1ZX3A

Structure of ne0241 protein of unknown function from nitrosomonas europaea
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
b'EVQQPDPMRKNWIMENMDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLEETNTEYQNQQRKLRKTYIEYYDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein NE0241
publication title X-ray crystal structure of hypothetical protein NE0241 from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1020 Mainly Alpha Orthogonal Bundle Helix Hairpins NE0241-like 1zx3A01
1ZX3A
chains in the Genus database with same CATH superfamily
5J2UB 1M56B 1HNWB 2Q7EA 5KHJA 5GTHZ 2YEVB 4DV1B 1PL4A 3G6EV 3G80A 3JARB 3HKBA 1I7FA 5GONA 2Y4TA 4GZRB 3ZRWA 3RYHB 4DK1A 3AG3B 2Y0PA 3DTUB 1YJNV 3TETA 4WF9V 2GTSA 4DV2B 1OCRB 4NTWA 4LF9B 4B3RB 4WFHA 1DF4A 1SS3A 1Y74B 2GUZB 2FKXA 4OX9O 3I5DA 2WLLB 4BW9A 2VS0A 3UT5B 1GN2A 1S5LZ 5E79Z 3K06A 2WWWA 2CH7B 4UUJC 3A8TA 4LFBB 4J42A 2M7WA 4H44B 3THOA 3VQVA 1V54C 3JAWA 1F23A 1D5NA 2HKOA 4X88A 5EC2C 2QM8A 3FFQA 1EZJA 3CRCA 4FLXA 5D5PA 1OCOB 3L75H 4LH7A 4X89A 3OM3B 4FLVA 1NR1A 4DR5B 3EFFK 3MDSA 3RWRD 1AI4A 4PDMA 4FFBB 2Q0OC 2XUMA 5L3DA 3LDEA 3A0HZ 2Q0AA 3JAKB 5CB4B 4B7EA 1BL8A 1SQQH 2AGAA 4DV5B 2HEPA 3E22A 4J7ZA 5EZYA 4L8JA 1TGOA 2B1IA 1AROP 2QE7G 4B3MB 3LSSA 3KCXA 2ITCC 5IJ9A 5CMUA 3BVOA 1QCEA 3E8HA 1KC8W 3IFXA 3S3WA 1TVKB 2OIGA 3LDCA 1OCCC 4RWUA 1K4DC 3HKDA 3SYOA 4H33A 3ZX6A 2Z0AA 1SZTA 3NXSA 3ZN1A 1R6NA 3SPHA 2UU9O 3UO3A 4AQYO 1HNXO 2DYRC 2EBOA 3CMEV 3QG5A 1SQXH 1VARA 4DUYO 2HFEC 3ZRXA 5LP6B 3D36A 4JV5B 1L0NH 2BE3A 5EC1C 2JEXA 4FVMA 1XI1A 4DW1A 1LNQA 3ZMTA 3QO7A 4DV7O 3CC7V 4BAYA 1P84F 3ASNB 1RPOA 1ZWIC 4UB8Z 3CJHB 2EJRA 3PN1A 2ZE8A 3MD0A 3RBZA 3WB2A 1H2SB 3K9AA 2JJ2G 1GM8A 2OT5A 4AI8A 1WPBA 1I94B 1PD3A 2OCHA 4RQEA 2KG7A 1AB3A 1NH2D 1H38A 1SETA 3LUTB 4ZKIA 2GBOA 2DN9A 4LF6O 4DRXB 3CRAA 4UFZA 1M1KW 2CK3G 3L70H 4JAUA 1JFFB 3OGCC 1K34A 1I5YA 2Q4PA 3N2GA 3T1HB 3BPZA 1IVSA 1R1BA 3HKBB 5GONB 1RM1B 3ZRWB 2DYSB 5IY5C 1VF6C 3PJSK 1QHTA 4TV9A 2XNDG 2DQ3A 4PJ0Z 4LFCO 4ZBMA 4ZI7A 1KKDA 3ML0A 2Y4UA 3JATA 1WNSA 4XDJA 3ZBHA 3JD1A 2V1DA 3X2QC 1US6A 3HKCA 1HWYA 1PNLA 3APOA 4YXWG 4TWKA 3CS5A 3AK2A 1WP7A 4FK5C 1XMOB 1TUBA 4ZIBA 4WBNA 1N8RW 3ASOC 3J7AU 3JAWB 4JI0O 1R6TA 4MTGA 5L3GA 1KYOF 2IH1C 3T4ZA 1ORQC 4PD4F 2XT9A 3SYAA 3AG2B 3K57A 2IU0A 2A3QA 4OPHA 3L71H 3W7WA 4K0KB 2ZM6O 4DV3O 1Q81W 4RQFA 2VQFO 5LA6A 1EM1A 1SERA 2NR5A 5LHGA 4IL6Z 5LGNA 2Y48A 4TSFG 5JJEB 1JR9A 5LGUA 3E22B 2E74B 4I9WA 5EZYB 3I56V 4JI2B 4MVMA 4O4IA 1HDJA 2YXLA 5BZBA 4P9PA 2JGDA 4WFGA 1PKXA 5IJ9B 1FAFA 3G67A 2EILC 2UUAO 4DV4B 4KUMA 3HKDB 5HFMA 4DV0O 1Q6UA 5B1NA 1KUQA 5FNVA 1UPGA 1U96A 2QTOA 4IT5A 4FJCC 4BR6A 1QU7A 5IJ0A 2Q6AA 4R6ZA 2WA4A 4UV8A 1CP9A 3DC5A 4DR7O 3RYFA 3KZIZ 3OEHG 2BOBC 1FD9A 4HBNA 4JI3B 1YCIA 5KMGA 4PDRA 2JEUA 5KHKA 2QWPB 2LFSA 4UB6Z 5EIBD 4I7ZB 2ZXWB 5K1PA 4NXNO 2EZPA 5LOVA 4QNHB 4MVOA 5FL7G 1JOYA 4X66B 4FMTA 3H1JH 2ADPA 3L9DA 5JQGA 1I5XA 4R8CA 1GAXA 1WN7A 3B77A 2RNBA 1J5EO 4NYKA 3RVZA 5C8YA 4WFAV 5KHHA 4EFEA 3D3QA 2YIAA 3CCEV 1OV9A 1VQ5V 5B66Z 2V4DA 1OCZC 4P2ZA 1Z5WA 2ITDC 4N23A 1BZKA 3AG4C 1W59A 3IJ4A 4J10A 4JASA 2KG7B 2WAMA 1IBKO 1IBLO 2PYLA 5BY1A 2NN4A 4J80A 1QVGU 1R3KC 2QDOA 2AZ2A 1AILA 2R72A 1QBZA 2EIMC 2EIJC 2H8PC 1EN5A 2ZR2A 4UCOA 4O2AA 3CCRV 2Q7HA 3OUSA 1XL4A 1DK1A 1U97A 3D8CA 3ABMC 2RDCA 4OXSA 1K92A 3N2GB 2Y69C 3P30A 3KKYA 4MSWC 4LF4O 5H2FZ 2OCCB 1B6QA 4KFMA 3BCCH 1GN6A 3SJQC 4A5UB 3CCUV 1AJPA 1ZL8A 4JTAB 5BR8O 1OZ0A 5KX5A 3A0BZ 1GK9A 4TV9B 3N2KA 5J2TA 5LMUO 4ZI7B 1JA8A 3JATB 4DR4B 2VWKA 2P6JA 5BXZA 3RW0A 1A32A 2X7RB 3GWKC 4YIOA 2QJ1A 1V55C 2BTQA 1NVPD 3CB2A 2AHYA 3ABKB 1XDCA 4TOIA 1HNZB 3HKCB 3QVNA 1N34B 3CCJV 5IE9A 1N36B 4XDLA 1M9NA 1N33B 1P4RA 4UVCA 5DEDA 1TUBB 4FIPC 4U7OA 3H1KH 4WBNB 3BA8A 5D5QA 1M56C 3SYQA 4Z1MG 1BMFG 2QTSA 2XAGA 3RYIA 4B7KA 4X1KA 4JI4O 1NTKH 1Q82W 2EJ7A 5EYPA 1WB8A 3L72H 3QO5A 4CS4A 3CCLV 4X65O 1AP6A 5B1BB 3AG3C 1WPXA 2HJFC 2Q73A 3ICXA 4HYOA 4WCEV 1HW7A 3AG1B 4CC6A 4DR7B 5JCOA 5B5EZ 1VP7A 1K3EA 1OCRC 2E76B 2EULA 5IWAB 3K58A 1L0LH 2MW2B 3LNMB 4DR6O 5LA6B 2AW9A 1VEWA 1WA8A 4JYYA 3E8BA 3M99B 5EBLC 1M93A 1FJGO 3EVKA 2ARHA 4FPPA 1DGSA 5GTIZ 5JJJB 1NJIW 3QTCA 1KMIZ 3CXCU 1QVFU 3OAAG 4R50A 4O4IB 4YIPA 4D7TA 1G6UA 2R9IA 2GDSA 2JGDB 3BHPA 1P7BA 4PDVA 1YTFB 2F43G 1FKAO 4QPKA 1VQ9V 5KA5A 1ROPA 2UXBO 1OCOC 1OHHG 3ZEDA 1QLNA 5FNVB 1T5EA 2ETNA 1IURA 3O65A 1ZSPA 3F5TA 3AK1A 4XBFA 4GYCB 4J9YB 3P3PA 4X64O 4JI8O 3AK3A 2VQEB 2PTMA 5IJ0B 1Q7YW 1YVWA 2E5LB 2RJZA 3SYCA 4CZZA 1BHAA 2ZDIC 3RYFB 1WB7A 2DQ0A 1GM7A 4DUZO 2N04A 4BIOA 4JI5B 1Q43A 5KMGB 1QLEB 5FPRA 2BSKA 1VQ7V 3W7SA 1GO3F 4DR3B 5LOVB 2DJVA 1R3JC 3MAQA 1B3QA 4JI7O 4MVQA 4TQDA 1JMKC 3C3TA 4LF5O 5JQGB 3ZMUA 5LMUB 3F5WC 3OMIB 2ILMA 2JGUA 4LFAB 5H6RA 3HR0A 5C8YB 4KHPO 1VQNV 3BY6A 2HR3A 4B3TB 4QE9A 4JI6O 1NS1A 4JTDB 3H1IH 1SQPH 2F4VO 1F4MA 5A9GA 3G71V 1GN4A 3T1YB 1EBOA 4O2BA 4LF8B 1M57C 5LP6C 4G28B 3OW2U 3ABUA 2ZIMA 1L8DA 3SJCC 2ZE7A 4O2AB 5BMVA 1JCHA 4BIUA 2UUCO 4Q6GA 4X1YA 1XNQO 2UXNA 4JI4B 2YDEA 3OTOB 2H94A 1AR4A 2LW7A 5H9CA 2IJHA 4UV9A 5KAFZ 1JJOA 2F93B 2R9RB 2YXYA 3H1HH 1YEWA 2Y0IA 3E2EA 1ZL8B 1YITV 5KX5B 1XEQA 3N2KB 2GSMB 5J2TB 3JCUZ 4P9OA 3LSQA 4JGSA 1M5IA 2FYUH 4JYAB 1N0JA 4NR1A 3W7XA 2JIZG 1R73A 3FYIB 3SYPA 1HR0O 2BTQB 4JI1O 2XOKG 1CPYA 4UCVA 4Q20A 2K9PA 2Q7GA 2B9ZA 3K0DA 3OD4A 1TA8A 2QSAA 1SRYA 4JZ2A 1XHXA 2F95B 1PNMA 4RO2A 2V7QG 3ZCCA 4EEQA 5KUKA 5L3CA 3RYIB 1N32O 5LMNO 4GT1A 4GLXA 1TUEB 4ZOLA 4X1KB 3U0ZA 2X6AA 5EYPB 1RM1C 3E86A 3K59A 3OE7G 2ADQB 5DM6V 3SDLA 1VQ8V 3G6BA 1UFIA 2XAFA 2QA4V 3R65A 5B3SB 3WU2Z 2X6BA 1WJZA 1F7YA 1F51A 4IHJA 3RN4A 2PF4E 3T1CA 4X62O 3SPIA 4PA7A 1EFRG 3SR2C 4OX9B 3O9OA 3CMAV 3J80N 4JYCA 1YJ9V 4GKJO 1WA8B 4OGQB 4LNUA 1H2KA 4LF7O 1VF5B 1JJ2U 5DN6G 5KUMA 4P30A 1OCCB 1GH6A 4CBCA 3K5NA 3K04A 1W0JG 5CBGA 1R3IC 2N05A 3K3WA 4I50A 3VQWA 2OIEA 2CDYA 1MMMA 4YHHO 2DYRB 1VQPV 4LBEC 3CC2V 2XHBA 3IAYA 3WG7C 1VQ6V 1K97A 2EX3A 1H2LA 1JX9A 3BAAA 3TXSA 3IGAC 3TXQA 3OMAB 1KU9A 4DR1O 1F4NA 3T4DA 1KB9F 2IJIA 5EIBC 2CUGA 2Q68A 1VQLV 2RQ6A 2G38A 4ASUG 4CH6A 1LR1A 2YIBA 1NBMG 3AEIA 3LDDA 2QWNB 4RUFA 1IBMO 2Z3YA 3FB7C 2BSKB 2EZOA 3KG2A 1XBLA 4D7SA 4K35A 3W7UA 3CCQV 1XILA 3C3SA 1HP8A 5CBHA 3E35A 4DO2A 4I9QA 2CE4A 1BGYH 1M4UA 4TV8A 2L6LA 2H3OA 3E83A 2UU9B 4AQYB 1SESA 1HNXB 4FM0A 1W2BU 3K0GA 2IW5A 4DUYB 1Y76A 3HKEA 4GX2A 3RT3C 4GKKO 2YXHA 4O2BB 4DV6O 1DTOA 1AP5A 4NXMO 3D36C 1GM9A 3FKSG 5BMVB 4X1YB 2N74A 2LGQA 4GX5A 4DV7B 2ZXWC 4HZ3A 2DW4A 5L3FA 4ICGA 2PGGA 1Q6IA 5LYJA 3ABLC 3B4SA 3DGEA 2F23A 4G2KA 4K8XA 3QO8A 2ZD9A 2PYJA 2EIKB 4E4EA 3K5OA 4LP8A 4UCRA 3X2QB 1Y66A 3K79A 3OFNG 4FLYA 1O9GA 3CEIA 4MT8A 2ZE6A 1RFYA 2QWRB 4DR2O 1NQTA 2JVDA 3EHBB 4LF6B 1VF7A 1DLBA 5K1XA 2LJ2A 2ZR3A 3ASOB 1WAZA 3GWOA 3CSXA 2P22C 4GX0A 1O9HA 3ETQA 1BSMA 2QKSA 4F6RA 4MW3A 4O4JA 3SJBC 4TUYA 1J95A 1K7DA 1D5AA 4JF3A 4IIJA 3HPLC 2CAZC 1K5SA 4ZOLB 2OTLV 2ZNIA 3NR7A 2XAQA 4MVUA 4ABMA 2OCCC 1AVMA 1AR5A 4LFCB 2UXDO 4KXRA 4JPRA 1TAEA 3ZJZA 2LQTA 3B40A 5EBWC 1VQKV 2QKCA 4IHJB 1S72V 5IDJA 5IYZA 4CS3A 1Y4MA 2MK3A 2PZSA 2UUBO 2AXTZ 4YY3O 3ZMSA 2B5UA 4I4TA 2IU3A 1MG1A 1FXKC 4O4HA 4AILC 4LNUB 2HVKC 3ABKC 2UXCO 4UXNA 3RGBA 3CCVV 3VOUA 1BT8A 1IXBA 3H9VA 4DV1O 3FAVA 2RCVA 4NTXA 1KKCA 3STLC 1Z2GA 4JI0B 1RP3B 4I50B 4N21A 5KLVH 1DF5A 2EINB 4WFEA 4B08A 2KKWA 5C93A 3E89A 4DV2O 2OTJV 3DXRA 4LF9O 4PDLA 5KAIZ 4B3RO 1BE3H 4GCZA 2ZM6B 4DV3B 4DV6B 5H5NA 2YC0A 2VQFB 1NTZH 2O57A 5DECA 3QF7A 4G27B 4PV1B 3K5MA 4QPJA 3OUFA 1UJWB 3CCMV 4LFBO 4H0LB 4CS2A 1XOUA 3ZHUA 3ZHSA 3UM7A 1NTMH 1R6KA 4BW5A 1KD1W 1V9PA 3EXAA 5HFLA 2HLDG 2KSDA 4FZ1A 4I0XA 2M6YA 3B8MA 1K9MW 2UUAB 1S3JA 2P67A 4DW0A 1PP9H 2DE0X 2VRZA 4DV0B 1LUWA 3MHSC 4TV8B 3CPWU 2EIMB 4DR5O 3W7TA 2PI5A 1FFTB 3SGIA 4FLZA 2VWJA 1ZTEA 4WFBV 1E1RG 1KP2A 4TQFA 1BHBA 3SPCA 1Y76B 3HKEB 4YJ3A 1ZAUA 2Y69B 4JAVA 4J11A 2ODMA 2D2CB 4DV5O 4I5SA 1NU1H 5AG2A 3APQA 1BQZA 1URFA 1H2NA 5JVDA 3CHXA 4NXNB 3FYEB 2Q5ZA 1BQ0A 1QLEC 1NI8A 4QJFB 4B3MO 2HG5C 2FL4A 4K8ZA 4Z1VA 1KECA 2A7WA 4J7KA 1CEZA 4UCTA 3JALB 1E79G 1J5EB 5LYJB 4QGPA 1NT2B 2P90A 1YHQV 2ZT9B 1IX9A 1V55B 3P32A 1JPXA 4FLTA 2IH3C 2IM9A 4QE7A 4UCUA 1SKVA 5B1AB 3B09A 2GHYA 1IBKB 1IBLB 4TT3G 2IJJA 4JTCB 1THZA 2ATKC 4JV5O 5LGTA 3JD2A 1AJNA 3H1LH 1ENVA 1YXBA 4MVSA 2NNUA 3ZMZA 4F6RB 2YIDA 4UVAA 4O4JB 1W0KG 1MNGA 2QKAA 4TUYB 4LF4B 1YZBA 2RN9A 4IIJB 4GUNA 4W4LA 5BR8B 1YSCA 5CA1A 1AR1B 1SQFA 3ETDA 3FX7A 1S5JA 1PM9A 5H6QA 4KL1A 3FB8C 1I94O 1MSWD 2IBZH 1NZ6A 2DWDC 5IYZB 3L73H 2OWOA 2NLJC 1Q5OA 4QIWF 3JASA 3IC9A 1SA0A 4I4TB 4RUEA 1YTFD 2QWQB 4O4HB 2XAJA 1Q86W 2JDIG 3E8FA 1K5QA 3MHHC 1D2DA 3BRCA 1EN4A 2WSSG 3FAVB 1P49A 4PA4A 3T1HO 4F6EA 2HJDA 3ZS8C 4Z2WA 1VF6A 3U10A 4NKGB 2JJ1G 1G1XB 2K1EA 2W6JG 1M90W 2LGWA 2ZQMA 5EBMC 1SZXA 4X65B 1XNRO 2HVJC 3ZIAG 3AG7A 3DXRB 3ASNC 1MA1A 4MW8A 5CA3A 1QR8A 4J9ZB 4F4LA 5B3SC 1YF2A 3CRRA 5CBFA 3DC6A 5JCOC 4DR6B 3HB3B 1VQ4V 3GVMA 4CH5A 3C90A 1PPJH 2WLMA 4LWSA 4PHZA 4I55A 1ZLZA 1FJGB 1COWG 1V54B 3WB1A 5TISZ 1XMOO 2B1GA 4MS2A 1Q3EA 3RVYA 1NH2B 1FYJA 2C2AA 1S5HC 2YS8A 4X1IA 1SQVH 4C7UA 4I0XB 1FPOA 3SPGA 3KCYA 4IYHA 2UXBB 5ITZA 3CE2A 2RMKB 3TGUH 1NR7A 4U3JA 1M57B 3P3NA 1FS0G 5GW7A 3CYOA 2DYSC 1K4CC 4K0KO 4CH4A 2PUSA 4X64B 1N4CA 2CGOA 1K8AW 4JI8B 2P4KA 4H37A 4JAAA 1H2MA 4CC5A 1KBHA 4YJ3B 3ZMVA 3E8GA 4HNAA 5A2QN 4PI2A 1S76D 4DUZB 2X0LA 4MTFA 4BWAA 2D3OW 3ZN0A 1P7GA 4NTYA 1N0NA 2GV9A 4JYBA 5JVDB 3UQ8A 4JI2O 5CA0A 3CWBH 4EB6A 3CRQA 1SQGA 4JI7B 4LF5B 2LO1A 2QWOB 2QR4A 3FD9A 5IYCO 3CD6V 4PA9A 3J81N 1YDXA 2AHZA 1R3LC 4D6TH 3ZHQA 4DXWA 4DV4O 2L35A 3CX5F 4KHPB 5KHIA 4JI6B 3S3XA 3CXHF 1G8MA 5KA6A 1AJQA 1LUVA 4KP4A 3DSQA 3JSLA 2F4VB 3OR7C 1ZUQA 2F1MA 2JS3A 5LXTA 2BTOA 3U11A 3JAMN 3SPJA 1BCCH 2JS5A 3AG2C 4YJ2A 1SQBH 4JI3O 4MTOA 2IJKA 2UUCB 1FXHA 4PELA 1XNQB 1MSDA 2Q8VA 4GX1A 3UKMA 4RAIA 4X66O 3A0RA 1XUQA 3CP1A 4FM2A 5JWPA 1XNRB 1PNKA 3JSNA 3LSUA 2P7TC 3OMNB 4LCUC 4BIZA 3ZHVA 4NB5A 5CA1B 2A9HA 2YUAA 4XDKA 3TCUA 4B3SO 2EIKC 2QM4A 2DWEC 1FXKA 4NVPA 1GKFA 4X20A 1VMGA 4FZ0A 2WLJA 2XASA 1HR0B 4LR3A 2ZNJA 1RSOA 5FLXN 1H8HG 3JASB 1SF9A 1OJHA 4U3FH 1RPRA 4JI1B 1SA0B 4IGGA 1EZVH 4EFBA 4U7NA 2UXXA 3LNNA 4FM1A 1GRJA 3ETGA 4J41A 3OT7A 2QGNA 3VBBA 3JD0A 2AZ0A 3A2FA 1I0HA 3Q4HA 1Z5VA 1JQ0A 1XQ8A 5IY5B 3RFRA 3WG7B 1N32B 2F66C 5LMNB 2WLIA 3FB5C 3ZHRA 2Q67A 5JH7A 2Z5UA 3TJTA 3VQXA 2HHHO 4CH3A 3JALA 5KHGA 2A0LA 4UVBA 1EN6A 1KP3A 1VIBA 3JD3A 2X6CA 4DR4O 4O4LA 1YJWV 4K3AA 4X62B 1Q8IA 5L3BA 5LHHA 1FFXA 5LL6Y 2CGNA 3JYCA 4GKJB 2BOCC 5EK0A 1HNZO 1N34O 4LWSB 4I55B 3RYCA 1N36O 3GB7C 4LF7B 2YI9A 4ZHQA 1N33O 2WPDG 4PI0A 4FFKA 5J2UA 2YEVA 1MABG 1B06A 3M8AA 4MVRA 2W0FC 3JARA 3ZRVA 3FB6C 3F7VC 4H13B 4X1IB 3RYHA 1PL0A 4YHHB 1G4YB 2Q69A 5B1OA 4LH6A 3I55V 2PI4A 4EKWA 2KB1A 5ITZB 2EINC 1B04A 1Q6HA 2HP8A 1PV0A 4U3JB 5IWAO 2R70A 1Y74A 4MVZA 2GUZA 1Q90D 2XAHA 4JZGA 3T2MA 2WLLA 4DR1B 3BA9A 3M7MX 3UT5A 3OGIB 2ZKOA 3L74H 2CH7A 5J9PC 4HNAB 1MOFA 1XMQO 5IYDO 3B8NA 1GN3A 2CTRA 3ABLB 5JJNB 1IBMB 2LW1A 1YIJV 1NKDA 5CA0B 1SC5B 1K33A 4EB6B 5L3EA 1Y67A 5FPOA 4LC1A 1S77D 1NVPB 1HNWO 1KQSU 2EILB 4B3SB 2CTQA 1YI2V 3SJAC 2R9AA 1H8EG 4DYLA 4X9QA 1S0VA 2YI8A 2E3CA 4FLWA 4X8AA 2FMLA 2GTAA 3CC4V 4PA3A 4FFBA 2W6IG 2ZDIA 3R66A 2VQEO 5LXTB 4AHCA 1GTOA 2E5LO 5B1BC 1QR9A 4GKKB 4UCSA 2P4VA 3AG1C 1CXZB 3JAKA 4YJ2B 5CB4A 1AI6A 4NXMB 4JI5O 5LBQA 3B2EE 2WLHA 2UXCB 3STZC 2JK5C 2WA3A 4DR3O 1JVMA 3OTFA 4FLUA 5IT9N 3ZHTA 1H2GA 2QM7A 2HHHB 1QQCA 1XREA 4MTXA 2WLKA 2DMXA 5F2VO 2ZE5A 1GMGA 1E1QG 2W0XA 1TVKA 4HAMA 1X4TA 4LFAO 3TK1A 4R7CA 1VQMV 1X59A 1IZ3A 1OCZB 2LP7A 4B3TO 3K9SA 3UCSC 3G4SV 2Q9LA 3AG4B 4WFFA 1K73W 1FXKB 2ZINA 4X20B 1XL6A 1MZEA 1XHZA 3K08A 3BFRA 1BS3A 1ZX3A 2JRIA 2A06H 3H01A 3K03A 5LP6A 4DK0A 5B1AC 3CCSV 4DR2B 1RSOB 2EIJB 3T1YO 3ETEA 1IDSA 4LF8O 2YICA 2P06A 2ZCEA 3ABMB 2CTWA 4PA6A 5E1AC 1L1FA 1Y6XA 4W4KA 2CTPA 3D3IA 2A79B 3UO2A 2FB5A 4J7JA 2P5OA 2WLNA 3OTOO 1IXMA 2PY5A 3Q4HB 1QNMA 4E2LA 2BCCH 2LFRA 2QEXV 2WLIB 3CJHA 1MZFA 1WP8A 5JH7B 2E75B 2FTKA 2YSUB 2DOSA 2YIBD 2UXDB 3K5LA 3WB0A 1I08A 3OEEG 4JYAO 3BABA 4O4LB 5IYBO 3QNEA 1AI5A 1XMQB 1VQOV 4OPAA 2UUBB 3ZRSA 3F7YC 4IYIA 4YY3B 2ZIOA 1FFXB 3JD4A 5CN0A 3WFVA 4L87A 3CRMA 3VQYA 2KQXA 3JCZA 5LHIA 4DRXA 3N27A 3IC7A 1AI7A 3RYCB 3ABTA 4ZHQB 3BEHA 3OR6C 2XTAA 1JFFA 1FXVA 2OYQA 1WLEA
chains in the Genus database with same CATH topology
1ZX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX3 A; 
#chains in the Genus database with same CATH topology
 5J2U B;  1M56 B;  1HNW B;  2Q7E A;  5KHJ A;  5GTH Z;  2YEV B;  4DV1 B;  1PL4 A;  3G6E V;  3G80 A;  3JAR B;  3HKB A;  1I7F A;  5GON A;  2Y4T A;  4GZR B;  3ZRW A;  3RYH B;  4DK1 A;  3AG3 B;  2Y0P A;  3DTU B;  1YJN V;  3TET A;  4WF9 V;  2GTS A;  4DV2 B;  1OCR B;  4NTW A;  4LF9 B;  4B3R B;  4WFH A;  1DF4 A;  1SS3 A;  1Y74 B;  2GUZ B;  2FKX A;  4OX9 O;  3I5D A;  2WLL B;  4BW9 A;  2VS0 A;  3UT5 B;  1GN2 A;  1S5L Z;  5E79 Z;  3K06 A;  2WWW A;  2CH7 B;  4UUJ C;  3A8T A;  4LFB B;  4J42 A;  2M7W A;  4H44 B;  3THO A;  3VQV A;  1V54 C;  3JAW A;  1F23 A;  1D5N A;  2HKO A;  4X88 A;  5EC2 C;  2QM8 A;  3FFQ A;  1EZJ A;  3CRC A;  4FLX A;  5D5P A;  1OCO B;  3L75 H;  4LH7 A;  4X89 A;  3OM3 B;  4FLV A;  1NR1 A;  4DR5 B;  3EFF K;  3MDS A;  3RWR D;  1AI4 A;  4PDM A;  4FFB B;  2Q0O C;  2XUM A;  5L3D A;  3LDE A;  3A0H Z;  2Q0A A;  3JAK B;  5CB4 B;  4B7E A;  1BL8 A;  1SQQ H;  2AGA A;  4DV5 B;  2HEP A;  3E22 A;  4J7Z A;  5EZY A;  4L8J A;  1TGO A;  2B1I A;  1ARO P;  2QE7 G;  4B3M B;  3LSS A;  3KCX A;  2ITC C;  5IJ9 A;  5CMU A;  3BVO A;  1QCE A;  3E8H A;  1KC8 W;  3IFX A;  3S3W A;  1TVK B;  2OIG A;  3LDC A;  1OCC C;  4RWU A;  1K4D C;  3HKD A;  3SYO A;  4H33 A;  3ZX6 A;  2Z0A A;  1SZT A;  3NXS A;  3ZN1 A;  1R6N A;  3SPH A;  2UU9 O;  3UO3 A;  4AQY O;  1HNX O;  2DYR C;  2EBO A;  3CME V;  3QG5 A;  1SQX H;  1VAR A;  4DUY O;  2HFE C;  3ZRX A;  5LP6 B;  3D36 A;  4JV5 B;  1L0N H;  2BE3 A;  5EC1 C;  2JEX A;  4FVM A;  1XI1 A;  4DW1 A;  1LNQ A;  3ZMT A;  3QO7 A;  4DV7 O;  3CC7 V;  4BAY A;  1P84 F;  3ASN B;  1RPO A;  1ZWI C;  4UB8 Z;  3CJH B;  2EJR A;  3PN1 A;  2ZE8 A;  3MD0 A;  3RBZ A;  3WB2 A;  1H2S B;  3K9A A;  2JJ2 G;  1GM8 A;  2OT5 A;  4AI8 A;  1WPB A;  1I94 B;  1PD3 A;  2OCH A;  4RQE A;  2KG7 A;  1AB3 A;  1NH2 D;  1H38 A;  1SET A;  3LUT B;  4ZKI A;  2GBO A;  2DN9 A;  4LF6 O;  4DRX B;  3CRA A;  4UFZ A;  1M1K W;  2CK3 G;  3L70 H;  4JAU A;  1JFF B;  3OGC C;  1K34 A;  1I5Y A;  2Q4P A;  3N2G A;  3T1H B;  3BPZ A;  1IVS A;  1R1B A;  3HKB B;  5GON B;  1RM1 B;  3ZRW B;  2DYS B;  5IY5 C;  1VF6 C;  3PJS K;  1QHT A;  4TV9 A;  2XND G;  2DQ3 A;  4PJ0 Z;  4LFC O;  4ZBM A;  4ZI7 A;  1KKD A;  3ML0 A;  2Y4U A;  3JAT A;  1WNS A;  4XDJ A;  3ZBH A;  3JD1 A;  2V1D A;  3X2Q C;  1US6 A;  3HKC A;  1HWY A;  1PNL A;  3APO A;  4YXW G;  4TWK A;  3CS5 A;  3AK2 A;  1WP7 A;  4FK5 C;  1XMO B;  1TUB A;  4ZIB A;  4WBN A;  1N8R W;  3ASO C;  3J7A U;  3JAW B;  4JI0 O;  1R6T A;  4MTG A;  5L3G A;  1KYO F;  2IH1 C;  3T4Z A;  1ORQ C;  4PD4 F;  2XT9 A;  3SYA A;  3AG2 B;  3K57 A;  2IU0 A;  2A3Q A;  4OPH A;  3L71 H;  3W7W A;  4K0K B;  2ZM6 O;  4DV3 O;  1Q81 W;  4RQF A;  2VQF O;  5LA6 A;  1EM1 A;  1SER A;  2NR5 A;  5LHG A;  4IL6 Z;  5LGN A;  2Y48 A;  4TSF G;  5JJE B;  1JR9 A;  5LGU A;  3E22 B;  2E74 B;  4I9W A;  5EZY B;  3I56 V;  4JI2 B;  4MVM A;  4O4I A;  1HDJ A;  2YXL A;  5BZB A;  4P9P A;  2JGD A;  4WFG A;  1PKX A;  5IJ9 B;  1FAF A;  3G67 A;  2EIL C;  2UUA O;  4DV4 B;  4KUM A;  3HKD B;  5HFM A;  4DV0 O;  1Q6U A;  5B1N A;  1KUQ A;  5FNV A;  1UPG A;  1U96 A;  2QTO A;  4IT5 A;  4FJC C;  4BR6 A;  1QU7 A;  5IJ0 A;  2Q6A A;  4R6Z A;  2WA4 A;  4UV8 A;  1CP9 A;  3DC5 A;  4DR7 O;  3RYF A;  3KZI Z;  3OEH G;  2BOB C;  1FD9 A;  4HBN A;  4JI3 B;  1YCI A;  5KMG A;  4PDR A;  2JEU A;  5KHK A;  2QWP B;  2LFS A;  4UB6 Z;  5EIB D;  4I7Z B;  2ZXW B;  5K1P A;  4NXN O;  2EZP A;  5LOV A;  4QNH B;  4MVO A;  5FL7 G;  1JOY A;  4X66 B;  4FMT A;  3H1J H;  2ADP A;  3L9D A;  5JQG A;  1I5X A;  4R8C A;  1GAX A;  1WN7 A;  3B77 A;  2RNB A;  1J5E O;  4NYK A;  3RVZ A;  5C8Y A;  4WFA V;  5KHH A;  4EFE A;  3D3Q A;  2YIA A;  3CCE V;  1OV9 A;  1VQ5 V;  5B66 Z;  2V4D A;  1OCZ C;  4P2Z A;  1Z5W A;  2ITD C;  4N23 A;  1BZK A;  3AG4 C;  1W59 A;  3IJ4 A;  4J10 A;  4JAS A;  2KG7 B;  2WAM A;  1IBK O;  1IBL O;  2PYL A;  5BY1 A;  2NN4 A;  4J80 A;  1QVG U;  1R3K C;  2QDO A;  2AZ2 A;  1AIL A;  2R72 A;  1QBZ A;  2EIM C;  2EIJ C;  2H8P C;  1EN5 A;  2ZR2 A;  4UCO A;  4O2A A;  3CCR V;  2Q7H A;  3OUS A;  1XL4 A;  1DK1 A;  1U97 A;  3D8C A;  3ABM C;  2RDC A;  4OXS A;  1K92 A;  3N2G B;  2Y69 C;  3P30 A;  3KKY A;  4MSW C;  4LF4 O;  5H2F Z;  2OCC B;  1B6Q A;  4KFM A;  3BCC H;  1GN6 A;  3SJQ C;  4A5U B;  3CCU V;  1AJP A;  1ZL8 A;  4JTA B;  5BR8 O;  1OZ0 A;  5KX5 A;  3A0B Z;  1GK9 A;  4TV9 B;  3N2K A;  5J2T A;  5LMU O;  4ZI7 B;  1JA8 A;  3JAT B;  4DR4 B;  2VWK A;  2P6J A;  5BXZ A;  3RW0 A;  1A32 A;  2X7R B;  3GWK C;  4YIO A;  2QJ1 A;  1V55 C;  2BTQ A;  1NVP D;  3CB2 A;  2AHY A;  3ABK B;  1XDC A;  4TOI A;  1HNZ B;  3HKC B;  3QVN A;  1N34 B;  3CCJ V;  5IE9 A;  1N36 B;  4XDL A;  1M9N A;  1N33 B;  1P4R A;  4UVC A;  5DED A;  1TUB B;  4FIP C;  4U7O A;  3H1K H;  4WBN B;  3BA8 A;  5D5Q A;  1M56 C;  3SYQ A;  4Z1M G;  1BMF G;  2QTS A;  2XAG A;  3RYI A;  4B7K A;  4X1K A;  4JI4 O;  1NTK H;  1Q82 W;  2EJ7 A;  5EYP A;  1WB8 A;  3L72 H;  3QO5 A;  4CS4 A;  3CCL V;  4X65 O;  1AP6 A;  5B1B B;  3AG3 C;  1WPX A;  2HJF C;  2Q73 A;  3ICX A;  4HYO A;  4WCE V;  1HW7 A;  3AG1 B;  4CC6 A;  4DR7 B;  5JCO A;  5B5E Z;  1VP7 A;  1K3E A;  1OCR C;  2E76 B;  2EUL A;  5IWA B;  3K58 A;  1L0L H;  2MW2 B;  3LNM B;  4DR6 O;  5LA6 B;  2AW9 A;  1VEW A;  1WA8 A;  4JYY A;  3E8B A;  3M99 B;  5EBL C;  1M93 A;  1FJG O;  3EVK A;  2ARH A;  4FPP A;  1DGS A;  5GTI Z;  5JJJ B;  1NJI W;  3QTC A;  1KMI Z;  3CXC U;  1QVF U;  3OAA G;  4R50 A;  4O4I B;  4YIP A;  4D7T A;  1G6U A;  2R9I A;  2GDS A;  2JGD B;  3BHP A;  1P7B A;  4PDV A;  1YTF B;  2F43 G;  1FKA O;  4QPK A;  1VQ9 V;  5KA5 A;  1ROP A;  2UXB O;  1OCO C;  1OHH G;  3ZED A;  1QLN A;  5FNV B;  1T5E A;  2ETN A;  1IUR A;  3O65 A;  1ZSP A;  3F5T A;  3AK1 A;  4XBF A;  4GYC B;  4J9Y B;  3P3P A;  4X64 O;  4JI8 O;  3AK3 A;  2VQE B;  2PTM A;  5IJ0 B;  1Q7Y W;  1YVW A;  2E5L B;  2RJZ A;  3SYC A;  4CZZ A;  1BHA A;  2ZDI C;  3RYF B;  1WB7 A;  2DQ0 A;  1GM7 A;  4DUZ O;  2N04 A;  4BIO A;  4JI5 B;  1Q43 A;  5KMG B;  1QLE B;  5FPR A;  2BSK A;  1VQ7 V;  3W7S A;  1GO3 F;  4DR3 B;  5LOV B;  2DJV A;  1R3J C;  3MAQ A;  1B3Q A;  4JI7 O;  4MVQ A;  4TQD A;  1JMK C;  3C3T A;  4LF5 O;  5JQG B;  3ZMU A;  5LMU B;  3F5W C;  3OMI B;  2ILM A;  2JGU A;  4LFA B;  5H6R A;  3HR0 A;  5C8Y B;  4KHP O;  1VQN V;  3BY6 A;  2HR3 A;  4B3T B;  4QE9 A;  4JI6 O;  1NS1 A;  4JTD B;  3H1I H;  1SQP H;  2F4V O;  1F4M A;  5A9G A;  3G71 V;  1GN4 A;  3T1Y B;  1EBO A;  4O2B A;  4LF8 B;  1M57 C;  5LP6 C;  4G28 B;  3OW2 U;  3ABU A;  2ZIM A;  1L8D A;  3SJC C;  2ZE7 A;  4O2A B;  5BMV A;  1JCH A;  4BIU A;  2UUC O;  4Q6G A;  4X1Y A;  1XNQ O;  2UXN A;  4JI4 B;  2YDE A;  3OTO B;  2H94 A;  1AR4 A;  2LW7 A;  5H9C A;  2IJH A;  4UV9 A;  5KAF Z;  1JJO A;  2F93 B;  2R9R B;  2YXY A;  3H1H H;  1YEW A;  2Y0I A;  3E2E A;  1ZL8 B;  1YIT V;  5KX5 B;  1XEQ A;  3N2K B;  2GSM B;  5J2T B;  3JCU Z;  4P9O A;  3LSQ A;  4JGS A;  1M5I A;  2FYU H;  4JYA B;  1N0J A;  4NR1 A;  3W7X A;  2JIZ G;  1R73 A;  3FYI B;  3SYP A;  1HR0 O;  2BTQ B;  4JI1 O;  2XOK G;  1CPY A;  4UCV A;  4Q20 A;  2K9P A;  2Q7G A;  2B9Z A;  3K0D A;  3OD4 A;  1TA8 A;  2QSA A;  1SRY A;  4JZ2 A;  1XHX A;  2F95 B;  1PNM A;  4RO2 A;  2V7Q G;  3ZCC A;  4EEQ A;  5KUK A;  5L3C A;  3RYI B;  1N32 O;  5LMN O;  4GT1 A;  4GLX A;  1TUE B;  4ZOL A;  4X1K B;  3U0Z A;  2X6A A;  5EYP B;  1RM1 C;  3E86 A;  3K59 A;  3OE7 G;  2ADQ B;  5DM6 V;  3SDL A;  1VQ8 V;  3G6B A;  1UFI A;  2XAF A;  2QA4 V;  3R65 A;  5B3S B;  3WU2 Z;  2X6B A;  1WJZ A;  1F7Y A;  1F51 A;  4IHJ A;  3RN4 A;  2PF4 E;  3T1C A;  4X62 O;  3SPI A;  4PA7 A;  1EFR G;  3SR2 C;  4OX9 B;  3O9O A;  3CMA V;  3J80 N;  4JYC A;  1YJ9 V;  4GKJ O;  1WA8 B;  4OGQ B;  4LNU A;  1H2K A;  4LF7 O;  1VF5 B;  1JJ2 U;  5DN6 G;  5KUM A;  4P30 A;  1OCC B;  1GH6 A;  4CBC A;  3K5N A;  3K04 A;  1W0J G;  5CBG A;  1R3I C;  2N05 A;  3K3W A;  4I50 A;  3VQW A;  2OIE A;  2CDY A;  1MMM A;  4YHH O;  2DYR B;  1VQP V;  4LBE C;  3CC2 V;  2XHB A;  3IAY A;  3WG7 C;  1VQ6 V;  1K97 A;  2EX3 A;  1H2L A;  1JX9 A;  3BAA A;  3TXS A;  3IGA C;  3TXQ A;  3OMA B;  1KU9 A;  4DR1 O;  1F4N A;  3T4D A;  1KB9 F;  2IJI A;  5EIB C;  2CUG A;  2Q68 A;  1VQL V;  2RQ6 A;  2G38 A;  4ASU G;  4CH6 A;  1LR1 A;  2YIB A;  1NBM G;  3AEI A;  3LDD A;  2QWN B;  4RUF A;  1IBM O;  2Z3Y A;  3FB7 C;  2BSK B;  2EZO A;  3KG2 A;  1XBL A;  4D7S A;  4K35 A;  3W7U A;  3CCQ V;  1XIL A;  3C3S A;  1HP8 A;  5CBH A;  3E35 A;  4DO2 A;  4I9Q A;  2CE4 A;  1BGY H;  1M4U A;  4TV8 A;  2L6L A;  2H3O A;  3E83 A;  2UU9 B;  4AQY B;  1SES A;  1HNX B;  4FM0 A;  1W2B U;  3K0G A;  2IW5 A;  4DUY B;  1Y76 A;  3HKE A;  4GX2 A;  3RT3 C;  4GKK O;  2YXH A;  4O2B B;  4DV6 O;  1DTO A;  1AP5 A;  4NXM O;  3D36 C;  1GM9 A;  3FKS G;  5BMV B;  4X1Y B;  2N74 A;  2LGQ A;  4GX5 A;  4DV7 B;  2ZXW C;  4HZ3 A;  2DW4 A;  5L3F A;  4ICG A;  2PGG A;  1Q6I A;  5LYJ A;  3ABL C;  3B4S A;  3DGE A;  2F23 A;  4G2K A;  4K8X A;  3QO8 A;  2ZD9 A;  2PYJ A;  2EIK B;  4E4E A;  3K5O A;  4LP8 A;  4UCR A;  3X2Q B;  1Y66 A;  3K79 A;  3OFN G;  4FLY A;  1O9G A;  3CEI A;  4MT8 A;  2ZE6 A;  1RFY A;  2QWR B;  4DR2 O;  1NQT A;  2JVD A;  3EHB B;  4LF6 B;  1VF7 A;  1DLB A;  5K1X A;  2LJ2 A;  2ZR3 A;  3ASO B;  1WAZ A;  3GWO A;  3CSX A;  2P22 C;  4GX0 A;  1O9H A;  3ETQ A;  1BSM A;  2QKS A;  4F6R A;  4MW3 A;  4O4J A;  3SJB C;  4TUY A;  1J95 A;  1K7D A;  1D5A A;  4JF3 A;  4IIJ A;  3HPL C;  2CAZ C;  1K5S A;  4ZOL B;  2OTL V;  2ZNI A;  3NR7 A;  2XAQ A;  4MVU A;  4ABM A;  2OCC C;  1AVM A;  1AR5 A;  4LFC B;  2UXD O;  4KXR A;  4JPR A;  1TAE A;  3ZJZ A;  2LQT A;  3B40 A;  5EBW C;  1VQK V;  2QKC A;  4IHJ B;  1S72 V;  5IDJ A;  5IYZ A;  4CS3 A;  1Y4M A;  2MK3 A;  2PZS A;  2UUB O;  2AXT Z;  4YY3 O;  3ZMS A;  2B5U A;  4I4T A;  2IU3 A;  1MG1 A;  1FXK C;  4O4H A;  4AIL C;  4LNU B;  2HVK C;  3ABK C;  2UXC O;  4UXN A;  3RGB A;  3CCV V;  3VOU A;  1BT8 A;  1IXB A;  3H9V A;  4DV1 O;  3FAV A;  2RCV A;  4NTX A;  1KKC A;  3STL C;  1Z2G A;  4JI0 B;  1RP3 B;  4I50 B;  4N21 A;  5KLV H;  1DF5 A;  2EIN B;  4WFE A;  4B08 A;  2KKW A;  5C93 A;  3E89 A;  4DV2 O;  2OTJ V;  3DXR A;  4LF9 O;  4PDL A;  5KAI Z;  4B3R O;  1BE3 H;  4GCZ A;  2ZM6 B;  4DV3 B;  4DV6 B;  5H5N A;  2YC0 A;  2VQF B;  1NTZ H;  2O57 A;  5DEC A;  3QF7 A;  4G27 B;  4PV1 B;  3K5M A;  4QPJ A;  3OUF A;  1UJW B;  3CCM V;  4LFB O;  4H0L B;  4CS2 A;  1XOU A;  3ZHU A;  3ZHS A;  3UM7 A;  1NTM H;  1R6K A;  4BW5 A;  1KD1 W;  1V9P A;  3EXA A;  5HFL A;  2HLD G;  2KSD A;  4FZ1 A;  4I0X A;  2M6Y A;  3B8M A;  1K9M W;  2UUA B;  1S3J A;  2P67 A;  4DW0 A;  1PP9 H;  2DE0 X;  2VRZ A;  4DV0 B;  1LUW A;  3MHS C;  4TV8 B;  3CPW U;  2EIM B;  4DR5 O;  3W7T A;  2PI5 A;  1FFT B;  3SGI A;  4FLZ A;  2VWJ A;  1ZTE A;  4WFB V;  1E1R G;  1KP2 A;  4TQF A;  1BHB A;  3SPC A;  1Y76 B;  3HKE B;  4YJ3 A;  1ZAU A;  2Y69 B;  4JAV A;  4J11 A;  2ODM A;  2D2C B;  4DV5 O;  4I5S A;  1NU1 H;  5AG2 A;  3APQ A;  1BQZ A;  1URF A;  1H2N A;  5JVD A;  3CHX A;  4NXN B;  3FYE B;  2Q5Z A;  1BQ0 A;  1QLE C;  1NI8 A;  4QJF B;  4B3M O;  2HG5 C;  2FL4 A;  4K8Z A;  4Z1V A;  1KEC A;  2A7W A;  4J7K A;  1CEZ A;  4UCT A;  3JAL B;  1E79 G;  1J5E B;  5LYJ B;  4QGP A;  1NT2 B;  2P90 A;  1YHQ V;  2ZT9 B;  1IX9 A;  1V55 B;  3P32 A;  1JPX A;  4FLT A;  2IH3 C;  2IM9 A;  4QE7 A;  4UCU A;  1SKV A;  5B1A B;  3B09 A;  2GHY A;  1IBK B;  1IBL B;  4TT3 G;  2IJJ A;  4JTC B;  1THZ A;  2ATK C;  4JV5 O;  5LGT A;  3JD2 A;  1AJN A;  3H1L H;  1ENV A;  1YXB A;  4MVS A;  2NNU A;  3ZMZ A;  4F6R B;  2YID A;  4UVA A;  4O4J B;  1W0K G;  1MNG A;  2QKA A;  4TUY B;  4LF4 B;  1YZB A;  2RN9 A;  4IIJ B;  4GUN A;  4W4L A;  5BR8 B;  1YSC A;  5CA1 A;  1AR1 B;  1SQF A;  3ETD A;  3FX7 A;  1S5J A;  1PM9 A;  5H6Q A;  4KL1 A;  3FB8 C;  1I94 O;  1MSW D;  2IBZ H;  1NZ6 A;  2DWD C;  5IYZ B;  3L73 H;  2OWO A;  2NLJ C;  1Q5O A;  4QIW F;  3JAS A;  3IC9 A;  1SA0 A;  4I4T B;  4RUE A;  1YTF D;  2QWQ B;  4O4H B;  2XAJ A;  1Q86 W;  2JDI G;  3E8F A;  1K5Q A;  3MHH C;  1D2D A;  3BRC A;  1EN4 A;  2WSS G;  3FAV B;  1P49 A;  4PA4 A;  3T1H O;  4F6E A;  2HJD A;  3ZS8 C;  4Z2W A;  1VF6 A;  3U10 A;  4NKG B;  2JJ1 G;  1G1X B;  2K1E A;  2W6J G;  1M90 W;  2LGW A;  2ZQM A;  5EBM C;  1SZX A;  4X65 B;  1XNR O;  2HVJ C;  3ZIA G;  3AG7 A;  3DXR B;  3ASN C;  1MA1 A;  4MW8 A;  5CA3 A;  1QR8 A;  4J9Z B;  4F4L A;  5B3S C;  1YF2 A;  3CRR A;  5CBF A;  3DC6 A;  5JCO C;  4DR6 B;  3HB3 B;  1VQ4 V;  3GVM A;  4CH5 A;  3C90 A;  1PPJ H;  2WLM A;  4LWS A;  4PHZ A;  4I55 A;  1ZLZ A;  1FJG B;  1COW G;  1V54 B;  3WB1 A;  5TIS Z;  1XMO O;  2B1G A;  4MS2 A;  1Q3E A;  3RVY A;  1NH2 B;  1FYJ A;  2C2A A;  1S5H C;  2YS8 A;  4X1I A;  1SQV H;  4C7U A;  4I0X B;  1FPO A;  3SPG A;  3KCY A;  4IYH A;  2UXB B;  5ITZ A;  3CE2 A;  2RMK B;  3TGU H;  1NR7 A;  4U3J A;  1M57 B;  3P3N A;  1FS0 G;  5GW7 A;  3CYO A;  2DYS C;  1K4C C;  4K0K O;  4CH4 A;  2PUS A;  4X64 B;  1N4C A;  2CGO A;  1K8A W;  4JI8 B;  2P4K A;  4H37 A;  4JAA A;  1H2M A;  4CC5 A;  1KBH A;  4YJ3 B;  3ZMV A;  3E8G A;  4HNA A;  5A2Q N;  4PI2 A;  1S76 D;  4DUZ B;  2X0L A;  4MTF A;  4BWA A;  2D3O W;  3ZN0 A;  1P7G A;  4NTY A;  1N0N A;  2GV9 A;  4JYB A;  5JVD B;  3UQ8 A;  4JI2 O;  5CA0 A;  3CWB H;  4EB6 A;  3CRQ A;  1SQG A;  4JI7 B;  4LF5 B;  2LO1 A;  2QWO B;  2QR4 A;  3FD9 A;  5IYC O;  3CD6 V;  4PA9 A;  3J81 N;  1YDX A;  2AHZ A;  1R3L C;  4D6T H;  3ZHQ A;  4DXW A;  4DV4 O;  2L35 A;  3CX5 F;  4KHP B;  5KHI A;  4JI6 B;  3S3X A;  3CXH F;  1G8M A;  5KA6 A;  1AJQ A;  1LUV A;  4KP4 A;  3DSQ A;  3JSL A;  2F4V B;  3OR7 C;  1ZUQ A;  2F1M A;  2JS3 A;  5LXT A;  2BTO A;  3U11 A;  3JAM N;  3SPJ A;  1BCC H;  2JS5 A;  3AG2 C;  4YJ2 A;  1SQB H;  4JI3 O;  4MTO A;  2IJK A;  2UUC B;  1FXH A;  4PEL A;  1XNQ B;  1MSD A;  2Q8V A;  4GX1 A;  3UKM A;  4RAI A;  4X66 O;  3A0R A;  1XUQ A;  3CP1 A;  4FM2 A;  5JWP A;  1XNR B;  1PNK A;  3JSN A;  3LSU A;  2P7T C;  3OMN B;  4LCU C;  4BIZ A;  3ZHV A;  4NB5 A;  5CA1 B;  2A9H A;  2YUA A;  4XDK A;  3TCU A;  4B3S O;  2EIK C;  2QM4 A;  2DWE C;  1FXK A;  4NVP A;  1GKF A;  4X20 A;  1VMG A;  4FZ0 A;  2WLJ A;  2XAS A;  1HR0 B;  4LR3 A;  2ZNJ A;  1RSO A;  5FLX N;  1H8H G;  3JAS B;  1SF9 A;  1OJH A;  4U3F H;  1RPR A;  4JI1 B;  1SA0 B;  4IGG A;  1EZV H;  4EFB A;  4U7N A;  2UXX A;  3LNN A;  4FM1 A;  1GRJ A;  3ETG A;  4J41 A;  3OT7 A;  2QGN A;  3VBB A;  3JD0 A;  2AZ0 A;  3A2F A;  1I0H A;  3Q4H A;  1Z5V A;  1JQ0 A;  1XQ8 A;  5IY5 B;  3RFR A;  3WG7 B;  1N32 B;  2F66 C;  5LMN B;  2WLI A;  3FB5 C;  3ZHR A;  2Q67 A;  5JH7 A;  2Z5U A;  3TJT A;  3VQX A;  2HHH O;  4CH3 A;  3JAL A;  5KHG A;  2A0L A;  4UVB A;  1EN6 A;  1KP3 A;  1VIB A;  3JD3 A;  2X6C A;  4DR4 O;  4O4L A;  1YJW V;  4K3A A;  4X62 B;  1Q8I A;  5L3B A;  5LHH A;  1FFX A;  5LL6 Y;  2CGN A;  3JYC A;  4GKJ B;  2BOC C;  5EK0 A;  1HNZ O;  1N34 O;  4LWS B;  4I55 B;  3RYC A;  1N36 O;  3GB7 C;  4LF7 B;  2YI9 A;  4ZHQ A;  1N33 O;  2WPD G;  4PI0 A;  4FFK A;  5J2U A;  2YEV A;  1MAB G;  1B06 A;  3M8A A;  4MVR A;  2W0F C;  3JAR A;  3ZRV A;  3FB6 C;  3F7V C;  4H13 B;  4X1I B;  3RYH A;  1PL0 A;  4YHH B;  1G4Y B;  2Q69 A;  5B1O A;  4LH6 A;  3I55 V;  2PI4 A;  4EKW A;  2KB1 A;  5ITZ B;  2EIN C;  1B04 A;  1Q6H A;  2HP8 A;  1PV0 A;  4U3J B;  5IWA O;  2R70 A;  1Y74 A;  4MVZ A;  2GUZ A;  1Q90 D;  2XAH A;  4JZG A;  3T2M A;  2WLL A;  4DR1 B;  3BA9 A;  3M7M X;  3UT5 A;  3OGI B;  2ZKO A;  3L74 H;  2CH7 A;  5J9P C;  4HNA B;  1MOF A;  1XMQ O;  5IYD O;  3B8N A;  1GN3 A;  2CTR A;  3ABL B;  5JJN B;  1IBM B;  2LW1 A;  1YIJ V;  1NKD A;  5CA0 B;  1SC5 B;  1K33 A;  4EB6 B;  5L3E A;  1Y67 A;  5FPO A;  4LC1 A;  1S77 D;  1NVP B;  1HNW O;  1KQS U;  2EIL B;  4B3S B;  2CTQ A;  1YI2 V;  3SJA C;  2R9A A;  1H8E G;  4DYL A;  4X9Q A;  1S0V A;  2YI8 A;  2E3C A;  4FLW A;  4X8A A;  2FML A;  2GTA A;  3CC4 V;  4PA3 A;  4FFB A;  2W6I G;  2ZDI A;  3R66 A;  2VQE O;  5LXT B;  4AHC A;  1GTO A;  2E5L O;  5B1B C;  1QR9 A;  4GKK B;  4UCS A;  2P4V A;  3AG1 C;  1CXZ B;  3JAK A;  4YJ2 B;  5CB4 A;  1AI6 A;  4NXM B;  4JI5 O;  5LBQ A;  3B2E E;  2WLH A;  2UXC B;  3STZ C;  2JK5 C;  2WA3 A;  4DR3 O;  1JVM A;  3OTF A;  4FLU A;  5IT9 N;  3ZHT A;  1H2G A;  2QM7 A;  2HHH B;  1QQC A;  1XRE A;  4MTX A;  2WLK A;  2DMX A;  5F2V O;  2ZE5 A;  1GMG A;  1E1Q G;  2W0X A;  1TVK A;  4HAM A;  1X4T A;  4LFA O;  3TK1 A;  4R7C A;  1VQM V;  1X59 A;  1IZ3 A;  1OCZ B;  2LP7 A;  4B3T O;  3K9S A;  3UCS C;  3G4S V;  2Q9L A;  3AG4 B;  4WFF A;  1K73 W;  1FXK B;  2ZIN A;  4X20 B;  1XL6 A;  1MZE A;  1XHZ A;  3K08 A;  3BFR A;  1BS3 A;  1ZX3 A;  2JRI A;  2A06 H;  3H01 A;  3K03 A;  5LP6 A;  4DK0 A;  5B1A C;  3CCS V;  4DR2 B;  1RSO B;  2EIJ B;  3T1Y O;  3ETE A;  1IDS A;  4LF8 O;  2YIC A;  2P06 A;  2ZCE A;  3ABM B;  2CTW A;  4PA6 A;  5E1A C;  1L1F A;  1Y6X A;  4W4K A;  2CTP A;  3D3I A;  2A79 B;  3UO2 A;  2FB5 A;  4J7J A;  2P5O A;  2WLN A;  3OTO O;  1IXM A;  2PY5 A;  3Q4H B;  1QNM A;  4E2L A;  2BCC H;  2LFR A;  2QEX V;  2WLI B;  3CJH A;  1MZF A;  1WP8 A;  5JH7 B;  2E75 B;  2FTK A;  2YSU B;  2DOS A;  2YIB D;  2UXD B;  3K5L A;  3WB0 A;  1I08 A;  3OEE G;  4JYA O;  3BAB A;  4O4L B;  5IYB O;  3QNE A;  1AI5 A;  1XMQ B;  1VQO V;  4OPA A;  2UUB B;  3ZRS A;  3F7Y C;  4IYI A;  4YY3 B;  2ZIO A;  1FFX B;  3JD4 A;  5CN0 A;  3WFV A;  4L87 A;  3CRM A;  3VQY A;  2KQX A;  3JCZ A;  5LHI A;  4DRX A;  3N27 A;  3IC7 A;  1AI7 A;  3RYC B;  3ABT A;  4ZHQ B;  3BEH A;  3OR6 C;  2XTA A;  1JFF A;  1FXV A;  2OYQ A;  1WLE A; 
#chains in the Genus database with same CATH homology
 1ZX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...