1ZX3A

Structure of ne0241 protein of unknown function from nitrosomonas europaea
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
EVQQPDPMRKNWIMENMDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLEETNTEYQNQQRKLRKTYIEYYDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein NE0241
publication title X-ray crystal structure of hypothetical protein NE0241 from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1020 Mainly Alpha Orthogonal Bundle Helix Hairpins NE0241-like 1zx3A01
1ZX3A
chains in the Genus database with same CATH superfamily
2RCVA 4DV7O 3E8GA 1XQ8A 3WFVA 3OMNB 4UCVA 3SPIA 4JI2B 1MOFA 1WP7A 4JI4B 3OFNG 3JALB 3G71V 4BWAA 1I94O 3IAYA 3G6EV 5CMUA 4JYCA 1AJPA 2KSDA 1FKAO 4ZBMA 4CH6A 1VQ5V 2YIBD 1ZLZA 3E22A 1IBKO 4H37A 5BY1A 1GH6A 3M8AA 1COWG 5CA3A 3JSLA 1FS0G 5CA1B 1H2KA 4UV9A 4PA6A 5H2FZ 1JOYA 1K5SA 3VBBA 4PDMA 4F6RB 1LNQA 1VQKV 4W4KA 2VQFB 4B3TB 4YHHB 5IDJA 1R73A 2OCCB 2FYUH 3SGIA 4PELA 2VQEO 5JJJB 1YTFB 2P06A 4WF9V 2G38A 1JPXA 4LF7B 3P3NA 4NR1A 1OCCB 1SKVA 3BFRA 3SR2C 3QO8A 3LNNA 2ZDIC 2EIJB 4TUYA 3JCZA 4DUYO 4DV3O 1DTOA 3CCJV 2P7TC 2E3CA 4LH7A 4CH4A 4GLXA 4FLUA 4X88A 2ZM6B 2Q7HA 2R9RB 4JZ2A 2JS3A 3ZN1A 2ZQMA 3LSQA 4O4JA 3JAWA 2B5UA 3E22B 1IBLO 1ZX3A 1GO3F 2JJ2G 4QIWF 1OZ0A 3DXRA 4K35A 3TJTA 3K08A 4ZOLA 1MZEA 4AILC 3OUFA 1HP8A 1QQCA 1VQ4V 4DR5O 2V7QG 5L3DA 3K03A 5B1AC 3SYOA 3P32A 2QA4V 4DV5O 4F6EA 4JF3A 4BW5A 1XL4A 1VEWA 2L35A 1TGOA 2A7WA 1KP3A 2BOCC 3OTFA 2IJHA 1KU9A 2PZSA 5EIBD 2QGNA 1XMOO 3O65A 4X89A 4TUYB 4B3MO 3VQYA 4YIOA 1V9PA 2YXHA 1FXVA 4BW9A 1SQGA 3CJHA 2RJZA 1IXBA 4I9QA 2Y4TA 2Y0PA 2UUAB 1N36O 4AQYO 2EIMB 1I0HA 4CBCA 1FAFA 1KB9F 2OIGA 3ZJZA 1BSMA 4W4LA 2QEXV 3CRRA 4O4JB 3B77A 4QE7A 5IJ9A 2F66C 3SDLA 4TOIA 4CZZA 3ABMC 4TV8A 3B8NA 4LR3A 4OX9B 4MVSA 5C93A 4WFBV 2F95B 2JIZG 3EFFK 3DXRB 2VRZA 4KUMA 2WLIA 4Z1MG 4ZOLB 2JEUA 1IVSA 1H2NA 3CYOA 1RM1B 1V54C 5LA6A 4OGQB 5LHHA 2LJ2A 2BTOA 2UXBO 2Y4UA 1PKXA 3F5TA 1VF6C 1YZBA 3D3QA 2CAZC 3AG2B 2EIKB 4JYYA 2PI4A 2QKCA 3SJBC 3BRCA 1BZKA 3ZX6A 3ASOB 4QPKA 3CJHB 5EK0A 4I50A 4DR2B 3H1HH 4EFEA 1S72V 1VMGA 1YDXA 2KG7A 3ZEDA 2OT5A 2YI8A 5IWAB 3ZRXA 3B8MA 4J9ZB 1EFRG 5A9GA 5IJ9B 1MSDA 1Y6XA 5GW7A 1LUVA 4B3RB 1J5EB 4YJ3A 4JI8B 3ZN0A 4TV8B 4ZI7B 4J10A 1VF5B 3O9OA 1R6TA 1D5AA 1SA0A 4J80A 3T1YB 2WLJA 1TA8A 4LNUA 4MVZA 5JJNB 2Y69B 4B3SB 2KQXA 4I55A 3TGUH 1GAXA 3CEIA 3OMAB 3LDEA 3FYEB 5EIBC 3ZCCA 5LA6B 3L72H 3CCMV 3QG5A 1H2LA 5IYDO 1HW7A 3K0DA 3KG2A 3LNMB 1WJZA 2XAGA 1Y67A 5K1PA 3KZIZ 1N33B 1NS1A 1JA8A 4ZHQA 3BABA 1TVKA 1M9NA 1Q43A 4X1IA 1NTMH 3ETDA 2R9IA 4JI4O 1XUQA 2QSAA 2C2AA 1PM9A 1GMGA 1YF2A 4DV4B 5CA0A 4I50B 1FXKC 1HNWB 1IDSA 2LW1A 5GTIZ 3ZHQA 2KG7B 4JTCB 4WBNA 1KECA 5D5PA 1AI5A 2R9AA 3OGCC 4AHCA 1NJIW 2UUBB 2AXTZ 4TV9A 2YXLA 1NU1H 3JASA 4KL1A 2YIBA 4YJ3B 1J95A 5EBLC 5B1OA 2ATKC 3K79A 1SA0B 4LNUB 1YXBA 1U96A 2VQFO 2WA3A 4OXSA 1OCRB 4YHHO 4I55B 5D5QA 2ZD9A 1Q6HA 4K8XA 1K34A 4J7KA 3IJ4A 4JI3B 5KMGA 2Q68A 1WNSA 4LF7O 3NXSA 3VQWA 1B06A 1VP7A 2QM7A 4TWKA 1W0KG 2QTSA 1XOUA 1B6QA 1E1RG 4ZHQB 3N2KA 1TVKB 1DLBA 4X1IB 2ARHA 2UUCB 3G67A 1F4MA 1GM9A 3GVMA 3TK1A 5JJEB 5CA0B 2QWRB 1IURA 3HKEA 4WBNB 1WPBA 4FLYA 2XHBA 2JJ1G 4JYBA 4F4LA 4TV9B 5B3SC 4MVOA 1VARA 2LFSA 2JRIA 3I5DA 1G4YB 3JASB 5LP6C 4X1YA 4CC5A 3SYAA 1L1FA 2Q0AA 4GZRB 3JD1A 2OCHA 5JWPA 4J42A 3F5WC 3IC9A 2XNDG 3ZBHA 2UXDB 5B66Z 3BAAA 1LUWA 3FYIB 3R66A 4HZ3A 4H13B 3ABMB 2H3OA 2P5OA 3E86A 3CSXA 3CD6V 4FK5C 3MAQA 4JI5B 1K4CC 2Q0OC 2P4VA 2ZE8A 2F93B 3ASNB 3N2KB 4I5SA 1GRJA 1OCZB 1XHXA 4PA4A 4I7ZB 2Y48A 1BMFG 1F23A 2HLDG 1V55C 1SQFA 4LF9B 2YEVA 3DGEA 3HKEB 3UO3A 4MVMA 3SJCC 3K9AA 5E79Z 3K5MA 1TUEB 2FL4A 4FZ1A 1N0JA 2N04A 3B09A 4X1YB 2Q4PA 2W0XA 4UCTA 1FXKA 2IU3A 1YJWV 3FD9A 4HBNA 3ZHUA 3RW0A 1K8AW 3X2QC 2GDSA 1ENVA 3FX7A 4DV1B 2PUSA 5CBFA 5KA6A 1Y4MA 1AP6A 1ZSPA 4GCZA 2KB1A 3A0HZ 4N21A 1WB8A 4XDLA 3T1HB 5LOVA 4E2LA 1JJOA 1WAZA 4P2ZA 5DECA 1BT8A 3W7TA 1H8HG 3ZMZA 3ZRVA 2DE0X 4JYAB 2YXYA 1NI8A 1JCHA 3UCSC 4MT8A 2WPDG 3FB5C 4DR2O 2Q67A 3P30A 3BY6A 1B04A 4LH6A 5IWAO 1AB3A 5FLXN 3ABLC 4NKGB 2YEVB 2HJFC 1XILA 3WG7C 2JGUA 1NR1A 1J5EO 1TUBA 3RBZA 1AR1B 5LL6Y 2CTWA 1VQ6V 5DN6G 2Q7EA 5LGUA 3T1YO 1CPYA 1GN6A 3OT7A 1YJNV 1FXKB 4JAAA 4B3SO 2JK5C 4DV0B 1WLEA 2P90A 1EN6A 2HJDA 1NVPB 2IW5A 1Q90D 3AG4C 5EC2C 2ZNIA 4P30A 4QJFB 4FFBA 1YSCA 1VIBA 3OTOB 1XEQA 4MTFA 4GX5A 2P4KA 3AEIA 2GSMB 1KYOF 1VQNV 4DR3B 4YJ2A 5LOVB 2CE4A 4GKJB 1VF7A 2GTSA 1FFXA 3ZMUA 1N33O 1M57C 4UV8A 4RWUA 2QWOB 4JI7B 4NXNB 3CX5F 4LFAB 1Q5OA 5B1NA 1N32B 1FFTB 4DYLA 3CMAV 5JH7A 2MW2B 3ZHTA 4KXRA 4DV4O 5E1AC 1CEZA 1H8EG 1QU7A 5LXTA 2KKWA 3LDCA 2ILMA 3APQA 4UB8Z 4NVPA 2JS5A 1QLNA 4LF8O 3SPCA 1NH2D 2UUBO 3PJSK 2CH7A 1K4DC 4OPHA 5B1BC 1TUBB 4WFFA 1EN4A 2HVKC 3K0GA 4KFMA 4FZ0A 4PJ0Z 4UUJC 3FKSG 1EN5A 3W7UA 1F51A 1QR9A 3WU2Z 3ZMSA 5CB4A 4IL6Z 5KUKA 2ZNJA 1HNXB 3D3IA 1K7DA 1GTOA 3JD2A 1SQBH 4FFBB 2YIDA 2EILB 1Z5VA 3FFQA 2Z3YA 2PY5A 2AZ0A 5B3SB 4JI3O 2XASA 4PI2A 3IGAC 1X4TA 4DXWA 1I7FA 1AR5A 4YJ2B 4HNAA 1Q3EA 4FM1A 4BR6A 3AG1C 1FFXB 1WN7A 2ZCEA 2AGAA 3CCQV 2F4VB 2HKOA 4X65B 1SC5B 2OYQA 2UXCB 3A0RA 3CCSV 1MZFA 1MSWD 1M56B 3AG3C 4DV6B 2V4DA 1Y74A 4JGSA 2UUCO 4CS3A 3CCUV 4JV5B 3KKYA 5JH7B 1MG1A 3EHBB 1N34B 5KX5A 5LXTB 1N0NA 2EX3A 3JARA 4NXMB 2CGOA 2F1MA 4UVAA 1AJQA 2LW7A 1IBMB 4JI6B 2QKSA 3H1KH 2CTRA 5LMNB 2QWPB 1MABG 4LFBB 5FNVA 2N05A 4JASA 2CH7B 3K06A 4R50A 4O2BA 5H6RA 4FLVA 4BIOA 4R7CA 5KHHA 3ABKB 1K33A 5IYBO 4PA3A 1JMKC 3PN1A 2JVDA 3A2FA 5CB4B 4I9WA 4X8AA 2Q8VA 2UXDO 1O9GA 2PYLA 3MHHC 5JCOC 1YCIA 3CC4V 3G80A 5CN0A 4XBFA 2GTAA 2YI9A 2R72A 1SRYA 2YDEA 3HKDA 4NTWA 2RN9A 2DYSC 2YSUB 4X64B 5JQGA 1K97A 1PD3A 3CCEV 4HNAB 3WB2A 3H9VA 2MK3A 4ZI7A 1P49A 1QR8A 4PI0A 4MVQA 3A8TA 1VQMV 5BXZA 1S5LZ 1PP9H 1XNRB 2BSKA 1S5HC 1XMQB 2JEXA 3CRQA 1Y74B 3M7MX 1GN4A 4HAMA 2XTAA 3L9DA 1PL0A 2X6BA 2YS8A 3U10A 5KX5B 5J2UA 3JARB 3AK2A 1OV9A 3OEHG 4PDRA 3CPWU 1XL6A 5IYZA 2DYRC 5J2TA 5H9CA 3B40A 5FNVB 1PNLA 2CUGA 3AK1A 2XUMA 4O2BB 4CS4A 1XBLA 1G8MA 5LHGA 4ZIBA 5LYJA 2GBOA 3SJQC 5KA5A 1VQ8V 1YHQV 4H44B 3N2GA 3ABLB 4PHZA 1HNZO 4DV1O 3CHXA 3WG7B 2EZOA 4LF5B 2M6YA 4X66B 3T1HO 1P7GA 3HKDB 3K58A 2ZDIA 1Q7YW 4UXNA 5DM6V 4IYIA 2W6JG 1JVMA 5JQGB 3ML0A 4UFZA 1BHBA 3CP1A 4IIJA 3W7WA 1S0VA 1DF4A 1VQ7V 4N23A 2JGDA 1JQ0A 4J11A 5BR8B 2BSKB 2ZE6A 2DMXA 2XAQA 2Z0AA 4PD4F 4D7SA 3JATA 1AJNA 1MA1A 4LF6O 5J2UB 4X20A 4PDLA 3RN4A 4K0KO 2W0FC 5FPOA 1M57B 3WB0A 4LF4O 3JD0A 5IYZB 1L0NH 5J2TB 1KMIZ 4JAUA 3P3PA 3QF7A 1FXHA 2QR4A 2DW4A 3F7VC 4X9QA 3K04A 4DV0O 4LWSA 1HR0B 4JI2O 5LYJB 2OTLV 3N2GB 3OTOO 3ZHRA 1IBKB 3THOA 1NZ6A 1SQVH 3DTUB 4DR3O 3ZMTA 4R6ZA 1D5NA 2RDCA 2QJ1A 1M5IA 3CC2V 4G27B 4O4IA 4Q20A 3W7XA 2LQTA 4D7TA 2LFRA 4L87A 4JI7O 3CCLV 1YVWA 4DRXA 4LFAO 2IJIA 5JCOA 3J80N 4IIJB 1N32O 3E83A 1W59A 5L3BA 2Z5UA 2LO1A 2QDOA 2JGDB 1US6A 1DGSA 4CS2A 2VQEB 4B3TO 2QM4A 2X6AA 4ABMA 2YC0A 3C90A 2DWEC 1VQ9V 1PNMA 3AG7A 3JATB 1YITV 3SYCA 4J7JA 4X20B 2EINC 4GX0A 5LMUB 3GWKC 1NTKH 3K59A 3CXCU 2GUZA 1F4NA 4R8CA 1AI4A 1BS3A 3H1JH 3AG3B 4B08A 4U7OA 5EBWC 5KUMA 1S76D 1CP9A 5B1AB 2GV9A 4LWSB 2YICA 1HNXO 2ZM6O 2OCCC 4P9OA 1VF6A 3DSQA 3ETQA 4X62B 2H94A 3I56V 1I5YA 4IGGA 5HFMA 2OTJV 4WFGA 1BQZA 5KHJA 1SQQH 4O4IB 3OE7G 1SZTA 5H5NA 4MTXA 3ZHSA 1FJGB 4DR7B 4KHPB 2ZXWC 2X7RB 1UFIA 2EIJC 4DK0A 1BL8A 3MHSC 1QVFU 4DRXB 2UXCO 3ICXA 2WA4A 4GUNA 1IX9A 2PI5A 3OD4A 1KP2A 3VOUA 1SESA 2GHYA 3CC7V 4FLTA 3ETEA 1N34O 2DYSB 4MW3A 1NR7A 4JI1B 3TCUA 4NXMO 3E8BA 4FLXA 2FKXA 1S5JA 3VQXA 2VWJA 1GN2A 3C3TA 1IBMO 4CH3A 4JI6O 5LMNO 4RUEA 2GUZB 4UCRA 3F7YC 3U0ZA 2A3QA 1E1QG 4MW8A 3CCRV 1N36B 3G4SV 3A0BZ 2IU0A 2O57A 2WLMA 4FM0A 3SPGA 3RYFA 5H6QA 2EBOA 1ORQC 3ZS8C 1V54B 2ETNA 1NT2B 2ZKOA 2UUAO 2IJKA 3OM3B 3QO5A 4Z2WA 1N4CA 1Q6UA 3FB7C 3SJAC 1L8DA 4PA7A 2EZPA 4J41A 3BCCH 1X59A 2EJRA 4CH5A 2X6CA 1DK1A 1RP3B 5DEDA 4X64O 2YIAA 3JD4A 3T2MA 2XOKG 4OX9O 3OGIB 4B7EA 2PTMA 5LHIA 3L71H 4O2AA 4MTOA 4UCSA 1XNRO 1XMQO 5K1XA 2L6LA 2PYJA 5IYCO 1L0LH 4U7NA 1KQSU 2UXBB 1I08A 3K3WA 1D2DA 3K5OA 3UM7A 2HEPA 4MVUA 4TQDA 2CDYA 3AK3A 1XHZA 3E8HA 3BVOA 2E75B 1R6NA 4JPRA 2XAFA 2DWDC 4QGPA 4DR4B 3KCYA 2V1DA 4JI0B 1M93A 4MSWC 4ICGA 3BHPA 3SYQA 4L8JA 1NQTA 2DQ0A 3K9SA 2XAHA 3RYFB 2UXNA 5L3GA 4Q6GA 3N27A 1K9MW 1RM1C 4LF5O 2Q7GA 3E89A 1HWYA 4X66O 1B3QA 2HHHB 4B3RO 3RVYA 5GTHZ 3FB6C 4JI8O 2EIKC 2XT9A 3M99B 4RO2A 2B9ZA 5LGNA 4H33A 3ZIAG 4O2AB 1NBMG 5JVDA 3ASOC 5BR8O 1Q86W 3QNEA 3D36C 1MMMA 1YI2V 1UJWB 1WPXA 2HFEC 2ZIMA 5LP6A 4K8ZA 4OPAA 5BMVA 2K1EA 2QM8A 2N74A 1JX9A 1KUQA 3JAMN 2IBZH 4GT1A 2WSSG 1OJHA 2FTKA 3OEEG 4LCUC 2IH1C 4RUFA 4YIPA 3R65A 2Y69C 1Q82W 2H8PC 4RQFA 3QTCA 1HR0O 1KC8W 3OMIB 4DR6B 4DR1B 4TT3G 3TXSA 4EFBA 2EINB 1HNWO 5FPRA 3CRAA 1FPOA 2ZE7A 2BCCH 1SERA 3WB1A 2ITDC 5A2QN 2ITCC 3MDSA 2WAMA 3RYCA 4ZKIA 1ZWIC 1PNKA 1P4RA 4B7KA 5J9PC 2HG5C 4XDKA 2P67A 3ZMVA 2WLKA 1XNQB 1URFA 1QLEC 5JVDB 1R3JC 4P9PA 1BQ0A 2ADPA 1H2SB 2Q73A 1QBZA 1UPGA 2RQ6A 4QNHB 2UU9B 2Q5ZA 2QKAA 4EEQA 3HKCA 2ZXWB 1G1XB 5LMUO 1NTZH 5LP6B 5BMVB 2ZR3A 3CS5A 3CXHF 1SZXA 1QCEA 1GN3A 1SF9A 2DQ3A 3ABTA 4O4LA 4O4HA 3JCUZ 2IJJA 2FB5A 1VQLV 2DJVA 3DC6A 1S77D 2HVJC 1BE3H 1BHAA 1OCRC 4DUZB 2D3OW 3DC5A 3LSUA 4YY3B 1Z2GA 4X62O 2QWQB 1RFYA 5GONA 2E5LB 1YEWA 3CRCA 5AG2A 3RYCB 4ASUG 1FJGO 4KHPO 4DR7O 4DK1A 3RYIA 1XI1A 3UQ8A 4H0LB 2ODMA 3IFXA 4WCEV 3OW2U 4FLZA 2LGWA 2QWNB 5KLVH 3E8FA 1OCOC 1KBHA 3SPHA 1V55B 1GM8A 1EM1A 2QTOA 1VQOV 2PGGA 2BE3A 4JI1O 4RQEA 5ITZA 2EULA 1SQXH 2DN9A 2IM9A 3BEHA 4GKKB 1T5EA 1M90W 4WFHA 4FIPC 3HKCB 4LBEC 1YIJV 5EZYA 5FL7G 2A9HA 3ZRSA 5CBGA 1OHHG 3ZRWA 2AHYA 4JI5O 3D36A 1ZTEA 3X2QB 4O4LB 4NB5A 3HR0A 4O4HB 3UO2A 1U97A 1H2MA 2DOSA 5KAIZ 3JAKA 5L3CA 4CC6A 4XDJA 3JAWB 2WLLA 4MVRA 1Y76A 3EXAA 5BZBA 4PV1B 3QO7A 4GYCB 1JJ2U 2B1IA 3BPZA 4LF9O 3GWOA 4RAIA 1GK9A 1NVPD 3TETA 4DV2B 5GONB 4UCOA 3CRMA 2ZINA 4IHJA 1R3LC 1KD1W 4IYHA 3RYIB 2X0LA 3ASNC 3BA9A 1OCZC 4QPJA 1W2BU 1KKCA 1PL4A 1IZ3A 1PV0A 1AI7A 3L75H 5ITZB 3W7SA 1R3IC 4K3AA 1RPOA 1EZJA 4LFCB 1QHTA 5EZYB 4DR4O 1ROPA 2ADQB 4JI0O 1O9HA 3CMEV 1P7BA 3H01A 3ZRWB 3HB3B 1YTFD 5EYPA 3JYCA 3AG4B 3T4DA 4JYAO 3OR7C 3RGBA 3EVKA 2NNUA 3JAKB 2ZE5A 5HFLA 1CXZB 2WLLB 1Y76B 3KCXA 5TISZ 1P84F 3OR6C 5KAFZ 2F43G 2HHHO 3STZC 4KP4A 3MD0A 4DV7B 4JZGA 1R1BA 1XREA 2WLIB 5L3FA 3L73H 4IHJB 1THZA 2NR5A 3Q4HA 4TSFG 4I0XA 3B2EE 2VWKA 1I94B 1ZUQA 3T4ZA 2B1GA 2OIEA 4C7UA 2HR3A 5F2VO 2D2CB 1FYJA 2A06H 3U11A 3L74H 4UVCA 5B1BB 4DW1A 4GKJO 2PF4E 5KHGA 5IE9A 4LP8A 5IY5C 1QLEB 1Z5WA 2ZR2A 4NXNO 3J7AU 4FPPA 5EYPB 2BTQA 2Q6AA 1SETA 1WB7A 1DF5A 3JD3A 1BGYH 3QVNA 1W0JG 4GX2A 4Z1VA 4DR6O 1JR9A 4DR1O 1I5XA 2FMLA 3I55V 2RMKB 4IT5A 4LF8B 1HDJA 3LUTB 1M1KW 2Y0IA 3K5LA 1AILA 3AG1B 4FM2A 1LR1A 4FLWA 4DUYB 3G6BA 2NN4A 4DV3B 1ZL8A 2CTQA 2AZ2A 4GX1A 4G2KA 3Q4HB 1XNQO 4I0XB 1BCCH 4AI8A 4G28B 2WLNA 1FD9A 3RT3C 3IC7A 2LGQA 1RPRA 4EB6A 2UU9O 2JDIG 3C3SA 2AHZA 2P22C 1IBLB 2EJ7A 4U3JA 1GM7A 4TQFA 2HP8A 4JTAB 1AROP 2VS0A 3VQVA 1R6KA 3RWRD 1IXMA 5IT9N 1OCCC 3J81N 2WWWA 5EBMC 1EZVH 1OCOB 4HYOA 4I4TA 1NKDA 5IJ0A 4DR5B 2F4VO 4DW0A 4X65O 4PA9A 2BTQB 4DV6O 4EKWA 1SQPH 5L3EA 4DUZO 2A0LA 4JAVA 3B4SA 4JV5O 4DV5B 4YY3O 3CE2A 4YXWG 4J9YB 2EILC 5B5EZ 1MNGA 3S3XA 2BOBC 3ZHVA 2W6IG 3H1IH 4J7ZA 4DO2A 3CWBH 1H38A 2E5LO 2UXXA 1XMOB 4UCUA 1Q81W 4LFBO 4B3MB 3OAAG 4UB6Z 1ZL8B 1A32A 2QE7G 2WLHA 3SPJA 1GKFA 1NH2B 4BIZA 4AQYB 4UVBA 1M56C 4MTGA 5KHIA 1E79G 4BAYA 4WFEA 1AI6A 4MS2A 1RSOA 3UKMA 2Q69A 3HKBA 5KMGB 4EB6B 1JFFA 4GKKO 3L70H 2DYRB 4U3JB 4D6TH 5CBHA 3NR7A 1QVGU 2Q9LA 5LGTA 2XAJA 5C8YA 3ABKC 4I4TB 3H1LH 5EC1C 5IJ0B 1YJ9V 1EBOA 2R70A 3FAVA 1K73W 1K3EA 1H2GA 4X1KA 3UT5A 1AR4A 1Y66A 2EIMC 1WA8A 4WFAV 1K92A 2K9PA 4NTYA 2RNBA 4LC1A 3TXQA 3HPLC 2YUAA 3RYHA 1Q6IA 2CGNA 3FB8C 4DV2O 1TAEA 4FVMA 4NYKA 3K57A 4A5UB 3RFRA 4QE9A 1AVMA 2LP7A 1WP8A 3JALA 4PDVA 1SS3A 2F23A 3LSSA 1HNZB 2OWOA 4JTDB 3APOA 5LBQA 4FMTA 1Q8IA 2P6JA 3CCVV 1RSOB 1M4UA 3HKBB 4NTXA 4FJCC 3RVZA 1N8RW 2ZT9B 3T1CA 1JFFB 3BA8A 3E35A 5CA1A 1K5QA 3CB2A 2CK3G 4FFKA 2CTPA 2AW9A 3D8CA 4LFCO 1KKDA 2NLJC 1XDCA 4F6RA 1ZAUA 3STLC 1PPJH 3AG2C 1VQPV 1F7YA 2E74B 2M7WA 2ZIOA 2E76B 3OUSA 5C8YB 1QNMA 3FAVB 1S3JA 3LDDA 5KHKA 4LF6B 2IH3C 3S3WA 4K0KB 4X1KB 1R3KC 3UT5B 3K5NA 1WA8B 3ABUA 2A79B 4U3FH 4LF4B 3GB7C 1AP5A 3ETGA 5IY5B 4BIUA 3E2EA 1G6UA 3RYHB 4E4EA 3SYPA 3JSNA
chains in the Genus database with same CATH topology
1ZX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX3 A; 
#chains in the Genus database with same CATH topology
 2RCV A;  4DV7 O;  3E8G A;  1XQ8 A;  3WFV A;  3OMN B;  4UCV A;  3SPI A;  4JI2 B;  1MOF A;  1WP7 A;  4JI4 B;  3OFN G;  3JAL B;  3G71 V;  4BWA A;  1I94 O;  3IAY A;  3G6E V;  5CMU A;  4JYC A;  1AJP A;  2KSD A;  1FKA O;  4ZBM A;  4CH6 A;  1VQ5 V;  2YIB D;  1ZLZ A;  3E22 A;  1IBK O;  4H37 A;  5BY1 A;  1GH6 A;  3M8A A;  1COW G;  5CA3 A;  3JSL A;  1FS0 G;  5CA1 B;  1H2K A;  4UV9 A;  4PA6 A;  5H2F Z;  1JOY A;  1K5S A;  3VBB A;  4PDM A;  4F6R B;  1LNQ A;  1VQK V;  4W4K A;  2VQF B;  4B3T B;  4YHH B;  5IDJ A;  1R73 A;  2OCC B;  2FYU H;  3SGI A;  4PEL A;  2VQE O;  5JJJ B;  1YTF B;  2P06 A;  4WF9 V;  2G38 A;  1JPX A;  4LF7 B;  3P3N A;  4NR1 A;  1OCC B;  1SKV A;  3BFR A;  3SR2 C;  3QO8 A;  3LNN A;  2ZDI C;  2EIJ B;  4TUY A;  3JCZ A;  4DUY O;  4DV3 O;  1DTO A;  3CCJ V;  2P7T C;  2E3C A;  4LH7 A;  4CH4 A;  4GLX A;  4FLU A;  4X88 A;  2ZM6 B;  2Q7H A;  2R9R B;  4JZ2 A;  2JS3 A;  3ZN1 A;  2ZQM A;  3LSQ A;  4O4J A;  3JAW A;  2B5U A;  3E22 B;  1IBL O;  1ZX3 A;  1GO3 F;  2JJ2 G;  4QIW F;  1OZ0 A;  3DXR A;  4K35 A;  3TJT A;  3K08 A;  4ZOL A;  1MZE A;  4AIL C;  3OUF A;  1HP8 A;  1QQC A;  1VQ4 V;  4DR5 O;  2V7Q G;  5L3D A;  3K03 A;  5B1A C;  3SYO A;  3P32 A;  2QA4 V;  4DV5 O;  4F6E A;  4JF3 A;  4BW5 A;  1XL4 A;  1VEW A;  2L35 A;  1TGO A;  2A7W A;  1KP3 A;  2BOC C;  3OTF A;  2IJH A;  1KU9 A;  2PZS A;  5EIB D;  2QGN A;  1XMO O;  3O65 A;  4X89 A;  4TUY B;  4B3M O;  3VQY A;  4YIO A;  1V9P A;  2YXH A;  1FXV A;  4BW9 A;  1SQG A;  3CJH A;  2RJZ A;  1IXB A;  4I9Q A;  2Y4T A;  2Y0P A;  2UUA B;  1N36 O;  4AQY O;  2EIM B;  1I0H A;  4CBC A;  1FAF A;  1KB9 F;  2OIG A;  3ZJZ A;  1BSM A;  4W4L A;  2QEX V;  3CRR A;  4O4J B;  3B77 A;  4QE7 A;  5IJ9 A;  2F66 C;  3SDL A;  4TOI A;  4CZZ A;  3ABM C;  4TV8 A;  3B8N A;  4LR3 A;  4OX9 B;  4MVS A;  5C93 A;  4WFB V;  2F95 B;  2JIZ G;  3EFF K;  3DXR B;  2VRZ A;  4KUM A;  2WLI A;  4Z1M G;  4ZOL B;  2JEU A;  1IVS A;  1H2N A;  3CYO A;  1RM1 B;  1V54 C;  5LA6 A;  4OGQ B;  5LHH A;  2LJ2 A;  2BTO A;  2UXB O;  2Y4U A;  1PKX A;  3F5T A;  1VF6 C;  1YZB A;  3D3Q A;  2CAZ C;  3AG2 B;  2EIK B;  4JYY A;  2PI4 A;  2QKC A;  3SJB C;  3BRC A;  1BZK A;  3ZX6 A;  3ASO B;  4QPK A;  3CJH B;  5EK0 A;  4I50 A;  4DR2 B;  3H1H H;  4EFE A;  1S72 V;  1VMG A;  1YDX A;  2KG7 A;  3ZED A;  2OT5 A;  2YI8 A;  5IWA B;  3ZRX A;  3B8M A;  4J9Z B;  1EFR G;  5A9G A;  5IJ9 B;  1MSD A;  1Y6X A;  5GW7 A;  1LUV A;  4B3R B;  1J5E B;  4YJ3 A;  4JI8 B;  3ZN0 A;  4TV8 B;  4ZI7 B;  4J10 A;  1VF5 B;  3O9O A;  1R6T A;  1D5A A;  1SA0 A;  4J80 A;  3T1Y B;  2WLJ A;  1TA8 A;  4LNU A;  4MVZ A;  5JJN B;  2Y69 B;  4B3S B;  2KQX A;  4I55 A;  3TGU H;  1GAX A;  3CEI A;  3OMA B;  3LDE A;  3FYE B;  5EIB C;  3ZCC A;  5LA6 B;  3L72 H;  3CCM V;  3QG5 A;  1H2L A;  5IYD O;  1HW7 A;  3K0D A;  3KG2 A;  3LNM B;  1WJZ A;  2XAG A;  1Y67 A;  5K1P A;  3KZI Z;  1N33 B;  1NS1 A;  1JA8 A;  4ZHQ A;  3BAB A;  1TVK A;  1M9N A;  1Q43 A;  4X1I A;  1NTM H;  3ETD A;  2R9I A;  4JI4 O;  1XUQ A;  2QSA A;  2C2A A;  1PM9 A;  1GMG A;  1YF2 A;  4DV4 B;  5CA0 A;  4I50 B;  1FXK C;  1HNW B;  1IDS A;  2LW1 A;  5GTI Z;  3ZHQ A;  2KG7 B;  4JTC B;  4WBN A;  1KEC A;  5D5P A;  1AI5 A;  2R9A A;  3OGC C;  4AHC A;  1NJI W;  2UUB B;  2AXT Z;  4TV9 A;  2YXL A;  1NU1 H;  3JAS A;  4KL1 A;  2YIB A;  4YJ3 B;  1J95 A;  5EBL C;  5B1O A;  2ATK C;  3K79 A;  1SA0 B;  4LNU B;  1YXB A;  1U96 A;  2VQF O;  2WA3 A;  4OXS A;  1OCR B;  4YHH O;  4I55 B;  5D5Q A;  2ZD9 A;  1Q6H A;  4K8X A;  1K34 A;  4J7K A;  3IJ4 A;  4JI3 B;  5KMG A;  2Q68 A;  1WNS A;  4LF7 O;  3NXS A;  3VQW A;  1B06 A;  1VP7 A;  2QM7 A;  4TWK A;  1W0K G;  2QTS A;  1XOU A;  1B6Q A;  1E1R G;  4ZHQ B;  3N2K A;  1TVK B;  1DLB A;  4X1I B;  2ARH A;  2UUC B;  3G67 A;  1F4M A;  1GM9 A;  3GVM A;  3TK1 A;  5JJE B;  5CA0 B;  2QWR B;  1IUR A;  3HKE A;  4WBN B;  1WPB A;  4FLY A;  2XHB A;  2JJ1 G;  4JYB A;  4F4L A;  4TV9 B;  5B3S C;  4MVO A;  1VAR A;  2LFS A;  2JRI A;  3I5D A;  1G4Y B;  3JAS B;  5LP6 C;  4X1Y A;  4CC5 A;  3SYA A;  1L1F A;  2Q0A A;  4GZR B;  3JD1 A;  2OCH A;  5JWP A;  4J42 A;  3F5W C;  3IC9 A;  2XND G;  3ZBH A;  2UXD B;  5B66 Z;  3BAA A;  1LUW A;  3FYI B;  3R66 A;  4HZ3 A;  4H13 B;  3ABM B;  2H3O A;  2P5O A;  3E86 A;  3CSX A;  3CD6 V;  4FK5 C;  3MAQ A;  4JI5 B;  1K4C C;  2Q0O C;  2P4V A;  2ZE8 A;  2F93 B;  3ASN B;  3N2K B;  4I5S A;  1GRJ A;  1OCZ B;  1XHX A;  4PA4 A;  4I7Z B;  2Y48 A;  1BMF G;  1F23 A;  2HLD G;  1V55 C;  1SQF A;  4LF9 B;  2YEV A;  3DGE A;  3HKE B;  3UO3 A;  4MVM A;  3SJC C;  3K9A A;  5E79 Z;  3K5M A;  1TUE B;  2FL4 A;  4FZ1 A;  1N0J A;  2N04 A;  3B09 A;  4X1Y B;  2Q4P A;  2W0X A;  4UCT A;  1FXK A;  2IU3 A;  1YJW V;  3FD9 A;  4HBN A;  3ZHU A;  3RW0 A;  1K8A W;  3X2Q C;  2GDS A;  1ENV A;  3FX7 A;  4DV1 B;  2PUS A;  5CBF A;  5KA6 A;  1Y4M A;  1AP6 A;  1ZSP A;  4GCZ A;  2KB1 A;  3A0H Z;  4N21 A;  1WB8 A;  4XDL A;  3T1H B;  5LOV A;  4E2L A;  1JJO A;  1WAZ A;  4P2Z A;  5DEC A;  1BT8 A;  3W7T A;  1H8H G;  3ZMZ A;  3ZRV A;  2DE0 X;  4JYA B;  2YXY A;  1NI8 A;  1JCH A;  3UCS C;  4MT8 A;  2WPD G;  3FB5 C;  4DR2 O;  2Q67 A;  3P30 A;  3BY6 A;  1B04 A;  4LH6 A;  5IWA O;  1AB3 A;  5FLX N;  3ABL C;  4NKG B;  2YEV B;  2HJF C;  1XIL A;  3WG7 C;  2JGU A;  1NR1 A;  1J5E O;  1TUB A;  3RBZ A;  1AR1 B;  5LL6 Y;  2CTW A;  1VQ6 V;  5DN6 G;  2Q7E A;  5LGU A;  3T1Y O;  1CPY A;  1GN6 A;  3OT7 A;  1YJN V;  1FXK B;  4JAA A;  4B3S O;  2JK5 C;  4DV0 B;  1WLE A;  2P90 A;  1EN6 A;  2HJD A;  1NVP B;  2IW5 A;  1Q90 D;  3AG4 C;  5EC2 C;  2ZNI A;  4P30 A;  4QJF B;  4FFB A;  1YSC A;  1VIB A;  3OTO B;  1XEQ A;  4MTF A;  4GX5 A;  2P4K A;  3AEI A;  2GSM B;  1KYO F;  1VQN V;  4DR3 B;  4YJ2 A;  5LOV B;  2CE4 A;  4GKJ B;  1VF7 A;  2GTS A;  1FFX A;  3ZMU A;  1N33 O;  1M57 C;  4UV8 A;  4RWU A;  2QWO B;  4JI7 B;  4NXN B;  3CX5 F;  4LFA B;  1Q5O A;  5B1N A;  1N32 B;  1FFT B;  4DYL A;  3CMA V;  5JH7 A;  2MW2 B;  3ZHT A;  4KXR A;  4DV4 O;  5E1A C;  1CEZ A;  1H8E G;  1QU7 A;  5LXT A;  2KKW A;  3LDC A;  2ILM A;  3APQ A;  4UB8 Z;  4NVP A;  2JS5 A;  1QLN A;  4LF8 O;  3SPC A;  1NH2 D;  2UUB O;  3PJS K;  2CH7 A;  1K4D C;  4OPH A;  5B1B C;  1TUB B;  4WFF A;  1EN4 A;  2HVK C;  3K0G A;  4KFM A;  4FZ0 A;  4PJ0 Z;  4UUJ C;  3FKS G;  1EN5 A;  3W7U A;  1F51 A;  1QR9 A;  3WU2 Z;  3ZMS A;  5CB4 A;  4IL6 Z;  5KUK A;  2ZNJ A;  1HNX B;  3D3I A;  1K7D A;  1GTO A;  3JD2 A;  1SQB H;  4FFB B;  2YID A;  2EIL B;  1Z5V A;  3FFQ A;  2Z3Y A;  2PY5 A;  2AZ0 A;  5B3S B;  4JI3 O;  2XAS A;  4PI2 A;  3IGA C;  1X4T A;  4DXW A;  1I7F A;  1AR5 A;  4YJ2 B;  4HNA A;  1Q3E A;  4FM1 A;  4BR6 A;  3AG1 C;  1FFX B;  1WN7 A;  2ZCE A;  2AGA A;  3CCQ V;  2F4V B;  2HKO A;  4X65 B;  1SC5 B;  2OYQ A;  2UXC B;  3A0R A;  3CCS V;  1MZF A;  1MSW D;  1M56 B;  3AG3 C;  4DV6 B;  2V4D A;  1Y74 A;  4JGS A;  2UUC O;  4CS3 A;  3CCU V;  4JV5 B;  3KKY A;  5JH7 B;  1MG1 A;  3EHB B;  1N34 B;  5KX5 A;  5LXT B;  1N0N A;  2EX3 A;  3JAR A;  4NXM B;  2CGO A;  2F1M A;  4UVA A;  1AJQ A;  2LW7 A;  1IBM B;  4JI6 B;  2QKS A;  3H1K H;  2CTR A;  5LMN B;  2QWP B;  1MAB G;  4LFB B;  5FNV A;  2N05 A;  4JAS A;  2CH7 B;  3K06 A;  4R50 A;  4O2B A;  5H6R A;  4FLV A;  4BIO A;  4R7C A;  5KHH A;  3ABK B;  1K33 A;  5IYB O;  4PA3 A;  1JMK C;  3PN1 A;  2JVD A;  3A2F A;  5CB4 B;  4I9W A;  4X8A A;  2Q8V A;  2UXD O;  1O9G A;  2PYL A;  3MHH C;  5JCO C;  1YCI A;  3CC4 V;  3G80 A;  5CN0 A;  4XBF A;  2GTA A;  2YI9 A;  2R72 A;  1SRY A;  2YDE A;  3HKD A;  4NTW A;  2RN9 A;  2DYS C;  2YSU B;  4X64 B;  5JQG A;  1K97 A;  1PD3 A;  3CCE V;  4HNA B;  3WB2 A;  3H9V A;  2MK3 A;  4ZI7 A;  1P49 A;  1QR8 A;  4PI0 A;  4MVQ A;  3A8T A;  1VQM V;  5BXZ A;  1S5L Z;  1PP9 H;  1XNR B;  2BSK A;  1S5H C;  1XMQ B;  2JEX A;  3CRQ A;  1Y74 B;  3M7M X;  1GN4 A;  4HAM A;  2XTA A;  3L9D A;  1PL0 A;  2X6B A;  2YS8 A;  3U10 A;  5KX5 B;  5J2U A;  3JAR B;  3AK2 A;  1OV9 A;  3OEH G;  4PDR A;  3CPW U;  1XL6 A;  5IYZ A;  2DYR C;  5J2T A;  5H9C A;  3B40 A;  5FNV B;  1PNL A;  2CUG A;  3AK1 A;  2XUM A;  4O2B B;  4CS4 A;  1XBL A;  1G8M A;  5LHG A;  4ZIB A;  5LYJ A;  2GBO A;  3SJQ C;  5KA5 A;  1VQ8 V;  1YHQ V;  4H44 B;  3N2G A;  3ABL B;  4PHZ A;  1HNZ O;  4DV1 O;  3CHX A;  3WG7 B;  2EZO A;  4LF5 B;  2M6Y A;  4X66 B;  3T1H O;  1P7G A;  3HKD B;  3K58 A;  2ZDI A;  1Q7Y W;  4UXN A;  5DM6 V;  4IYI A;  2W6J G;  1JVM A;  5JQG B;  3ML0 A;  4UFZ A;  1BHB A;  3CP1 A;  4IIJ A;  3W7W A;  1S0V A;  1DF4 A;  1VQ7 V;  4N23 A;  2JGD A;  1JQ0 A;  4J11 A;  5BR8 B;  2BSK B;  2ZE6 A;  2DMX A;  2XAQ A;  2Z0A A;  4PD4 F;  4D7S A;  3JAT A;  1AJN A;  1MA1 A;  4LF6 O;  5J2U B;  4X20 A;  4PDL A;  3RN4 A;  4K0K O;  2W0F C;  5FPO A;  1M57 B;  3WB0 A;  4LF4 O;  3JD0 A;  5IYZ B;  1L0N H;  5J2T B;  1KMI Z;  4JAU A;  3P3P A;  3QF7 A;  1FXH A;  2QR4 A;  2DW4 A;  3F7V C;  4X9Q A;  3K04 A;  4DV0 O;  4LWS A;  1HR0 B;  4JI2 O;  5LYJ B;  2OTL V;  3N2G B;  3OTO O;  3ZHR A;  1IBK B;  3THO A;  1NZ6 A;  1SQV H;  3DTU B;  4DR3 O;  3ZMT A;  4R6Z A;  1D5N A;  2RDC A;  2QJ1 A;  1M5I A;  3CC2 V;  4G27 B;  4O4I A;  4Q20 A;  3W7X A;  2LQT A;  4D7T A;  2LFR A;  4L87 A;  4JI7 O;  3CCL V;  1YVW A;  4DRX A;  4LFA O;  2IJI A;  5JCO A;  3J80 N;  4IIJ B;  1N32 O;  3E83 A;  1W59 A;  5L3B A;  2Z5U A;  2LO1 A;  2QDO A;  2JGD B;  1US6 A;  1DGS A;  4CS2 A;  2VQE B;  4B3T O;  2QM4 A;  2X6A A;  4ABM A;  2YC0 A;  3C90 A;  2DWE C;  1VQ9 V;  1PNM A;  3AG7 A;  3JAT B;  1YIT V;  3SYC A;  4J7J A;  4X20 B;  2EIN C;  4GX0 A;  5LMU B;  3GWK C;  1NTK H;  3K59 A;  3CXC U;  2GUZ A;  1F4N A;  4R8C A;  1AI4 A;  1BS3 A;  3H1J H;  3AG3 B;  4B08 A;  4U7O A;  5EBW C;  5KUM A;  1S76 D;  1CP9 A;  5B1A B;  2GV9 A;  4LWS B;  2YIC A;  1HNX O;  2ZM6 O;  2OCC C;  4P9O A;  1VF6 A;  3DSQ A;  3ETQ A;  4X62 B;  2H94 A;  3I56 V;  1I5Y A;  4IGG A;  5HFM A;  2OTJ V;  4WFG A;  1BQZ A;  5KHJ A;  1SQQ H;  4O4I B;  3OE7 G;  1SZT A;  5H5N A;  4MTX A;  3ZHS A;  1FJG B;  4DR7 B;  4KHP B;  2ZXW C;  2X7R B;  1UFI A;  2EIJ C;  4DK0 A;  1BL8 A;  3MHS C;  1QVF U;  4DRX B;  2UXC O;  3ICX A;  2WA4 A;  4GUN A;  1IX9 A;  2PI5 A;  3OD4 A;  1KP2 A;  3VOU A;  1SES A;  2GHY A;  3CC7 V;  4FLT A;  3ETE A;  1N34 O;  2DYS B;  4MW3 A;  1NR7 A;  4JI1 B;  3TCU A;  4NXM O;  3E8B A;  4FLX A;  2FKX A;  1S5J A;  3VQX A;  2VWJ A;  1GN2 A;  3C3T A;  1IBM O;  4CH3 A;  4JI6 O;  5LMN O;  4RUE A;  2GUZ B;  4UCR A;  3F7Y C;  3U0Z A;  2A3Q A;  1E1Q G;  4MW8 A;  3CCR V;  1N36 B;  3G4S V;  3A0B Z;  2IU0 A;  2O57 A;  2WLM A;  4FM0 A;  3SPG A;  3RYF A;  5H6Q A;  2EBO A;  1ORQ C;  3ZS8 C;  1V54 B;  2ETN A;  1NT2 B;  2ZKO A;  2UUA O;  2IJK A;  3OM3 B;  3QO5 A;  4Z2W A;  1N4C A;  1Q6U A;  3FB7 C;  3SJA C;  1L8D A;  4PA7 A;  2EZP A;  4J41 A;  3BCC H;  1X59 A;  2EJR A;  4CH5 A;  2X6C A;  1DK1 A;  1RP3 B;  5DED A;  4X64 O;  2YIA A;  3JD4 A;  3T2M A;  2XOK G;  4OX9 O;  3OGI B;  4B7E A;  2PTM A;  5LHI A;  3L71 H;  4O2A A;  4MTO A;  4UCS A;  1XNR O;  1XMQ O;  5K1X A;  2L6L A;  2PYJ A;  5IYC O;  1L0L H;  4U7N A;  1KQS U;  2UXB B;  1I08 A;  3K3W A;  1D2D A;  3K5O A;  3UM7 A;  2HEP A;  4MVU A;  4TQD A;  2CDY A;  3AK3 A;  1XHZ A;  3E8H A;  3BVO A;  2E75 B;  1R6N A;  4JPR A;  2XAF A;  2DWD C;  4QGP A;  4DR4 B;  3KCY A;  2V1D A;  4JI0 B;  1M93 A;  4MSW C;  4ICG A;  3BHP A;  3SYQ A;  4L8J A;  1NQT A;  2DQ0 A;  3K9S A;  2XAH A;  3RYF B;  2UXN A;  5L3G A;  4Q6G A;  3N27 A;  1K9M W;  1RM1 C;  4LF5 O;  2Q7G A;  3E89 A;  1HWY A;  4X66 O;  1B3Q A;  2HHH B;  4B3R O;  3RVY A;  5GTH Z;  3FB6 C;  4JI8 O;  2EIK C;  2XT9 A;  3M99 B;  4RO2 A;  2B9Z A;  5LGN A;  4H33 A;  3ZIA G;  4O2A B;  1NBM G;  5JVD A;  3ASO C;  5BR8 O;  1Q86 W;  3QNE A;  3D36 C;  1MMM A;  1YI2 V;  1UJW B;  1WPX A;  2HFE C;  2ZIM A;  5LP6 A;  4K8Z A;  4OPA A;  5BMV A;  2K1E A;  2QM8 A;  2N74 A;  1JX9 A;  1KUQ A;  3JAM N;  2IBZ H;  4GT1 A;  2WSS G;  1OJH A;  2FTK A;  3OEE G;  4LCU C;  2IH1 C;  4RUF A;  4YIP A;  3R65 A;  2Y69 C;  1Q82 W;  2H8P C;  4RQF A;  3QTC A;  1HR0 O;  1KC8 W;  3OMI B;  4DR6 B;  4DR1 B;  4TT3 G;  3TXS A;  4EFB A;  2EIN B;  1HNW O;  5FPR A;  3CRA A;  1FPO A;  2ZE7 A;  2BCC H;  1SER A;  3WB1 A;  2ITD C;  5A2Q N;  2ITC C;  3MDS A;  2WAM A;  3RYC A;  4ZKI A;  1ZWI C;  1PNK A;  1P4R A;  4B7K A;  5J9P C;  2HG5 C;  4XDK A;  2P67 A;  3ZMV A;  2WLK A;  1XNQ B;  1URF A;  1QLE C;  5JVD B;  1R3J C;  4P9P A;  1BQ0 A;  2ADP A;  1H2S B;  2Q73 A;  1QBZ A;  1UPG A;  2RQ6 A;  4QNH B;  2UU9 B;  2Q5Z A;  2QKA A;  4EEQ A;  3HKC A;  2ZXW B;  1G1X B;  5LMU O;  1NTZ H;  5LP6 B;  5BMV B;  2ZR3 A;  3CS5 A;  3CXH F;  1SZX A;  1QCE A;  1GN3 A;  1SF9 A;  2DQ3 A;  3ABT A;  4O4L A;  4O4H A;  3JCU Z;  2IJJ A;  2FB5 A;  1VQL V;  2DJV A;  3DC6 A;  1S77 D;  2HVJ C;  1BE3 H;  1BHA A;  1OCR C;  4DUZ B;  2D3O W;  3DC5 A;  3LSU A;  4YY3 B;  1Z2G A;  4X62 O;  2QWQ B;  1RFY A;  5GON A;  2E5L B;  1YEW A;  3CRC A;  5AG2 A;  3RYC B;  4ASU G;  1FJG O;  4KHP O;  4DR7 O;  4DK1 A;  3RYI A;  1XI1 A;  3UQ8 A;  4H0L B;  2ODM A;  3IFX A;  4WCE V;  3OW2 U;  4FLZ A;  2LGW A;  2QWN B;  5KLV H;  3E8F A;  1OCO C;  1KBH A;  3SPH A;  1V55 B;  1GM8 A;  1EM1 A;  2QTO A;  1VQO V;  2PGG A;  2BE3 A;  4JI1 O;  4RQE A;  5ITZ A;  2EUL A;  1SQX H;  2DN9 A;  2IM9 A;  3BEH A;  4GKK B;  1T5E A;  1M90 W;  4WFH A;  4FIP C;  3HKC B;  4LBE C;  1YIJ V;  5EZY A;  5FL7 G;  2A9H A;  3ZRS A;  5CBG A;  1OHH G;  3ZRW A;  2AHY A;  4JI5 O;  3D36 A;  1ZTE A;  3X2Q B;  4O4L B;  4NB5 A;  3HR0 A;  4O4H B;  3UO2 A;  1U97 A;  1H2M A;  2DOS A;  5KAI Z;  3JAK A;  5L3C A;  4CC6 A;  4XDJ A;  3JAW B;  2WLL A;  4MVR A;  1Y76 A;  3EXA A;  5BZB A;  4PV1 B;  3QO7 A;  4GYC B;  1JJ2 U;  2B1I A;  3BPZ A;  4LF9 O;  3GWO A;  4RAI A;  1GK9 A;  1NVP D;  3TET A;  4DV2 B;  5GON B;  4UCO A;  3CRM A;  2ZIN A;  4IHJ A;  1R3L C;  1KD1 W;  4IYH A;  3RYI B;  2X0L A;  3ASN C;  3BA9 A;  1OCZ C;  4QPJ A;  1W2B U;  1KKC A;  1PL4 A;  1IZ3 A;  1PV0 A;  1AI7 A;  3L75 H;  5ITZ B;  3W7S A;  1R3I C;  4K3A A;  1RPO A;  1EZJ A;  4LFC B;  1QHT A;  5EZY B;  4DR4 O;  1ROP A;  2ADQ B;  4JI0 O;  1O9H A;  3CME V;  1P7B A;  3H01 A;  3ZRW B;  3HB3 B;  1YTF D;  5EYP A;  3JYC A;  3AG4 B;  3T4D A;  4JYA O;  3OR7 C;  3RGB A;  3EVK A;  2NNU A;  3JAK B;  2ZE5 A;  5HFL A;  1CXZ B;  2WLL B;  1Y76 B;  3KCX A;  5TIS Z;  1P84 F;  3OR6 C;  5KAF Z;  2F43 G;  2HHH O;  3STZ C;  4KP4 A;  3MD0 A;  4DV7 B;  4JZG A;  1R1B A;  1XRE A;  2WLI B;  5L3F A;  3L73 H;  4IHJ B;  1THZ A;  2NR5 A;  3Q4H A;  4TSF G;  4I0X A;  3B2E E;  2VWK A;  1I94 B;  1ZUQ A;  3T4Z A;  2B1G A;  2OIE A;  4C7U A;  2HR3 A;  5F2V O;  2D2C B;  1FYJ A;  2A06 H;  3U11 A;  3L74 H;  4UVC A;  5B1B B;  4DW1 A;  4GKJ O;  2PF4 E;  5KHG A;  5IE9 A;  4LP8 A;  5IY5 C;  1QLE B;  1Z5W A;  2ZR2 A;  4NXN O;  3J7A U;  4FPP A;  5EYP B;  2BTQ A;  2Q6A A;  1SET A;  1WB7 A;  1DF5 A;  3JD3 A;  1BGY H;  3QVN A;  1W0J G;  4GX2 A;  4Z1V A;  4DR6 O;  1JR9 A;  4DR1 O;  1I5X A;  2FML A;  3I55 V;  2RMK B;  4IT5 A;  4LF8 B;  1HDJ A;  3LUT B;  1M1K W;  2Y0I A;  3K5L A;  1AIL A;  3AG1 B;  4FM2 A;  1LR1 A;  4FLW A;  4DUY B;  3G6B A;  2NN4 A;  4DV3 B;  1ZL8 A;  2CTQ A;  2AZ2 A;  4GX1 A;  4G2K A;  3Q4H B;  1XNQ O;  4I0X B;  1BCC H;  4AI8 A;  4G28 B;  2WLN A;  1FD9 A;  3RT3 C;  3IC7 A;  2LGQ A;  1RPR A;  4EB6 A;  2UU9 O;  2JDI G;  3C3S A;  2AHZ A;  2P22 C;  1IBL B;  2EJ7 A;  4U3J A;  1GM7 A;  4TQF A;  2HP8 A;  4JTA B;  1ARO P;  2VS0 A;  3VQV A;  1R6K A;  3RWR D;  1IXM A;  5IT9 N;  1OCC C;  3J81 N;  2WWW A;  5EBM C;  1EZV H;  1OCO B;  4HYO A;  4I4T A;  1NKD A;  5IJ0 A;  4DR5 B;  2F4V O;  4DW0 A;  4X65 O;  4PA9 A;  2BTQ B;  4DV6 O;  4EKW A;  1SQP H;  5L3E A;  4DUZ O;  2A0L A;  4JAV A;  3B4S A;  4JV5 O;  4DV5 B;  4YY3 O;  3CE2 A;  4YXW G;  4J9Y B;  2EIL C;  5B5E Z;  1MNG A;  3S3X A;  2BOB C;  3ZHV A;  2W6I G;  3H1I H;  4J7Z A;  4DO2 A;  3CWB H;  1H38 A;  2E5L O;  2UXX A;  1XMO B;  4UCU A;  1Q81 W;  4LFB O;  4B3M B;  3OAA G;  4UB6 Z;  1ZL8 B;  1A32 A;  2QE7 G;  2WLH A;  3SPJ A;  1GKF A;  1NH2 B;  4BIZ A;  4AQY B;  4UVB A;  1M56 C;  4MTG A;  5KHI A;  1E79 G;  4BAY A;  4WFE A;  1AI6 A;  4MS2 A;  1RSO A;  3UKM A;  2Q69 A;  3HKB A;  5KMG B;  4EB6 B;  1JFF A;  4GKK O;  3L70 H;  2DYR B;  4U3J B;  4D6T H;  5CBH A;  3NR7 A;  1QVG U;  2Q9L A;  5LGT A;  2XAJ A;  5C8Y A;  3ABK C;  4I4T B;  3H1L H;  5EC1 C;  5IJ0 B;  1YJ9 V;  1EBO A;  2R70 A;  3FAV A;  1K73 W;  1K3E A;  1H2G A;  4X1K A;  3UT5 A;  1AR4 A;  1Y66 A;  2EIM C;  1WA8 A;  4WFA V;  1K92 A;  2K9P A;  4NTY A;  2RNB A;  4LC1 A;  3TXQ A;  3HPL C;  2YUA A;  3RYH A;  1Q6I A;  2CGN A;  3FB8 C;  4DV2 O;  1TAE A;  4FVM A;  4NYK A;  3K57 A;  4A5U B;  3RFR A;  4QE9 A;  1AVM A;  2LP7 A;  1WP8 A;  3JAL A;  4PDV A;  1SS3 A;  2F23 A;  3LSS A;  1HNZ B;  2OWO A;  4JTD B;  3APO A;  5LBQ A;  4FMT A;  1Q8I A;  2P6J A;  3CCV V;  1RSO B;  1M4U A;  3HKB B;  4NTX A;  4FJC C;  3RVZ A;  1N8R W;  2ZT9 B;  3T1C A;  1JFF B;  3BA8 A;  3E35 A;  5CA1 A;  1K5Q A;  3CB2 A;  2CK3 G;  4FFK A;  2CTP A;  2AW9 A;  3D8C A;  4LFC O;  1KKD A;  2NLJ C;  1XDC A;  4F6R A;  1ZAU A;  3STL C;  1PPJ H;  3AG2 C;  1VQP V;  1F7Y A;  2E74 B;  2M7W A;  2ZIO A;  2E76 B;  3OUS A;  5C8Y B;  1QNM A;  3FAV B;  1S3J A;  3LDD A;  5KHK A;  4LF6 B;  2IH3 C;  3S3W A;  4K0K B;  4X1K B;  1R3K C;  3UT5 B;  3K5N A;  1WA8 B;  3ABU A;  2A79 B;  4U3F H;  4LF4 B;  3GB7 C;  1AP5 A;  3ETG A;  5IY5 B;  4BIU A;  3E2E A;  1G6U A;  3RYH B;  4E4E A;  3SYP A;  3JSN A; 
#chains in the Genus database with same CATH homology
 1ZX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...