 A;  2CTR A;  3E22 A;  2JK5 C;  4I50 A;  3WB2 A;  4GZR B;  2EIM C;  1NBM G;  2DOS A;  1YIJ V;  2W6I G;  4X88 A;  3K3W A;  3OM3 B;  4EFE A;  2BCC H;  4CH4 A;  1QCE A;  4JV5 B;  2LP7 A;  4O4I A;  2GUZ B;  2WWW A;  3WB1 A;  1QVG U;  4K0K O;  1S3J A;  1VAR A;  4DR5 B;  2A9H A;  5LGT A;  3K5O A;  3OR6 C;  3E8H A;  1IXB A;  5A2Q N;  4DUY B;  1NI8 A;  3CJH B;  5HFM A;  1D5A A;  1VF6 A;  3CCM V;  3JAS A;  4X20 B;  2FTK A;  4I50 B;  5IYD O;  2BSK B;  1RPR A;  2XOK G;  1M56 B;  2LO1 A;  4DV0 O;  4JI6 B;  4QE9 A;  2CH7 A;  2QGN A;  1V55 C;  1H38 A;  4QE7 A;  1AR1 B;  3T2M A;  3T1Y O;  5KA6 A;  4AQY B;  1N32 B;  3G6B A;  3IC9 A;  1K8A W;  2LGQ A;  1QLN A;  3K9S A;  1AJN A;  3HKB B;  2YSU B;  1VQO V;  4Q6G A;  3B09 A;  1TVK A;  4GX2 A;  2F4V B;  2ZCE A;  1XL6 A;  4I55 B;  4ABM A;  1OV9 A;  4LR3 A;  2A0L A;  4YIO A;  4R7C A;  1ENV A;  1QBZ A;  1N0N A;  4R50 A;  5H2F Z;  4LFC O;  1IBL O;  1HNW O;  1N32 O;  3CMA V;  3W7U A;  3ZHR A;  3AEI A;  1KQS U;  1K9M W;  1I7F A;  1D5N A;  3FKS G;  1JPX A;  3CCE V;  1M9N A;  1WPB A;  5FPO A;  4J42 A;  1V9P A;  2FYU H;  4O2B A;  2YIA A;  2H94 A;  2KKW A;  2FKX A;  1G8M A;  3ABL B;  3GWK C;  3A0H Z;  5LYJ A;  4FVM A;  2F23 A;  1KU9 A;  2Q4P A;  1TUE B;  2K9P A;  1R6N A;  2VQF O;  1Q6H A;  3N2G B;  3ZHS A;  2DYR C;  2UXC O;  1HP8 A;  5FLX N;  5EBW C;  3PJS K;  1HNZ B;  5KAI Z;  3UT5 B;  3STZ C;  3APO A;  3JD1 A;  4QIW F;  4LH7 A;  3A8T A;  4NTW A;  3D36 A;  1NR1 A;  4I5S A;  1ZAU A;  5JQG B;  4JF3 A;  5EK0 A;  1GN2 A;  3H1K H;  4F6R A;  4UVC A;  5KA5 A;  1H2K A;  1NQT A;  3FAV B;  3RVZ A;  4G28 B;  3JD2 A;  2QSA A;  3QNE A;  3EVK A;  2DQ3 A;  2QWP B;  1P49 A;  4PHZ A;  5FNV B;  4A5U B;  4DR6 O;  1I0H A;  4GYC B;  3X2Q B;  3SJC C;  3K9A A;  4DUY O;  3SGI A;  2WLL A;  2AW9 A;  4MW3 A;  4CS3 A;  3CEI A;  4NXN O;  2A06 H;  1NTM H;  4N23 A;  1J95 A;  4EKW A;  4HZ3 A;  4MVS A;  4QGP A;  3QO8 A;  4B3R B;  1YTF B;  3JD4 A;  4B7E A;  2DYS B;  1TUB A;  4X1I A;  2JGD B;  1IXM A;  3EFF K;  4X1Y A;  3QF7 A;  1V54 B;  3AG7 A;  4BWA A;  3P32 A;  2AHZ A;  1G1X B;  4X66 O;  1RM1 B;  1FJG O;  1UJW B;  4DV4 B;  4UV9 A;  1BCC H;  1XMQ O;  3IAY A;  4B3S B;  4MTF A;  2ZKO A;  2RNB A;  3A0B Z;  3BA8 A;  4MVU A;  3WFV A;  2ADQ B;  2PI5 A;  2Y0I A;  3S3X A;  2YC0 A;  1K7D A;  3RN4 A;  4O4L B;  3JSN A;  4E2L A;  2OCH A;  1KMI Z;  4Z1V A;  5JJE B;  1FYJ A;  4GKJ B;  2G38 A;  5DN6 G;  4AQY O;  5A9G A;  4X64 O;  5F2V O;  4UB6 Z;  4X65 B;  1S5L Z;  1WLE A;  1WJZ A;  2IJI A;  1BT8 A;  4DRX B;  1Z5V A;  3I55 V;  2F1M A;  2RDC A;  1JVM A;  4TV8 A;  1Q3E A;  4J7J A;  1I94 B;  2P7T C;  5BY1 A;  3AG4 C;  5EZY A;  3OTF A;  4O4I B;  1Q90 D;  3UKM A;  2QKA A;  4B08 A;  2FML A;  2QDO A;  1H2L A;  1SRY A;  1NJI W;  1V55 B;  3K57 A;  4CBC A;  2GTA A;  1Y76 A;  4J7K A;  1IBM B;  3RW0 A;  3SJQ C;  4DK0 A;  1SQV H;  1CXZ B;  4B3S O;  1MZF A;  2OIE A;  3CS5 A;  2QKC A;  2E3C A;  1U96 A;  1IBK O;  2R9I A;  1R73 A;  2NR5 A;  3VQW A;  3CP1 A;  1CEZ A;  3SPI A;  5LMN O;  5DEC A;  3ICX A;  4IT5 A;  4FZ0 A;  1H2M A;  5H9C A;  1KEC A;  2KG7 A;  5KUM A;  4JYC A;  5LHH A;  1OCC C;  3JAR A;  1TUB B;  4PA4 A;  4X1I B;  5CA1 A;  3G67 A;  3LDD A;  1QR9 A;  5IY5 B;  2ZE6 A;  1YIT V;  2IJJ A;  1GM9 A;  1K34 A;  4FPP A;  2PZS A;  2A79 B;  1RSO B;  2DJV A;  3OTO O;  5JWP A;  2D2C B;  3RT3 C;  2HJD A;  4X1K B;  4LFB O;  1PV0 A;  1VEW A;  1VP7 A;  4DR1 O;  4CS2 A;  2DN9 A;  3N2K A;  3KCX A;  4JZ2 A;  3B8M A;  1QNM A;  3APQ A;  2BE3 A;  4NTX A;  3ETE A;  1Z2G A;  4DV1 B;  4RUE A;  3JCU Z;  4FLZ A;  3S3W A;  1PNM A;  2B1G A;  3VOU A;  2HFE C;  2ZNI A;  1R6T A;  1PM9 A;  4LFA B;  4UCU A;  1KUQ A;  4WF9 V;  3DSQ A;  3T1H B;  4UCT A;  1A32 A;  1N36 B;  4NKG B;  1AI5 A;  3P3N A;  4LF9 O;  5LL6 Y;  3ABK B;  1VF7 A;  5EC2 C;  3ASO B;  4LWS B;  2QWR B;  1EN6 A;  3OR7 C;  1IBK B;  1SKV A;  2IH1 C;  5J2U A;  2UUC B;  3HKE B;  1COW G;  1S77 D;  3MAQ A;  4JI6 O;  2Q0O C;  2NN4 A;  3CME V;  5LOV B;  2WLL B;  2P4K A;  5EBL C;  2RJZ A;  4P9O A;  1E1R G;  3CB2 A;  3FYE B;  3TCU A;  4H13 B;  5LGN A;  4JI5 O;  2Z0A A;  3ZX6 A;  4GUN A;  1LUW A;  2CTW A;  3LSS A;  2BTQ B;  5KHK A;  3R65 A;  3VQY A;  2CUG A;  3SDL A;  1BSM A;  3JSL A;  2XUM A;  3JYC A;  1ZL8 A;  1FAF A;  1HR0 O;  3ZED A;  5JVD A;  3JAW A;  3LDC A;  2JS3 A;  4O2A B;  3ZMT A;  3OAA G;  4RQE A;  2N04 A;  4O4H A;  1SQQ H;  2EIN C;  4X64 B;  1IX9 A;  4NYK A;  2F66 C;  2EUL A;  3DTU B;  4O4L A;  3CCL V;  1ZTE A;  2EIJ B;  3WB0 A;  2AHY A;  3NXS A;  4KP4 A;  2YXY A;  2PI4 A;  4UCS A;  1ARO P;  5IJ0 A;  1PNL A;  2EIK C;  3L9D A;  3JAM N;  2W0F C;  2WLH A;  1H2S B;  3P3P A;  2LJ2 A;  2DMX A;  3ZRW A;  3ZBH A;  2F43 G;  2UXD O;  3ZRX A;  4JTC B;  5E1A C;  3GWO A;  1NS1 A;  1AP6 A;  5DED A;  4RAI A;  1G4Y B;  2Y0P A;  4WFB V;  5L3B A;  3FX7 A;  2VQE O;  1YVW A;  1FFX A;  1JJ2 U;  2DWD C;  1OCZ B;  1XI1 A;  3RYF A;  3H01 A;  3UO3 A;  4BR6 A;  4RUF A;  4P2Z A;  1I5Y A;  3JCZ A;  1M1K W;  3JAK B;  4K8Z A;  5L3F A;  1XBL A;  2B1I A;  4X65 O;  4ZI7 A;  5LMN B;  1D2D A;  4D7T A;  3OEE G;  1XHZ A;  4JI1 O;  2OCC C;  4LF5 O;  1WAZ A;  4DK1 A;  1XRE A;  1YCI A;  2QWN B;  5KMG B;  4OGQ B;  2ITC C;  1AP5 A;  1M57 C;  3LDE A;  3U10 A;  1K33 A;  1OZ0 A;  1MOF A;  3B77 A;  5IYB O;  1KC8 W;  2ATK C;  3NR7 A;  2E74 B;  1VF5 B;  5IT9 N;  4X20 A;  2X0L A;  4JYB A;  1XNQ O;  3ABT A;  2P67 A;  1Q8I A;  3FB8 C;  4DR2 O;  2JS5 A;  2ZNJ A;  3SPJ A;  1AVM A;  2L6L A;  2YXL A;  4U3F H;  2QE7 G;  2Q8V A;  2RQ6 A;  1BHB A;  3HKE A;  4PA3 A;  2PYJ A;  3I5D A;  1GMG A;  4OPH A;  1O9G A;  2XAH A;  1IUR A;  2LW7 A;  4LC1 A;  1LNQ A;  1W59 A;  4O2B B;  2JEU A;  1SQG A;  4B3T B;  3ZMU A;  4Z2W A;  3AG2 C;  3E89 A;  4UUJ C;  2VWJ A;  4LF6 O;  4TOI A;  3M7M X;  4I9W A;  1GO3 F;  2ADP A;  2YI9 A;  3D36 C;  3BY6 A;  1XNR B;  1FFT B;  1B06 A;  4O2A A;  2P22 C;  1IVS A;  3G80 A;  3CYO A;  1OCR C;  3MHS C;  4PA9 A;  2UXB B;  2VQF B;  2UUA O;  2F93 B;  2JEX A;  3E2E A;  3C90 A;  4W4L A;  5IWA O;  4JI8 B;  1HNZ O;  2OTJ V;  3G4S V;  3SYQ A;  2B9Z A;  4LF4 B;  2YIC A;  3ZRS A;  1J5E B;  4JZG A;  1FFX B;  4LH6 A;  1K73 W;  2PGG A;  3ETG A;  3ASO C;  1EBO A;  1PL4 A;  5J2T B;  1KYO F;  5LXT A;  1KD1 W;  4DUZ B;  4LF4 O;  5C93 A;  1TGO A;  2CGO A;  1WPX A;  4FK5 C;  4IGG A;  3OW2 U;  4KHP O;  5L3E A;  4JAV A;  1ZSP A;  3CE2 A;  3OTO B;  1JX9 A;  1T5E A;  1X59 A;  5KHJ A;  5GON A;  2JJ1 G;  4JI3 O;  5KUK A;  5CA0 B;  1N33 B;  1X4T A;  3ZMS A;  4JAS A;  4HYO A;  2EIJ C;  1V54 C;  2ZT9 B;  4OPA A;  4R8C A;  2F4V O;  4CS4 A;  3AG3 C;  1WB7 A;  3TXS A;  1SZT A;  3LNM B;  5IDJ A;  1P4R A;  2HEP A;  2LQT A;  5LP6 C;  2HLD G;  2Q68 A;  1NTZ H;  3TGU H;  1BE3 H;  2GDS A;  4YIP A;  4L8J A;  5IWA B;  3OGC C;  4JI8 O;  4UFZ A;  4BIU A;  1Y76 B;  1YJ9 V;  3CC4 V;  2Y4T A;  2UXB O;  1Y74 A;  4FMT A;  5BR8 B;  4CC6 A;  2EIK B;  1XUQ A;  2P06 A;  3U0Z A;  4UV8 A;  4PA6 A;  1N4C A;  2WAM A;  4LF5 B;  3E83 A;  2BSK A;  4J10 A;  1VF6 C;  4DR4 O;  1FXK B;  4AIL C;  1HNX B;  3D3Q A;  1F7Y A;  3JD3 A;  3W7X A;  1RP3 B;  1WB8 A;  3E86 A;  4HBN A;  2OCC B;  1P7B A;  4KUM A;  4LFC B;  2UUB B;  5BZB A;  2XAG A;  1FXK A;  1ZL8 B;  1ZLZ A;  2ZDI A;  4K35 A;  4MVQ A;  4NR1 A;  1QLE C;  5GW7 A;  1K5Q A;  3ASN B;  1CPY A;  2Q0A A;  2UXD B;  2CAZ C;  1Q82 W;  4X66 B;  2OTL V;  1Y74 B;  3CSX A;  1VQL V;  3RYF B;  3BFR A;  4MVO A;  5ITZ B;  2QTS A;  1SER A;  1BMF G;  3D3I A;  4XBF A;  3LUT B;  4ZHQ B;  2ZM6 O;  5JVD B;  4ZBM A;  2Q67 A;  3ZRW B;  1VQ7 V;  2ODM A;  3BAA A;  5FPR A;  4WBN B;  1VQ9 V;  1JQ0 A;  2DWE C;  2PF4 E;  5CA0 A;  1KP3 A;  2E75 B;  1SF9 A;  1OCC B;  4NXM B;  3H9V A;  1B04 A;  4MVZ A;  1NH2 D;  2V7Q G;  2EIL C;  3B4S A;  4MS2 A;  1RPO A;  5LA6 B;  3OUF A;  2UU9 B;  4JYY A;  3OEH G;  1N36 O;  4JTD B;  3BAB A;  4K3A A;  4WFF A;  5KLV H;  1FD9 A;  1KB9 F;  3AG1 B;  2ZIO A;  5CBG A;  3DC5 A;  5CN0 A;  1K97 A;  3UT5 A;  1AB3 A;  1DLB A;  2YUA A;  1M4U A;  1R3K C;  1TVK B;  4DO2 A;  5KHH A;  4TV9 B;  4DR6 B;  2Y48 A;  3H1H H;  3HKC B;  1VQP V;  1Q6I A;  3OFN G;  1JFF B;  5B3S C;  2VWK A;  1NH2 B;  5IYZ B;  2ZE5 A;  2X6B A;  4JI5 B;  1Y4M A;  5JH7 A;  4TV9 A;  4DW0 A;  1OCR B;  1L8D A;  5LGU A;  4U3J A;  4G2K A;  2OWO A;  3HPL C;  4LF6 B;  1BQ0 A;  1W2B U;  3L75 H;  2GTS A;  2ZXW C;  1OHH G;  2ZIM A;  3EHB B;  1PL0 A;  1HR0 B;  2ZE7 A;  3A0R A;  2K1E A;  3MDS A;  4DYL A;  1FKA O;  1GK9 A;  2XAS A;  4GLX A;  3B8N A;  1UFI A;  5CB4 A;  5K1X A;  1R1B A;  2PY5 A;  4DV3 O;  2X6C A;  1SET A;  4TQF A;  5EIB C;  1TA8 A;  3UM7 A;  2WLN A;  3FFQ A;  2AZ2 A;  4FFB B;  4JAU A;  2HVK C;  3VQX A;  5B66 Z;  3OUS A;  2FL4 A;  2UUC O;  4JI0 O;  2QA4 V;  1VQ6 V;  2JDI G;  3TXQ A;  4JYA B;  1SQB H;  4TT3 G;  1NU1 H;  2OT5 A;  4J11 A;  1BGY H;  3QO7 A;  2WLI A;  3IFX A;  3CCQ V;  4DR3 B;  2GBO A;  3GB7 C;  1HNW B;  2UUA B;  5CB4 B;  5H6Q A;  2ZE8 A;  1EN5 A;  2XAQ A;  1LUV A;  3IGA C;  2YID A;  4JYA O;  4DV1 O;  5LP6 B;  4RO2 A;  1PP9 H;  4DV0 B;  4X1K A;  2N05 A;  4JI1 B;  4DR7 O;  1FXH A;  2YXH A;  3O65 A;  3CCU V;  1M90 W;  2EJR A;  2PUS A;  5LA6 A;  3FAV A;  1H2N A;  2HG5 C;  5B1O A;  4WBN A;  2JJ2 G;  3T4Z A;  3I56 V;  4UXN A;  2UU9 O;  1KBH A;  5CA1 B;  3RFR A;  1XIL A;  4LFB B;  5KHI A;  3J81 N;  4J9Y B;  4F6E A;  1VQ8 V;  3CRA A;  4PDV A;  4OX9 O;  1GN3 A;  3C3T A;  4GX0 A;  4WCE V;  2W6J G;  4DR5 O;  1DTO A;  1OCZ C;  3JD0 A;  1M56 C;  2PTM A;  5L3C A;  2EZO A;  4YJ2 A;  2ARH A;  3CC2 V;  4LFA O;  1XDC A;  2CGN A;  2NNU A;  5J2U B;  1BZK A;  4DV6 O;  1QLE B;  4GT1 A;  4JI7 B;  1GAX A;  4K8X A;  2MW2 B;  2AXT Z;  5DM6 V;  4EFB A;  1M57 B;  3E8B A;  4BW5 A;  1GRJ A;  4I4T B;  4WFG A;  1MZE A;  2ZR2 A;  3E8F A;  1YSC A;  3B2E E;  1SC5 B;  4XDL A;  2W0X A;  4DV3 B;  4YY3 O;  1IBM O;  2X6A A;  5LMU B;  4JI2 O;  4H0L B;  3J80 N;  4FJC C;  4JPR A;  2ZIN A;  1PD3 A;  4FIP C;  5GTI Z;  3TET A;  4JI7 O;  1M93 A;  4DV6 B;  1S5J A;  4FM0 A;  3HKD B;  3N2G A;  2V4D A;  2EJ7 A;  3KKY A;  3BEH A;  3FYI B;  5KX5 B;  4FLV A;  1R6K A;  4FLY A;  1BL8 A;  3ABL C;  2A7W A;  4LF8 B;  1MNG A;  2VQE B;  4IYI A;  4I55 A;  2KB1 A;  2EIL B;  1Q5O A;  1Q6U A;  4EEQ A;  1K3E A;  1JMK C;  2DYR B;  3ETD A;  4TSF G;  5LXT B;  1BQZ A;  2UUB O;  3WU2 Z;  1S5H C;  1LR1 A;  4DW1 A;  3K0D A;  3Q4H B;  4DR3 O;  1H2G A;  2R9R B;  3DGE A;  5EZY B;  3RYI A;  2WLJ A;  3ZS8 C;  4JGS A;  1FXV A;  4QPK A;  3OT7 A;  2DQ0 A;  1XL4 A;  4IIJ B;  5B1N A;  3T4D A;  4X62 O;  4MTX A;  5EYP A;  4GKJ O;  1NR7 A;  3STL C;  1YJN V;  3ML0 A;  4ZHQ A;  5EC1 C;  5BR8 O;  4EB6 B;  1WA8 B;  4JI3 B;  3L74 H;  4IL6 Z;  4YJ2 B;  5B1A B;  3ZMV A;  4B3R O;  4C7U A;  2ZXW B;  1WN7 A;  3E8G A;  2ZM6 B;  2QM8 A;  4R6Z A;  5B1B B;  1GKF A;  4PEL A;  5H6R A;  4BIZ A;  3K06 A;  4YHH B;  1YJW V;  4GKK O;  5JCO C;  4Q20 A;  4DR7 B;  3OMA B;  2EX3 A;  1SS3 A;  5HFL A;  1EM1 A;  4Z1M G;  4U7O A;  4MTG A;  4CZZ A;  4IIJ A;  4KL1 A;  1YXB A;  4U7N A;  4KHP B;  2UXN A; 
#chains in the Genus database with same CATH homology
 2X7R B;  3CXC U;  1V54 C;  1JCH A;  4MTF A;  3CPW U;  4R8C A;  4MVU A;  1K4D C;  2B5U A;  3AG3 C;  1SZT A;  3LNM B;  3WFV A;  1P4R A;  4P9P A;  5IDJ A;  2PI5 A;  2XAF A;  2HLD G;  2XND G;  2Q68 A;  1I5X A;  2WSS G;  1K7D A;  4E2L A;  3E35 A;  3AG3 B;  1K92 A;  1KP2 A;  1NVP D;  1UJW B;  2Z5U A;  3OGC C;  4BIU A;  5DN6 G;  1YJ9 V;  4N21 A;  4PDR A;  3CC4 V;  2ZQM A;  4FMT A;  3G6E V;  1VQM V;  2EIK B;  1WLE A;  4QPJ A;  5CA3 A;  2IJI A;  4UV8 A;  4PA6 A;  3I55 V;  2WAM A;  3AG4 B;  3E83 A;  1JVM A;  3CD6 V;  1K5S A;  1FXK B;  2BOC C;  2P7T C;  3AG4 C;  3JD3 A;  3W7X A;  3E86 A;  2OCC B;  1MAB G;  3UKM A;  4DXW A;  1P7B A;  1AI6 A;  3K03 A;  3P30 A;  1FXK C;  4KUM A;  2IJH A;  2XAJ A;  5BZB A;  2XAG A;  3W7W A;  1SRY A;  1FXK A;  1NJI W;  1K4C C;  1V55 B;  2ZDI A;  1VQ5 V;  4CBC A;  4MVQ A;  4WFH A;  1QLE C;  5GW7 A;  1K5Q A;  4MTO A;  3ASN B;  1CPY A;  3ZN1 A;  3ABU A;  3RW0 A;  2HJF C;  3SJQ C;  2HVJ C;  1OCO B;  4BAY A;  1Q82 W;  2OTL V;  2YEV A;  5IYC O;  1Q7Y W;  1GM8 A;  3ASN C;  1S0V A;  4XDJ A;  4MT8 A;  3OE7 G;  1VQL V;  2R9I A;  1R73 A;  3WG7 B;  2QKS A;  4MVO A;  5LBQ A;  3CP1 A;  1S72 V;  1DF4 A;  1SER A;  1CEZ A;  1BMF G;  1JOY A;  3SPI A;  3D3I A;  4XBF A;  3TK1 A;  3M99 B;  2LFS A;  2V1D A;  3LUT B;  1L1F A;  1ZWI C;  4UVA A;  5H9C A;  3T1C A;  1KEC A;  4ZBM A;  5KUM A;  2Q67 A;  4JYC A;  3ZRW B;  5LHH A;  1VQ7 V;  3FB5 C;  1OCC C;  4PA4 A;  3K79 A;  1VQ9 V;  3LDD A;  1QR9 A;  2HR3 A;  5IY5 B;  1F51 A;  1JQ0 A;  3CCV V;  1YIT V;  2IJJ A;  3OMN B;  2DWE C;  1GM9 A;  1KP3 A;  1K34 A;  4FPP A;  1OCC B;  3SPG A;  2A79 B;  1AJP A;  4LBE C;  4YXW G;  4X89 A;  5IY5 C;  4MVZ A;  4WFE A;  4QNH B;  1NH2 D;  2V7Q G;  3AG1 C;  3FB6 C;  2EIL C;  2ZDI C;  4MS2 A;  2M7W A;  1RPO A;  4PA7 A;  1W0J G;  2Q6A A;  3OUF A;  3F5W C;  3CCJ V;  3OEH G;  4JTD B;  4WFF A;  3AG1 B;  5CBG A;  5L3G A;  3W7S A;  4UVB A;  4J9Z B;  3RVY A;  3B8M A;  5CN0 A;  1H8H G;  4RQF A;  1K97 A;  1VQ4 V;  1MSW D;  4TWK A;  2GHY A;  3ETE A;  1DLB A;  3ZMS A;  2NLJ C;  1DF5 A;  1R3K C;  1PKX A;  4RUE A;  4DO2 A;  1VQK V;  1CP9 A;  1PNM A;  2B1G A;  2Y48 A;  4MW8 A;  3VOU A;  2HFE C;  5LHI A;  4F4L A;  1VQP V;  2UXX A;  3OFN G;  2IJK A;  1NKD A;  2LFR A;  2ZD9 A;  2Z3Y A;  1QR8 A;  5B3S C;  5J9P C;  2Q69 A;  4WF9 V;  4JTA B;  1NH2 B;  2P90 A;  4X8A A;  1E79 G;  2X6B A;  1AI5 A;  4H37 A;  1Y4M A;  1R3I C;  1YI2 V;  1S76 D;  1OCR B;  2ITD C;  3ABK B;  3K0G A;  2Y69 C;  1ORQ C;  5EC2 C;  5LGU A;  1H8E G;  3ASO B;  5B3S B;  4G2K A;  5B1A C;  3HPL C;  1W2B U;  1Q81 W;  3OR7 C;  2IH1 C;  3SPC A;  2ZXW C;  2MK3 A;  3ABK C;  1COW G;  1OHH G;  1S77 D;  2WLM A;  3EHB B;  1PL0 A;  3CCS V;  3A0R A;  2K1E A;  3ZIA G;  3RBZ A;  3G71 V;  2IU0 A;  1GK9 A;  3CME V;  2XAS A;  1KKD A;  1F4M A;  4L87 A;  5FL7 G;  1FS0 G;  2WLL B;  3B8N A;  3SYC A;  3X2Q C;  2P6J A;  5EBL C;  1THZ A;  4P9O A;  1E1R G;  3FYE B;  3TCU A;  3ZN0 A;  2HKO A;  1VQN V;  2X6C A;  5LGN A;  4HAM A;  1SET A;  1NVP B;  3LSS A;  2H8P C;  3LSQ A;  3UM7 A;  2EIM B;  4PDM A;  4OXS A;  2QTO A;  2WLN A;  3ABM B;  3MD0 A;  4WFA V;  3R65 A;  2JK5 C;  4JAU A;  4LCU C;  2HVK C;  3JYC A;  2EIM C;  3OUS A;  1NBM G;  2QA4 V;  1YIJ V;  1VQ6 V;  2W6I G;  3LDC A;  2JDI G;  4X88 A;  2EIN B;  4GX1 A;  5EBM C;  3K3W A;  4TT3 G;  2OT5 A;  1GTO A;  4XDK A;  3F7Y C;  3OM3 B;  3ZMT A;  3OAA G;  1SES A;  2QM7 A;  2ZR3 A;  3QO7 A;  4RQE A;  2WLI A;  3IFX A;  2EIN C;  3CCQ V;  1QCE A;  3DTU B;  3GB7 C;  3CCL V;  2EIJ B;  2IU3 A;  3ZJZ A;  2LP7 A;  2AHY A;  3NXS A;  2YEV B;  4KP4 A;  5H6Q A;  3FB7 C;  2WWW A;  1QVG U;  2PI4 A;  2XAQ A;  1R3J C;  2CK3 G;  1S3J A;  3IGA C;  1ARO P;  2WLI B;  2A9H A;  1PNL A;  2EIK C;  3W7T A;  4RO2 A;  1ROP A;  4GCZ A;  2W0F C;  2WLH A;  5LGT A;  3OR6 C;  3E8H A;  1E1Q G;  1FXH A;  3ZRW A;  1M90 W;  3CCU V;  2EJR A;  2F43 G;  5HFM A;  3ZRX A;  4JTC B;  5E1A C;  3GWO A;  2HG5 C;  3CCM V;  5B1O A;  4RAI A;  1G4Y B;  4WFB V;  2FTK A;  5L3B A;  2JJ2 G;  3T4Z A;  3I56 V;  4UXN A;  1F4N A;  1JJ2 U;  5IYD O;  2DWD C;  1OCZ B;  1RPR A;  2XOK G;  1M56 B;  3SPH A;  3H01 A;  4J9Y B;  4QE9 A;  1VQ8 V;  3OMI B;  4PDV A;  4P2Z A;  4RUF A;  1I5Y A;  1V55 C;  3JCZ A;  1H38 A;  4QE7 A;  1F23 A;  1AR1 B;  3T2M A;  1M1K W;  4GX0 A;  4WCE V;  3F7V C;  5L3F A;  2W6J G;  2B1I A;  5CMU A;  1DTO A;  1OCZ C;  3JD0 A;  2GSM B;  5KA6 A;  1M56 C;  3OEE G;  5L3C A;  2EZO A;  4MVR A;  2OCC C;  1K8A W;  3CC2 V;  2NNU A;  1QLN A;  1AJN A;  2ITC C;  1HWY A;  2YSU B;  1M57 C;  2WLK A;  1VQO V;  3LDE A;  5L3D A;  3WG7 C;  1QLE B;  1YTF D;  4GT1 A;  1K33 A;  1OZ0 A;  4GX2 A;  1MOF A;  2EBO A;  5DM6 V;  3B77 A;  5IYB O;  1MG1 A;  1M57 B;  3E8B A;  4BW5 A;  1XL6 A;  1OCO C;  3SYP A;  1KC8 W;  2ATK C;  3IC7 A;  2A0L A;  4LP8 A;  5CBF A;  4R7C A;  1ENV A;  3K08 A;  4WFG A;  2ZR2 A;  4H33 A;  2IH3 C;  3E8F A;  3K04 A;  1QBZ A;  4R50 A;  1YSC A;  4HYO A;  1N8R W;  1Q86 W;  2X0L A;  4JYB A;  5CBH A;  4XDL A;  3ABT A;  2D3O W;  2P67 A;  4ZKI A;  3CMA V;  3W7U A;  3AEI A;  3FB8 C;  2X6A A;  3CC7 V;  1KQS U;  1K9M W;  1W0K G;  3SPJ A;  3FKS G;  1JPX A;  3CCE V;  2QE7 G;  4FJC C;  4JPR A;  1BHB A;  1M9N A;  1PD3 A;  4FIP C;  4PA3 A;  3TET A;  1GMG A;  2H94 A;  1BHA A;  1G8M A;  3ABL B;  1EFR G;  2XAH A;  3BEH A;  3ZCC A;  3FYI B;  2QEX V;  1R6K A;  4LC1 A;  1BL8 A;  1TUE B;  3ABL C;  1YHQ V;  1LNQ A;  3KG2 A;  1R6N A;  3VBB A;  2DYR C;  2JEU A;  2KB1 A;  3ZMU A;  2EIL B;  2C2A A;  3AG2 C;  3E89 A;  4UUJ C;  4ASU G;  5EBW C;  1K3E A;  1GM7 A;  2DYR B;  3ETD A;  4TSF G;  3PJS K;  4I9W A;  3SYA A;  1GO3 F;  3SYO A;  3STZ C;  3AG2 B;  1S5H C;  3JD1 A;  3BY6 A;  4QIW F;  4QJF B;  1B6Q A;  3K0D A;  1FFT B;  1H2G A;  3D36 A;  1NR1 A;  1AI7 A;  2R9R B;  3DGE A;  2JIZ G;  2WLJ A;  3CYO A;  1OCR C;  4I5S A;  2IW5 A;  4JGS A;  1FXV A;  4QPK A;  2Y69 B;  1EZJ A;  2DQ0 A;  1R3L C;  3MHS C;  4PA9 A;  4JF3 A;  5EK0 A;  5LHG A;  3CCR V;  4PDL A;  3HB3 B;  4UVC A;  1PNK A;  1XL4 A;  2JEX A;  5B1N A;  3E2E A;  3T4D A;  4MTX A;  5KA5 A;  1NQT A;  3RVZ A;  4G28 B;  1NR7 A;  2OTJ V;  3JD2 A;  3G4S V;  3SYQ A;  3STL C;  3QNE A;  3ZRS A;  1YJN V;  1AJQ A;  2DQ3 A;  3ML0 A;  5EC1 C;  2EZP A;  1K73 W;  3MHH C;  3ETG A;  3X2Q B;  3ASO C;  3K9A A;  1EBO A;  4MSW C;  5B1A B;  3ZMV A;  2WLL A;  4MW3 A;  3ZRV A;  1KD1 W;  2ZXW B;  2BOB C;  5C93 A;  4UV9 A;  3E8G A;  2QM8 A;  4N23 A;  1J95 A;  4R6Z A;  4GX5 A;  4P30 A;  5B1B B;  2DW4 A;  1WPX A;  1GKF A;  4EKW A;  4FK5 C;  4PEL A;  2DYS C;  1Y66 A;  4MVM A;  5H6R A;  4BIZ A;  1QVF U;  4HZ3 A;  3OW2 U;  3K06 A;  4MVS A;  5L3E A;  5B1B C;  3QO8 A;  1YTF B;  3JD4 A;  2DYS B;  4JAV A;  1RM1 C;  1YJW V;  1IXM A;  3QO5 A;  1JX9 A;  3EFF K;  4G27 B;  3ABM C;  4Q20 A;  3OMA B;  1AI4 A;  1V54 B;  5HFL A;  2JJ1 G;  4KFM A;  5KUK A;  3ZMZ A;  4Z1M G;  2WPD G;  3P32 A;  2AHZ A;  4U7O A;  4MTG A;  4CZZ A;  1RM1 B;  4U7N A;  4JAS A;  2UXN A;  2EIJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...