1ZX3A

Structure of ne0241 protein of unknown function from nitrosomonas europaea
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
b'EVQQPDPMRKNWIMENMDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLEETNTEYQNQQRKLRKTYIEYYDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein NE0241
molecule tags Structural genomics, unknown function
source organism Nitrosomonas europaea
publication title X-ray crystal structure of hypothetical protein NE0241 from Nitrosomonas europaea.
rcsb
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1020 Mainly Alpha Orthogonal Bundle Helix Hairpins NE0241-like 1zx3A01
1ZX3A
chains in the Genus database with same CATH superfamily
2DMXA 2Q8VA 4LF6B 2HLDG 5KMGB 2JDIG 3RYFB 5CBFA 4FIPC 1S5LZ 3KCYA 3G4SV 1L0LH 2Q7HA 4IYHA 3WG7B 3CHXA 4B3TO 2P5OA 2JGUA 1Y74B 3DC6A 3X2QB 1GMGA 1KBHA 1WLEA 3TXQA 2EIJC 3ZCCA 4BW9A 4DR1O 3QO5A 1FFTB 1YHQV 1K3EA 1MG1A 4DUZO 1SF9A 2EZPA 1KUQA 2P4KA 2XNDG 4YJ2B 2EJ7A 1AVMA 2Q7GA 3VOUA 3HKDA 3H1HH 4J80A 2QM4A 3DXRA 4X64O 4PDLA 2B1IA 1HNWB 1H38A 1B06A 1V54C 1XOUA 2JGDA 2RCVA 4OX9B 3ZRWB 4U3FH 5BXZA 1AJQA 2Q69A 5B1NA 3AK2A 2WLIB 4UCVA 3RGBA 1JA8A 5LOVA 5EZYB 2RN9A 5C8YB 1PD3A 3G71V 3CCEV 2ZM6O 3JALB 4U3JB 4DV4O 3CCRV 1RP3B 1HNXO 4ZI7A 5IT9N 1ZL8B 2VQFO 2ZDIC 4MVZA 3STLC 4ZBMA 1FAFA 4PJ0Z 2CK3G 1AILA 1YXBA 2R9RB 2KB1A 4TT3G 4DRXA 3L72H 2OIGA 1NQTA 4PDVA 2NR5A 1NVPB 2FL4A 4F6RB 3HKBA 3H1LH 1E1QG 2DWDC 4JASA 4X20B 1FXKB 4TUYA 1GM7A 1BMFG 2H8PC 3ZN1A 3C3SA 4JI7O 1G4YB 4UVCA 5LA6B 2JEXA 2ZR3A 2CGOA 2QJ1A 2UXCB 1MSWD 2F66C 3E35A 3K0GA 3CRCA 2OWOA 3JAWB 1W0JG 1SQVH 1GO3F 3RYCB 4WBNB 1US6A 3CMEV 3IJ4A 4K8XA 2HKOA 1HNZO 3RYCA 3JAMN 3C90A 2ILMA 4OPHA 5LMUO 5CBGA 3SJBC 3UKMA 1KD1W 3NR7A 1NR1A 2ZIMA 5IYBO 3JARA 1RPOA 4LF7O 2IJJA 2ZINA 3HPLC 1OCZC 3SYOA 5EYPA 1TVKB 1H2KA 2CH7A 4MSWC 1N36B 3QTCA 2GUZA 5CB4B 1NTKH 3T1CA 4LF8B 2WLHA 3WB1A 3OMNB 1QR9A 4X1YB 4DR2B 4JV5B 3QO7A 3AG1C 1Q3EA 3X2QC 5B1BB 3T1YB 3TCUA 1X59A 5KHJA 3J80N 1JCHA 5JCOA 3N2KB 1AR5A 4KHPO 1VF6C 1Q8IA 4LBEC 1JOYA 1N0NA 3VQWA 1N32O 3ZMZA 1Q5OA 2X0LA 4WFFA 4B3RB 4JI0B 4LFBO 3A0BZ 4P9PA 4TWKA 1EFRG 5LGUA 3D36A 2BTQB 5ITZB 1O9HA 4BWAA 2P06A 3ZEDA 1P84F 1TVKA 3APQA 3BRCA 3ZS8C 5JH7B 1FXVA 3CSXA 4CC5A 2EJRA 3ZBHA 3ABKC 3K06A 1F23A 2XUMA 3P30A 4LWSA 2Q0AA 3B4SA 5JQGB 4NXMO 4GUNA 5EZYA 4J9ZB 1M90W 2H3OA 2CTWA 3CXCU 4DO2A 3APOA 2QGNA 2HR3A 3WB0A 1H2SB 4XDLA 1H8HG 3OR7C 3HKEB 1OCCC 3T4ZA 3B77A 3ABMB 1SQGA 5LBQA 1Y67A 3DC5A 1UPGA 3S3XA 3ZHUA 1K33A 3ABUA 2KQXA 4LF5O 2A9HA 1D5NA 2EINB 4NYKA 2OCCB 3D8CA 4NKGB 4X89A 3FYIB 1EZJA 3JARB 3HKBB 2ODMA 2Q68A 3OW2U 2OCHA 3BVOA 3EVKA 4IT5A 3FB7C 4DV6B 3BY6A 1IDSA 4O2BA 5EBWC 1PNKA 4Z2WA 4MW8A 2CUGA 4I55B 1L0NH 2LJ2A 4J7KA 4LR3A 1I5YA 4DRXB 1BZKA 4TV9A 4KP4A 1AI4A 4J7ZA 3JCZA 2YSUB 3G67A 4N21A 2YEVA 3BAAA 5IE9A 5K1PA 4YHHO 1YITV 1F51A 5KA6A 1WJZA 2W6JG 1NH2D 3IAYA 3IC9A 2W0XA 1M5IA 5A2QN 2JIZG 3RYHB 3K58A 2LGWA 2RDCA 1DGSA 4J42A 2WLLB 4QGPA 1J5EO 4MVOA 1ORQC 3ZMSA 4X64B 1A32A 3QG5A 3H9VA 1K5QA 1L8DA 4F4LA 3BEHA 1VF7A 1Z2GA 3B40A 5FL7G 1S76D 4JI8B 4LFBB 3K0DA 2L6LA 4LFCB 4K8ZA 2AXTZ 3SJQC 1YI2V 3K5LA 1GKFA 2YI9A 5LOVB 4CZZA 3ABLB 4MVMA 4WFHA 4H33A 4FM0A 2AGAA 4I55A 2QE7G 4WF9V 5B3SB 1I08A 4ASUG 4BIOA 4I7ZB 2HP8A 1JX9A 4A5UB 4IGGA 4ZOLB 3D3IA 2QWRB 1XI1A 5GONA 3AG4C 5BZBA 1BHAA 3B09A 3JAKA 4ZHQA 4MS2A 4DW1A 3LDEA 5FPRA 3MHHC 4UVBA 4DR6B 3ASNB 4DV5B 3H1KH 3AG3B 4LF9O 1BSMA 2CE4A 3K04A 1R6NA 4DR4O 4LF7B 5TISZ 2ZIOA 2E5LO 4CH5A 2FB5A 2OCCC 3LNNA 1BGYH 4CH4A 4DV1O 4GKJO 1EN6A 4DR1B 5CA1A 2O57A 1OZ0A 3ABMC 1KQSU 4LFCO 3H1IH 1JJOA 4W4KA 3CCLV 2Y0IA 3AG7A 1MABG 1WNSA 3CC2V 2RQ6A 2DWEC 5EC2C 2F23A 5IJ0B 1GAXA 3RFRA 4DR4B 4FFKA 5L3CA 4YY3O 2X6CA 2F93B 3JYCA 2WLJA 5IYZB 4I9WA 4Z1MG 2A06H 1XNRO 1THZA 4AHCA 1OJHA 4NVPA 3JSLA 3CXHF 2UU9O 1M9NA 3GWKC 1N0JA 4MTXA 3CCMV 1IBLO 3O65A 1BS3A 3OFNG 3E2EA 3CS5A 2CTQA 1YTFD 2EIKB 1N36O 4I0XA 3ZRSA 1SKVA 3S3WA 1NTMH 4YIPA 1AR4A 1TAEA 1SQPH 2VQEO 1U96A 5LHGA 1MZEA 4RUFA 1D2DA 1H2LA 4DXWA 5B5EZ 5CN0A 5JCOC 4JAUA 1K92A 1ZTEA 3PJSK 4WFAV 1WAZA 4X1KB 2UXCO 1ZSPA 1DLBA 1F4NA 5CA0A 4B3TB 4MVSA 4B3SB 4PI2A 1QHTA 4KUMA 3E86A 5KMGA 5IWAO 2FMLA 4HAMA 1Y6XA 2QSAA 3D36C 3W7XA 1BHBA 4QPJA 3R65A 1Q81W 3L75H 3BCCH 2WAMA 2WWWA 1Y74A 4ZOLA 3K9SA 3TGUH 1R3JC 5DM6V 5JH7A 4JYBA 1JJ2U 1WP7A 3OAAG 4TUYB 5LL6Y 1F4MA 1K4DC 1NI8A 4UCSA 3ZRVA 1YJNV 3CMAV 3HKDB 1VP7A 4O4HA 2IW5A 3GVMA 3RYIA 4EB6B 4ICGA 5LMUB 5IY5B 3JD4A 2X6BA 1OCOC 1RM1B 4FZ1A 1Q43A 1R73A 1J95A 2PI4A 4CS4A 4WFEA 1EBOA 2YXLA 1M4UA 5J2UB 3I5DA 1NVPD 1K9MW 4KFMA 4DV2O 4FFBA 3ZRXA 1AP5A 1KB9F 3VBBA 1R1BA 2EIMC 2ZT9B 4BIUA 4DR7O 4K3AA 3K03A 2MK3A 1S5HC 3SPHA 4KHPB 4X62O 1S77D 4DV7O 3CB2A 4R7CA 1IBMO 1YJ9V 4NTXA 2UUAO 3RYIB 1GM8A 2VQEB 1QBZA 3L71H 1ZX3A 4LF4O 2HVJC 5B66Z 5H6RA 4FMTA 4UB8Z 3N2KA 5BR8B 5L3BA 4YIOA 3K9AA 2GSMB 2D2CB 5J2TB 2E5LB 3A0HZ 1P7GA 1B6QA 2ZE8A 2QKAA 3ZHRA 5FLXN 1PNLA 2EILB 3JASB 3SGIA 3CCQV 2GBOA 1PPJH 4I4TA 4DR6O 4PA4A 1VQ6V 2DE0X 3L73H 5EBLC 4HBNA 4YJ3B 4TV9B 2ITDC 1OHHG 1N34B 3ZHQA 5LYJB 2LFRA 4X66O 4LWSB 2QWNB 3K5MA 3P3PA 2DJVA 4JI4O 2XAHA 4BIZA 5LHHA 1OCCB 3CRQA 2AW9A 3OR6C 3OD4A 1Z5WA 1YDXA 2LGQA 1JFFB 5CA0B 2BOBC 5CBHA 1W59A 2NN4A 4GZRB 4O2BB 3ASOC 2ARHA 4WFGA 1XREA 2HFEC 4DYLA 4I0XB 4QE9A 3G6EV 2Y0PA 3JCUZ 3A0RA 2ZD9A 2XOKG 3N27A 4EFBA 3U10A 2AZ2A 3K79A 1XMQB 2ZE5A 2VWJA 1HWYA 4F6RA 3IC7A 2RNBA 1EN4A 4PELA 4Q6GA 1VQ4V 4OXSA 4H0LB 5KUKA 1B04A 1AP6A 2IJIA 4DK0A 4JZGA 5D5QA 3OM3B 4RAIA 5L3EA 1KMIZ 3ASNC 4I50B 1PL0A 1MOFA 3FB6C 3UCSC 1SS3A 4DR3O 1PP9H 2HHHB 3BFRA 4LNUA 1VIBA 4YXWG 4MT8A 1FKAO 1SA0A 2VWKA 5B1BC 1N32B 2CH7B 2F4VB 4X66B 2ZE7A 1ZAUA 4PA6A 5KUMA 2YUAA 1GRJA 3J81N 2YS8A 3L70H 4LC1A 2XHBA 2M6YA 2Q5ZA 3JATA 3A2FA 5A9GA 4DV3B 1RPRA 4JV5O 4J10A 2F43G 2IM9A 2PGGA 3JAWA 3T1HO 1Y66A 4UCOA 4HZ3A 2VRZA 3W7UA 2DQ3A 1IURA 2Q4PA 4WCEV 2IU0A 4GKJB 1Q6UA 4W4LA 3K59A 4R6ZA 2E3CA 4EB6A 2IH3C 4QE7A 4ZKIA 2KG7B 2GTSA 1XILA 1OCOB 1VARA 3ZMTA 2HJFC 4CS2A 3RN4A 2UXBO 2HG5C 1VQ5V 2UU9B 1SA0B 4LF9B 1XNRB 2BTOA 1K8AW 2YDEA 3RVYA 3DGEA 4ZIBA 3ZN0A 2UXDO 5IYZA 3ZIAG 3AG4B 2DYSB 1FFXA 5E1AC 3ETQA 3OTOB 4U7NA 1FFXB 2Z0AA 2QWPB 4RQEA 1DK1A 2WLIA 2K1EA 2G38A 1QLEC 5BY1A 5J2TA 4UV9A 3BPZA 5B1OA 1DTOA 1GTOA 2JJ2G 1SQBH 2QR4A 1LUVA 1HP8A 4QIWF 2KG7A 4RUEA 1BT8A 2XAJA 3WG7C 4YJ2A 5LP6A 1M57C 4JI8O 2QTSA 3BA8A 2JK5C 3I55V 3HKCA 4LF6O 4C7UA 1QNMA 5J9PC 4JYYA 5LGNA 1IBKB 4O2AA 1XHZA 3MD0A 2PI5A 2EBOA 4NTWA 4JI0O 4I9QA 4FM2A 3K5OA 4DR3B 4UCUA 1R6KA 4DR5B 4L8JA 3SYCA 1AI6A 4E4EA 2L35A 2QA4V 5LA6A 4OPAA 2N74A 3NXSA 1M93A 2XTAA 4LCUC 2ZQMA 3K5NA 1VQNV 4I4TB 3D3QA 2LO1A 3QF7A 2Q9LA 1QR8A 1HR0B 3R66A 5H6QA 1LUWA 4LFAO 2ZXWC 4IL6Z 5B3SC 2C2AA 3G80A 1JR9A 1KKDA 5LHIA 1WP8A 1PNMA 2JRIA 3DTUB 2VS0A 1KC8W 1AR1B 4JI6B 2LW7A 1U97A 1M56C 1PKXA 3H01A 4JAAA 4JAVA 4HYOA 1G1XB 1QQCA 4TQFA 4BW5A 1HNWO 4N23A 3MDSA 3FFQA 3FX7A 1HDJA 3TETA 5IWAB 2E75B 5D5PA 2ZR2A 1R3KC 4LF5B 3LDCA 3CCUV 1F7YA 1SQFA 4X62B 4UV8A 3E83A 4B3MB 1EZVH 4JF3A 1NT2B 2OT5A 4B7KA 2V7QG 3ETDA 3T1YO 1PM9A 1KYOF 2R72A 3RBZA 4JI2B 2CTPA 2UUBO 2ZE6A 4RWUA 3MAQA 5H5NA 4PA3A 2IBZH 5C93A 1YTFB 4JPRA 2PY5A 2GTAA 4J41A 4X88A 1ENVA 3SYQA 1XL4A 1Q90D 2LP7A 5L3FA 2FKXA 4TSFG 1ROPA 4UFZA 1R3IC 3UO3A 1I94O 4JZ2A 2X6AA 1B3QA 3PN1A 3RYFA 1JMKC 3OUSA 1ZLZA 3ABTA 3ABKB 2WSSG 2V1DA 4O4IA 2A0LA 1QCEA 3Q4HA 4H13B 5J2UA 3G6BA 4OX9O 3ICXA 4D7SA 4CC6A 1VQMV 1AJNA 3P3NA 5H9CA 2KKWA 1GN4A 3ML0A 4MVUA 1IXMA 3OTFA 5KHIA 3OEHG 2H94A 4FLYA 4MVQA 4JTAB 3SR2C 3T4DA 4Q20A 4DV5O 3SPJA 2RJZA 2PZSA 4J7JA 2Y4UA 2P22C 1OCZB 3ZHTA 2HEPA 1GN6A 1VQPV 1G6UA 1URFA 4O4LA 4PDMA 4CBCA 1VQOV 1TA8A 1JFFA 1IBLB 2AZ0A 1IVSA 4FLWA 3B8MA 2EIKC 4DW0A 4DV4B 5E79Z 2NNUA 4IHJB 1SC5B 1L1FA 2NLJC 1BQZA 3VQXA 2EILC 4MTGA 4JI2O 3THOA 5C8YA 3KG2A 1WPBA 4JTDB 1M56B 4UCRA 5IY5C 2WLKA 2IU3A 1CPYA 2Y69C 2F4VO 2QKSA 1NBMG 1V54B 5L3GA 1JQ0A 3M99B 1QLNA 1EN5A 3ZMVA 4GX1A 5LP6B 1Q82W 4JYAB 4XDKA 4DV2B 2P90A 5K1XA 1XQ8A 1UFIA 1G8MA 3CEIA 4PI0A 2YIBA 1PL4A 2DW4A 3CCJV 4MVRA 1DF5A 1ZUQA 4QPKA 4G2KA 5JJNB 1VMGA 4EKWA 2JJ1G 3FKSG 2EINC 4LF8O 2R9AA 1GH6A 1V55C 1YVWA 4UVAA 3JSNA 3W7TA 1YJWV 5GTIZ 1HNXB 4DK1A 4TV8A 2PYJA 3LSSA 2QTOA 3UT5A 2D3OW 4JI1B 2Q67A 1SERA 2YI8A 3U11A 4BR6A 2PYLA 5KA5A 4GX5A 4FLVA 5CA3A 3AG3C 4IYIA 2GHYA 5DECA 4DV7B 2EULA 1FS0G 3AK3A 1VQ7V 3KZIZ 2YXYA 2YXHA 4R8CA 4G27B 5FNVA 3WB2A 2A7WA 2AHYA 1COWG 2P67A 1QLEB 1RSOB 4B3SO 1Q6HA 1S72V 1RSOA 2Q6AA 5EIBC 1N34O 4B7EA 4GKKB 3T1HB 3IFXA 4JGSA 1SETA 1W2BU 4GLXA 1SRYA 1VF6A 3ABLC 5JVDA 4AQYO 4J11A 2FTKA 3CCSV 2DYRC 5BMVB 5DN6G 1KU9A 3JD0A 1I7FA 5AG2A 5EIBD 3DXRB 3ZJZA 4LH6A 1NS1A 3AG1B 3E8FA 2BOCC 3AG2C 4O4JB 4X8AA 4K0KO 2QEXV 2UXDB 1BQ0A 4X65B 1J5EB 4CH3A 3B2EE 4MTOA 1GN3A 2UUAB 3CRRA 2YIDA 1H2MA 5B1AC 4K0KB 3SDLA 1N8RW 2A3QA 4PDRA 1S3JA 2R70A 3VQVA 3SYAA 3RW0A 4D6TH 4DR5O 5BR8O 5LMNB 1QU7A 2LW1A 4JI5B 1K5SA 4MTFA 4AQYB 1QVFU 4FK5C 2JS3A 4R50A 2BSKB 2YIAA 1FXHA 5JVDB 3TK1A 1IBMB 1T5EA 3H1JH 4K35A 1WA8A 2QKCA 3JD2A 2ZNJA 3LUTB 4O4HB 2LQTA 1IZ3A 3K57A 1BCCH 2OTLV 2B1GA 5GTHZ 1Z5VA 3U0ZA 1I94B 1XEQA 1AJPA 1R6TA 1VF5B 4B3RO 3E22A 2RMKB 4IHJA 5LXTB 2N04A 2XAFA 2B5UA 2JVDA 1KP3A 1WN7A 4WFBV 4CS3A 1XHXA 3JASA 4J9YB 4TV8B 1KP2A 3ASOB 3GWOA 5EK0A 3E89A 1R3LC 4FZ0A 3CX5F 4UXNA 3CPWU 4X65O 3E8GA 2FYUH 4JI3O 4PD4F 1N33O 2MW2B 2DOSA 4B3MO 3LNMB 2XASA 1MNGA 1Q6IA 1MMMA 2PTMA 4NXNB 5LYJA 4JI1O 4X20A 4NTYA 1YCIA 2HVKC 3K08A 5KX5B 3OGCC 4I50A 2IH1C 3QNEA 3EFFK 1XNQO 3GB7C 5CMUA 3LDDA 3DSQA 1AROP 3JD1A 2UUCO 3RVZA 3AEIA 3AG2B 3F7YC 3KKYA 5JJJB 3W7SA 4EFEA 3N2GB 4JYAO 4JI3B 2BE3A 2CGNA 4YJ3A 1FYJA 4FLZA 2W0FC 1WB8A 1MA1A 1Y4MA 2Z5UA 2ZM6B 5KX5A 5BMVA 5IYDO 3CP1A 3FB5C 4TQDA 1AB3A 2Q0OC 4U7OA 3SJCC 4YY3B 4FM1A 1P4RA 4PV1B 2WPDG 2OIEA 4QNHB 3FB8C 3OMAB 1K97A 4DV0O 2WLNA 2BCCH 3CD6V 4NXMB 1IX9A 2CTRA 3ETGA 4NB5A 4O4LB 5DEDA 2W6IG 2EIMB 1XMQO 2XAQA 5LP6C 2OTJV 1JVMA 1GM9A 4FVMA 1FJGB 2WA3A 4DUZB 3EHBB 5CA1B 5IJ9B 4DV3O 2ADPA 2OYQA 3J7AU 1RM1C 4KXRA 4ZI7B 4X1IA 3HKEA 5LMNO 5IDJA 1WA8B 3OT7A 3T2MA 5KHHA 1CEZA 3CRMA 2EX3A 3CE2A 1DF4A 4NXNO 3SPIA 1RFYA 3UQ8A 3FAVA 3HB3B 3FD9A 4JI7B 1NKDA 1VQKV 3M8AA 1MSDA 4ZHQB 3RT3C 3QO8A 3EXAA 3AK1A 4F6EA 4IIJA 4DV1B 2Y4TA 2UXBB 2QWQB 3B8NA 4JYCA 1TGOA 1H8EG 1NZ6A 4O4JA 2WLMA 2ADQB 2DQ0A 3F5TA 1SQXH 4GX2A 3BHPA 4LH7A 2BSKA 4G28B 3ZRWA 2DYRB 4QJFB 3RYHA 1OCRC 4GT1A 1VQ8V 2E74B 4DV6O 4AI8A 3RWRD 3OEEG 5KHKA 4LF4B 4L87A 5JWPA 3FAVB 3ZX6A 3CYOA 2YEVB 1P49A 1K4CC 3SPGA 2JGDB 2UUBB 2DN9A 3E22B 1D5AA 1E79G 2Y48A 1W0KG 1XL6A 4P30A 1XMOO 2V4DA 3WU2Z 3W7WA 1IBKO 4HNAB 4JI5O 5FPOA 5JJEB 2QM7A 2AHZA 2WLLA 5B1AB 3C3TA 1PV0A 1JPXA 2YIBD 2HJDA 2JEUA 4P2ZA 2PUSA 1HW7A 5HFLA 3STZC 3UT5B 2A79B 2Z3YA 3HR0A 1E1RG 3FYEB 4KL1A 5IYCO 1QVGU 4JI6O 2ZNIA 3E8BA 3SPCA 1FPOA 4X1KA 2M7WA 3K3WA 2CAZC 5IJ9A 3L9DA 4H37A 2P7TC 3OGIB 4LFAB 1SZTA 4EEQA 2ZCEA 4DV0B 1HR0O 2ZKOA 3QVNA 1V55B 1VQ9V 5ITZA 5KHGA 1VQLV 3L74H 3WFVA 1TUBB 5EYPB 2P4VA 4O2AB 2GDSA 5FNVB 2KSDA 5IJ0A 1Y76A 4LNUB 4HNAA 4IIJB 1YSCA 4H44B 4PA9A 4X9QA 4JI4B 2LFSA 4JTCB 4PHZA 4Z1VA 1LNQA 3TXSA 1XMOB 4GYCB 3E8HA 4WBNA 2BTQA 3N2GA 2ZXWB 2B9ZA 4DUYO 1O9GA 1AI7A 2IJHA 1FJGO 2E76B 3LSUA 1UJWB 1GK9A 1SZXA 3JD3A 2Q7EA 2UXNA 3CCVV 1WPXA 1WB7A 5EBMC 1YZBA 1NH2B 4PA7A 4P9OA 1FXKC 1K34A 3BABA 3CJHA 1KKCA 3F5WC 3O9OA 4X1YA 3CRAA 3ZMUA 4RQFA 4FJCC 4MW3A 2CDYA 1V9PA 1HNZB 3ETEA 5JQGA 4UUJC 1IXBA 1EM1A 4DUYB 4XDJA 3VQYA 4ABMA 2YC0A 1OV9A 2ITCC 2Y69B 1BE3H 2XAGA 5H2FZ 3CC7V 4UB6Z 4OGQB 1P7BA 1NJIW 5GW7A 1VEWA 1YF2A 5LXTA 3OE7G 3LSQA 4X1IB 1M1KW 1CXZB 2DYSC 1CP9A 2UUCB 1XBLA 3F7VC 1XUQA 5F2VO 4BAYA 2K9PA 1K7DA 2QM8A 3A8TA 4GKKO 1MZFA 4FLXA 3UM7A 3CC4V 4D7TA 2VQFB 1XNQB 3CJHB 5HFMA 4GX0A 1NTZH 1Q7YW 3M7MX 4O4IB 2ETNA 2F1MA 5KLVH 3SJAC 3JALA 4U3JA 3ZHSA 2EIJB 1SESA 3Q4HB 2HHHO 1NR7A 3OTOO 3OUFA 1M57B 2R9IA 4AILC 2ATKC 1N33B 5LGTA 3OMIB 1OCRB 4RO2A 1ZWIC 1ZL8A 2GV9A 1SQQH 2QWOB 3BA9A 4GCZA 4FLTA 1BL8A 1H2NA 1Y76B 2WA4A 4XBFA 2QDOA 1Q86W 2GUZB 5CB4A 1N4CA 4FLUA 3P32A 3MHSC 5L3DA 3IGAC 3ZHVA 1FXKA 1I0HA 2N05A 1TUEB 2PF4E 1K73W 1S5JA 1LR1A 2EZOA 2UXXA 1FD9A 4LP8A 3UO2A 1X4TA 2XT9A 1YEWA 2P6JA 1XDCA 5EC1C 2ZDIA 4CH6A 1YIJV 4DR7B 4B08A 1NU1H 4UCTA 1AI5A 1KECA 1S0VA 5KAIZ 5GONB 3KCXA 3CWBH 3TJTA 1H2GA 5KAFZ 4TOIA 4YHHB 4DR2O 3I56V 2IJKA 1TUBA 4FPPA 3SYPA 4I5SA 3JAKB 3HKCB 2X7RB 2YICA 2F95B 2JS5A 4E2LA 4FFBB 4NR1A 1GN2A 3JATB 1I5XA 2Q73A
chains in the Genus database with same CATH topology
1ZX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX3 A; 
#chains in the Genus database with same CATH topology
 2DMX A;  2Q8V A;  4LF6 B;  2HLD G;  5KMG B;  2JDI G;  3RYF B;  5CBF A;  4FIP C;  1S5L Z;  3KCY A;  3G4S V;  1L0L H;  2Q7H A;  4IYH A;  3WG7 B;  3CHX A;  4B3T O;  2P5O A;  2JGU A;  1Y74 B;  3DC6 A;  3X2Q B;  1GMG A;  1KBH A;  1WLE A;  3TXQ A;  2EIJ C;  3ZCC A;  4BW9 A;  4DR1 O;  3QO5 A;  1FFT B;  1YHQ V;  1K3E A;  1MG1 A;  4DUZ O;  1SF9 A;  2EZP A;  1KUQ A;  2P4K A;  2XND G;  4YJ2 B;  2EJ7 A;  1AVM A;  2Q7G A;  3VOU A;  3HKD A;  3H1H H;  4J80 A;  2QM4 A;  3DXR A;  4X64 O;  4PDL A;  2B1I A;  1HNW B;  1H38 A;  1B06 A;  1V54 C;  1XOU A;  2JGD A;  2RCV A;  4OX9 B;  3ZRW B;  4U3F H;  5BXZ A;  1AJQ A;  2Q69 A;  5B1N A;  3AK2 A;  2WLI B;  4UCV A;  3RGB A;  1JA8 A;  5LOV A;  5EZY B;  2RN9 A;  5C8Y B;  1PD3 A;  3G71 V;  3CCE V;  2ZM6 O;  3JAL B;  4U3J B;  4DV4 O;  3CCR V;  1RP3 B;  1HNX O;  4ZI7 A;  5IT9 N;  1ZL8 B;  2VQF O;  2ZDI C;  4MVZ A;  3STL C;  4ZBM A;  1FAF A;  4PJ0 Z;  2CK3 G;  1AIL A;  1YXB A;  2R9R B;  2KB1 A;  4TT3 G;  4DRX A;  3L72 H;  2OIG A;  1NQT A;  4PDV A;  2NR5 A;  1NVP B;  2FL4 A;  4F6R B;  3HKB A;  3H1L H;  1E1Q G;  2DWD C;  4JAS A;  4X20 B;  1FXK B;  4TUY A;  1GM7 A;  1BMF G;  2H8P C;  3ZN1 A;  3C3S A;  4JI7 O;  1G4Y B;  4UVC A;  5LA6 B;  2JEX A;  2ZR3 A;  2CGO A;  2QJ1 A;  2UXC B;  1MSW D;  2F66 C;  3E35 A;  3K0G A;  3CRC A;  2OWO A;  3JAW B;  1W0J G;  1SQV H;  1GO3 F;  3RYC B;  4WBN B;  1US6 A;  3CME V;  3IJ4 A;  4K8X A;  2HKO A;  1HNZ O;  3RYC A;  3JAM N;  3C90 A;  2ILM A;  4OPH A;  5LMU O;  5CBG A;  3SJB C;  3UKM A;  1KD1 W;  3NR7 A;  1NR1 A;  2ZIM A;  5IYB O;  3JAR A;  1RPO A;  4LF7 O;  2IJJ A;  2ZIN A;  3HPL C;  1OCZ C;  3SYO A;  5EYP A;  1TVK B;  1H2K A;  2CH7 A;  4MSW C;  1N36 B;  3QTC A;  2GUZ A;  5CB4 B;  1NTK H;  3T1C A;  4LF8 B;  2WLH A;  3WB1 A;  3OMN B;  1QR9 A;  4X1Y B;  4DR2 B;  4JV5 B;  3QO7 A;  3AG1 C;  1Q3E A;  3X2Q C;  5B1B B;  3T1Y B;  3TCU A;  1X59 A;  5KHJ A;  3J80 N;  1JCH A;  5JCO A;  3N2K B;  1AR5 A;  4KHP O;  1VF6 C;  1Q8I A;  4LBE C;  1JOY A;  1N0N A;  3VQW A;  1N32 O;  3ZMZ A;  1Q5O A;  2X0L A;  4WFF A;  4B3R B;  4JI0 B;  4LFB O;  3A0B Z;  4P9P A;  4TWK A;  1EFR G;  5LGU A;  3D36 A;  2BTQ B;  5ITZ B;  1O9H A;  4BWA A;  2P06 A;  3ZED A;  1P84 F;  1TVK A;  3APQ A;  3BRC A;  3ZS8 C;  5JH7 B;  1FXV A;  3CSX A;  4CC5 A;  2EJR A;  3ZBH A;  3ABK C;  3K06 A;  1F23 A;  2XUM A;  3P30 A;  4LWS A;  2Q0A A;  3B4S A;  5JQG B;  4NXM O;  4GUN A;  5EZY A;  4J9Z B;  1M90 W;  2H3O A;  2CTW A;  3CXC U;  4DO2 A;  3APO A;  2QGN A;  2HR3 A;  3WB0 A;  1H2S B;  4XDL A;  1H8H G;  3OR7 C;  3HKE B;  1OCC C;  3T4Z A;  3B77 A;  3ABM B;  1SQG A;  5LBQ A;  1Y67 A;  3DC5 A;  1UPG A;  3S3X A;  3ZHU A;  1K33 A;  3ABU A;  2KQX A;  4LF5 O;  2A9H A;  1D5N A;  2EIN B;  4NYK A;  2OCC B;  3D8C A;  4NKG B;  4X89 A;  3FYI B;  1EZJ A;  3JAR B;  3HKB B;  2ODM A;  2Q68 A;  3OW2 U;  2OCH A;  3BVO A;  3EVK A;  4IT5 A;  3FB7 C;  4DV6 B;  3BY6 A;  1IDS A;  4O2B A;  5EBW C;  1PNK A;  4Z2W A;  4MW8 A;  2CUG A;  4I55 B;  1L0N H;  2LJ2 A;  4J7K A;  4LR3 A;  1I5Y A;  4DRX B;  1BZK A;  4TV9 A;  4KP4 A;  1AI4 A;  4J7Z A;  3JCZ A;  2YSU B;  3G67 A;  4N21 A;  2YEV A;  3BAA A;  5IE9 A;  5K1P A;  4YHH O;  1YIT V;  1F51 A;  5KA6 A;  1WJZ A;  2W6J G;  1NH2 D;  3IAY A;  3IC9 A;  2W0X A;  1M5I A;  5A2Q N;  2JIZ G;  3RYH B;  3K58 A;  2LGW A;  2RDC A;  1DGS A;  4J42 A;  2WLL B;  4QGP A;  1J5E O;  4MVO A;  1ORQ C;  3ZMS A;  4X64 B;  1A32 A;  3QG5 A;  3H9V A;  1K5Q A;  1L8D A;  4F4L A;  3BEH A;  1VF7 A;  1Z2G A;  3B40 A;  5FL7 G;  1S76 D;  4JI8 B;  4LFB B;  3K0D A;  2L6L A;  4LFC B;  4K8Z A;  2AXT Z;  3SJQ C;  1YI2 V;  3K5L A;  1GKF A;  2YI9 A;  5LOV B;  4CZZ A;  3ABL B;  4MVM A;  4WFH A;  4H33 A;  4FM0 A;  2AGA A;  4I55 A;  2QE7 G;  4WF9 V;  5B3S B;  1I08 A;  4ASU G;  4BIO A;  4I7Z B;  2HP8 A;  1JX9 A;  4A5U B;  4IGG A;  4ZOL B;  3D3I A;  2QWR B;  1XI1 A;  5GON A;  3AG4 C;  5BZB A;  1BHA A;  3B09 A;  3JAK A;  4ZHQ A;  4MS2 A;  4DW1 A;  3LDE A;  5FPR A;  3MHH C;  4UVB A;  4DR6 B;  3ASN B;  4DV5 B;  3H1K H;  3AG3 B;  4LF9 O;  1BSM A;  2CE4 A;  3K04 A;  1R6N A;  4DR4 O;  4LF7 B;  5TIS Z;  2ZIO A;  2E5L O;  4CH5 A;  2FB5 A;  2OCC C;  3LNN A;  1BGY H;  4CH4 A;  4DV1 O;  4GKJ O;  1EN6 A;  4DR1 B;  5CA1 A;  2O57 A;  1OZ0 A;  3ABM C;  1KQS U;  4LFC O;  3H1I H;  1JJO A;  4W4K A;  3CCL V;  2Y0I A;  3AG7 A;  1MAB G;  1WNS A;  3CC2 V;  2RQ6 A;  2DWE C;  5EC2 C;  2F23 A;  5IJ0 B;  1GAX A;  3RFR A;  4DR4 B;  4FFK A;  5L3C A;  4YY3 O;  2X6C A;  2F93 B;  3JYC A;  2WLJ A;  5IYZ B;  4I9W A;  4Z1M G;  2A06 H;  1XNR O;  1THZ A;  4AHC A;  1OJH A;  4NVP A;  3JSL A;  3CXH F;  2UU9 O;  1M9N A;  3GWK C;  1N0J A;  4MTX A;  3CCM V;  1IBL O;  3O65 A;  1BS3 A;  3OFN G;  3E2E A;  3CS5 A;  2CTQ A;  1YTF D;  2EIK B;  1N36 O;  4I0X A;  3ZRS A;  1SKV A;  3S3W A;  1NTM H;  4YIP A;  1AR4 A;  1TAE A;  1SQP H;  2VQE O;  1U96 A;  5LHG A;  1MZE A;  4RUF A;  1D2D A;  1H2L A;  4DXW A;  5B5E Z;  5CN0 A;  5JCO C;  4JAU A;  1K92 A;  1ZTE A;  3PJS K;  4WFA V;  1WAZ A;  4X1K B;  2UXC O;  1ZSP A;  1DLB A;  1F4N A;  5CA0 A;  4B3T B;  4MVS A;  4B3S B;  4PI2 A;  1QHT A;  4KUM A;  3E86 A;  5KMG A;  5IWA O;  2FML A;  4HAM A;  1Y6X A;  2QSA A;  3D36 C;  3W7X A;  1BHB A;  4QPJ A;  3R65 A;  1Q81 W;  3L75 H;  3BCC H;  2WAM A;  2WWW A;  1Y74 A;  4ZOL A;  3K9S A;  3TGU H;  1R3J C;  5DM6 V;  5JH7 A;  4JYB A;  1JJ2 U;  1WP7 A;  3OAA G;  4TUY B;  5LL6 Y;  1F4M A;  1K4D C;  1NI8 A;  4UCS A;  3ZRV A;  1YJN V;  3CMA V;  3HKD B;  1VP7 A;  4O4H A;  2IW5 A;  3GVM A;  3RYI A;  4EB6 B;  4ICG A;  5LMU B;  5IY5 B;  3JD4 A;  2X6B A;  1OCO C;  1RM1 B;  4FZ1 A;  1Q43 A;  1R73 A;  1J95 A;  2PI4 A;  4CS4 A;  4WFE A;  1EBO A;  2YXL A;  1M4U A;  5J2U B;  3I5D A;  1NVP D;  1K9M W;  4KFM A;  4DV2 O;  4FFB A;  3ZRX A;  1AP5 A;  1KB9 F;  3VBB A;  1R1B A;  2EIM C;  2ZT9 B;  4BIU A;  4DR7 O;  4K3A A;  3K03 A;  2MK3 A;  1S5H C;  3SPH A;  4KHP B;  4X62 O;  1S77 D;  4DV7 O;  3CB2 A;  4R7C A;  1IBM O;  1YJ9 V;  4NTX A;  2UUA O;  3RYI B;  1GM8 A;  2VQE B;  1QBZ A;  3L71 H;  1ZX3 A;  4LF4 O;  2HVJ C;  5B66 Z;  5H6R A;  4FMT A;  4UB8 Z;  3N2K A;  5BR8 B;  5L3B A;  4YIO A;  3K9A A;  2GSM B;  2D2C B;  5J2T B;  2E5L B;  3A0H Z;  1P7G A;  1B6Q A;  2ZE8 A;  2QKA A;  3ZHR A;  5FLX N;  1PNL A;  2EIL B;  3JAS B;  3SGI A;  3CCQ V;  2GBO A;  1PPJ H;  4I4T A;  4DR6 O;  4PA4 A;  1VQ6 V;  2DE0 X;  3L73 H;  5EBL C;  4HBN A;  4YJ3 B;  4TV9 B;  2ITD C;  1OHH G;  1N34 B;  3ZHQ A;  5LYJ B;  2LFR A;  4X66 O;  4LWS B;  2QWN B;  3K5M A;  3P3P A;  2DJV A;  4JI4 O;  2XAH A;  4BIZ A;  5LHH A;  1OCC B;  3CRQ A;  2AW9 A;  3OR6 C;  3OD4 A;  1Z5W A;  1YDX A;  2LGQ A;  1JFF B;  5CA0 B;  2BOB C;  5CBH A;  1W59 A;  2NN4 A;  4GZR B;  4O2B B;  3ASO C;  2ARH A;  4WFG A;  1XRE A;  2HFE C;  4DYL A;  4I0X B;  4QE9 A;  3G6E V;  2Y0P A;  3JCU Z;  3A0R A;  2ZD9 A;  2XOK G;  3N27 A;  4EFB A;  3U10 A;  2AZ2 A;  3K79 A;  1XMQ B;  2ZE5 A;  2VWJ A;  1HWY A;  4F6R A;  3IC7 A;  2RNB A;  1EN4 A;  4PEL A;  4Q6G A;  1VQ4 V;  4OXS A;  4H0L B;  5KUK A;  1B04 A;  1AP6 A;  2IJI A;  4DK0 A;  4JZG A;  5D5Q A;  3OM3 B;  4RAI A;  5L3E A;  1KMI Z;  3ASN C;  4I50 B;  1PL0 A;  1MOF A;  3FB6 C;  3UCS C;  1SS3 A;  4DR3 O;  1PP9 H;  2HHH B;  3BFR A;  4LNU A;  1VIB A;  4YXW G;  4MT8 A;  1FKA O;  1SA0 A;  2VWK A;  5B1B C;  1N32 B;  2CH7 B;  2F4V B;  4X66 B;  2ZE7 A;  1ZAU A;  4PA6 A;  5KUM A;  2YUA A;  1GRJ A;  3J81 N;  2YS8 A;  3L70 H;  4LC1 A;  2XHB A;  2M6Y A;  2Q5Z A;  3JAT A;  3A2F A;  5A9G A;  4DV3 B;  1RPR A;  4JV5 O;  4J10 A;  2F43 G;  2IM9 A;  2PGG A;  3JAW A;  3T1H O;  1Y66 A;  4UCO A;  4HZ3 A;  2VRZ A;  3W7U A;  2DQ3 A;  1IUR A;  2Q4P A;  4WCE V;  2IU0 A;  4GKJ B;  1Q6U A;  4W4L A;  3K59 A;  4R6Z A;  2E3C A;  4EB6 A;  2IH3 C;  4QE7 A;  4ZKI A;  2KG7 B;  2GTS A;  1XIL A;  1OCO B;  1VAR A;  3ZMT A;  2HJF C;  4CS2 A;  3RN4 A;  2UXB O;  2HG5 C;  1VQ5 V;  2UU9 B;  1SA0 B;  4LF9 B;  1XNR B;  2BTO A;  1K8A W;  2YDE A;  3RVY A;  3DGE A;  4ZIB A;  3ZN0 A;  2UXD O;  5IYZ A;  3ZIA G;  3AG4 B;  2DYS B;  1FFX A;  5E1A C;  3ETQ A;  3OTO B;  4U7N A;  1FFX B;  2Z0A A;  2QWP B;  4RQE A;  1DK1 A;  2WLI A;  2K1E A;  2G38 A;  1QLE C;  5BY1 A;  5J2T A;  4UV9 A;  3BPZ A;  5B1O A;  1DTO A;  1GTO A;  2JJ2 G;  1SQB H;  2QR4 A;  1LUV A;  1HP8 A;  4QIW F;  2KG7 A;  4RUE A;  1BT8 A;  2XAJ A;  3WG7 C;  4YJ2 A;  5LP6 A;  1M57 C;  4JI8 O;  2QTS A;  3BA8 A;  2JK5 C;  3I55 V;  3HKC A;  4LF6 O;  4C7U A;  1QNM A;  5J9P C;  4JYY A;  5LGN A;  1IBK B;  4O2A A;  1XHZ A;  3MD0 A;  2PI5 A;  2EBO A;  4NTW A;  4JI0 O;  4I9Q A;  4FM2 A;  3K5O A;  4DR3 B;  4UCU A;  1R6K A;  4DR5 B;  4L8J A;  3SYC A;  1AI6 A;  4E4E A;  2L35 A;  2QA4 V;  5LA6 A;  4OPA A;  2N74 A;  3NXS A;  1M93 A;  2XTA A;  4LCU C;  2ZQM A;  3K5N A;  1VQN V;  4I4T B;  3D3Q A;  2LO1 A;  3QF7 A;  2Q9L A;  1QR8 A;  1HR0 B;  3R66 A;  5H6Q A;  1LUW A;  4LFA O;  2ZXW C;  4IL6 Z;  5B3S C;  2C2A A;  3G80 A;  1JR9 A;  1KKD A;  5LHI A;  1WP8 A;  1PNM A;  2JRI A;  3DTU B;  2VS0 A;  1KC8 W;  1AR1 B;  4JI6 B;  2LW7 A;  1U97 A;  1M56 C;  1PKX A;  3H01 A;  4JAA A;  4JAV A;  4HYO A;  1G1X B;  1QQC A;  4TQF A;  4BW5 A;  1HNW O;  4N23 A;  3MDS A;  3FFQ A;  3FX7 A;  1HDJ A;  3TET A;  5IWA B;  2E75 B;  5D5P A;  2ZR2 A;  1R3K C;  4LF5 B;  3LDC A;  3CCU V;  1F7Y A;  1SQF A;  4X62 B;  4UV8 A;  3E83 A;  4B3M B;  1EZV H;  4JF3 A;  1NT2 B;  2OT5 A;  4B7K A;  2V7Q G;  3ETD A;  3T1Y O;  1PM9 A;  1KYO F;  2R72 A;  3RBZ A;  4JI2 B;  2CTP A;  2UUB O;  2ZE6 A;  4RWU A;  3MAQ A;  5H5N A;  4PA3 A;  2IBZ H;  5C93 A;  1YTF B;  4JPR A;  2PY5 A;  2GTA A;  4J41 A;  4X88 A;  1ENV A;  3SYQ A;  1XL4 A;  1Q90 D;  2LP7 A;  5L3F A;  2FKX A;  4TSF G;  1ROP A;  4UFZ A;  1R3I C;  3UO3 A;  1I94 O;  4JZ2 A;  2X6A A;  1B3Q A;  3PN1 A;  3RYF A;  1JMK C;  3OUS A;  1ZLZ A;  3ABT A;  3ABK B;  2WSS G;  2V1D A;  4O4I A;  2A0L A;  1QCE A;  3Q4H A;  4H13 B;  5J2U A;  3G6B A;  4OX9 O;  3ICX A;  4D7S A;  4CC6 A;  1VQM V;  1AJN A;  3P3N A;  5H9C A;  2KKW A;  1GN4 A;  3ML0 A;  4MVU A;  1IXM A;  3OTF A;  5KHI A;  3OEH G;  2H94 A;  4FLY A;  4MVQ A;  4JTA B;  3SR2 C;  3T4D A;  4Q20 A;  4DV5 O;  3SPJ A;  2RJZ A;  2PZS A;  4J7J A;  2Y4U A;  2P22 C;  1OCZ B;  3ZHT A;  2HEP A;  1GN6 A;  1VQP V;  1G6U A;  1URF A;  4O4L A;  4PDM A;  4CBC A;  1VQO V;  1TA8 A;  1JFF A;  1IBL B;  2AZ0 A;  1IVS A;  4FLW A;  3B8M A;  2EIK C;  4DW0 A;  4DV4 B;  5E79 Z;  2NNU A;  4IHJ B;  1SC5 B;  1L1F A;  2NLJ C;  1BQZ A;  3VQX A;  2EIL C;  4MTG A;  4JI2 O;  3THO A;  5C8Y A;  3KG2 A;  1WPB A;  4JTD B;  1M56 B;  4UCR A;  5IY5 C;  2WLK A;  2IU3 A;  1CPY A;  2Y69 C;  2F4V O;  2QKS A;  1NBM G;  1V54 B;  5L3G A;  1JQ0 A;  3M99 B;  1QLN A;  1EN5 A;  3ZMV A;  4GX1 A;  5LP6 B;  1Q82 W;  4JYA B;  4XDK A;  4DV2 B;  2P90 A;  5K1X A;  1XQ8 A;  1UFI A;  1G8M A;  3CEI A;  4PI0 A;  2YIB A;  1PL4 A;  2DW4 A;  3CCJ V;  4MVR A;  1DF5 A;  1ZUQ A;  4QPK A;  4G2K A;  5JJN B;  1VMG A;  4EKW A;  2JJ1 G;  3FKS G;  2EIN C;  4LF8 O;  2R9A A;  1GH6 A;  1V55 C;  1YVW A;  4UVA A;  3JSN A;  3W7T A;  1YJW V;  5GTI Z;  1HNX B;  4DK1 A;  4TV8 A;  2PYJ A;  3LSS A;  2QTO A;  3UT5 A;  2D3O W;  4JI1 B;  2Q67 A;  1SER A;  2YI8 A;  3U11 A;  4BR6 A;  2PYL A;  5KA5 A;  4GX5 A;  4FLV A;  5CA3 A;  3AG3 C;  4IYI A;  2GHY A;  5DEC A;  4DV7 B;  2EUL A;  1FS0 G;  3AK3 A;  1VQ7 V;  3KZI Z;  2YXY A;  2YXH A;  4R8C A;  4G27 B;  5FNV A;  3WB2 A;  2A7W A;  2AHY A;  1COW G;  2P67 A;  1QLE B;  1RSO B;  4B3S O;  1Q6H A;  1S72 V;  1RSO A;  2Q6A A;  5EIB C;  1N34 O;  4B7E A;  4GKK B;  3T1H B;  3IFX A;  4JGS A;  1SET A;  1W2B U;  4GLX A;  1SRY A;  1VF6 A;  3ABL C;  5JVD A;  4AQY O;  4J11 A;  2FTK A;  3CCS V;  2DYR C;  5BMV B;  5DN6 G;  1KU9 A;  3JD0 A;  1I7F A;  5AG2 A;  5EIB D;  3DXR B;  3ZJZ A;  4LH6 A;  1NS1 A;  3AG1 B;  3E8F A;  2BOC C;  3AG2 C;  4O4J B;  4X8A A;  4K0K O;  2QEX V;  2UXD B;  1BQ0 A;  4X65 B;  1J5E B;  4CH3 A;  3B2E E;  4MTO A;  1GN3 A;  2UUA B;  3CRR A;  2YID A;  1H2M A;  5B1A C;  4K0K B;  3SDL A;  1N8R W;  2A3Q A;  4PDR A;  1S3J A;  2R70 A;  3VQV A;  3SYA A;  3RW0 A;  4D6T H;  4DR5 O;  5BR8 O;  5LMN B;  1QU7 A;  2LW1 A;  4JI5 B;  1K5S A;  4MTF A;  4AQY B;  1QVF U;  4FK5 C;  2JS3 A;  4R50 A;  2BSK B;  2YIA A;  1FXH A;  5JVD B;  3TK1 A;  1IBM B;  1T5E A;  3H1J H;  4K35 A;  1WA8 A;  2QKC A;  3JD2 A;  2ZNJ A;  3LUT B;  4O4H B;  2LQT A;  1IZ3 A;  3K57 A;  1BCC H;  2OTL V;  2B1G A;  5GTH Z;  1Z5V A;  3U0Z A;  1I94 B;  1XEQ A;  1AJP A;  1R6T A;  1VF5 B;  4B3R O;  3E22 A;  2RMK B;  4IHJ A;  5LXT B;  2N04 A;  2XAF A;  2B5U A;  2JVD A;  1KP3 A;  1WN7 A;  4WFB V;  4CS3 A;  1XHX A;  3JAS A;  4J9Y B;  4TV8 B;  1KP2 A;  3ASO B;  3GWO A;  5EK0 A;  3E89 A;  1R3L C;  4FZ0 A;  3CX5 F;  4UXN A;  3CPW U;  4X65 O;  3E8G A;  2FYU H;  4JI3 O;  4PD4 F;  1N33 O;  2MW2 B;  2DOS A;  4B3M O;  3LNM B;  2XAS A;  1MNG A;  1Q6I A;  1MMM A;  2PTM A;  4NXN B;  5LYJ A;  4JI1 O;  4X20 A;  4NTY A;  1YCI A;  2HVK C;  3K08 A;  5KX5 B;  3OGC C;  4I50 A;  2IH1 C;  3QNE A;  3EFF K;  1XNQ O;  3GB7 C;  5CMU A;  3LDD A;  3DSQ A;  1ARO P;  3JD1 A;  2UUC O;  3RVZ A;  3AEI A;  3AG2 B;  3F7Y C;  3KKY A;  5JJJ B;  3W7S A;  4EFE A;  3N2G B;  4JYA O;  4JI3 B;  2BE3 A;  2CGN A;  4YJ3 A;  1FYJ A;  4FLZ A;  2W0F C;  1WB8 A;  1MA1 A;  1Y4M A;  2Z5U A;  2ZM6 B;  5KX5 A;  5BMV A;  5IYD O;  3CP1 A;  3FB5 C;  4TQD A;  1AB3 A;  2Q0O C;  4U7O A;  3SJC C;  4YY3 B;  4FM1 A;  1P4R A;  4PV1 B;  2WPD G;  2OIE A;  4QNH B;  3FB8 C;  3OMA B;  1K97 A;  4DV0 O;  2WLN A;  2BCC H;  3CD6 V;  4NXM B;  1IX9 A;  2CTR A;  3ETG A;  4NB5 A;  4O4L B;  5DED A;  2W6I G;  2EIM B;  1XMQ O;  2XAQ A;  5LP6 C;  2OTJ V;  1JVM A;  1GM9 A;  4FVM A;  1FJG B;  2WA3 A;  4DUZ B;  3EHB B;  5CA1 B;  5IJ9 B;  4DV3 O;  2ADP A;  2OYQ A;  3J7A U;  1RM1 C;  4KXR A;  4ZI7 B;  4X1I A;  3HKE A;  5LMN O;  5IDJ A;  1WA8 B;  3OT7 A;  3T2M A;  5KHH A;  1CEZ A;  3CRM A;  2EX3 A;  3CE2 A;  1DF4 A;  4NXN O;  3SPI A;  1RFY A;  3UQ8 A;  3FAV A;  3HB3 B;  3FD9 A;  4JI7 B;  1NKD A;  1VQK V;  3M8A A;  1MSD A;  4ZHQ B;  3RT3 C;  3QO8 A;  3EXA A;  3AK1 A;  4F6E A;  4IIJ A;  4DV1 B;  2Y4T A;  2UXB B;  2QWQ B;  3B8N A;  4JYC A;  1TGO A;  1H8E G;  1NZ6 A;  4O4J A;  2WLM A;  2ADQ B;  2DQ0 A;  3F5T A;  1SQX H;  4GX2 A;  3BHP A;  4LH7 A;  2BSK A;  4G28 B;  3ZRW A;  2DYR B;  4QJF B;  3RYH A;  1OCR C;  4GT1 A;  1VQ8 V;  2E74 B;  4DV6 O;  4AI8 A;  3RWR D;  3OEE G;  5KHK A;  4LF4 B;  4L87 A;  5JWP A;  3FAV B;  3ZX6 A;  3CYO A;  2YEV B;  1P49 A;  1K4C C;  3SPG A;  2JGD B;  2UUB B;  2DN9 A;  3E22 B;  1D5A A;  1E79 G;  2Y48 A;  1W0K G;  1XL6 A;  4P30 A;  1XMO O;  2V4D A;  3WU2 Z;  3W7W A;  1IBK O;  4HNA B;  4JI5 O;  5FPO A;  5JJE B;  2QM7 A;  2AHZ A;  2WLL A;  5B1A B;  3C3T A;  1PV0 A;  1JPX A;  2YIB D;  2HJD A;  2JEU A;  4P2Z A;  2PUS A;  1HW7 A;  5HFL A;  3STZ C;  3UT5 B;  2A79 B;  2Z3Y A;  3HR0 A;  1E1R G;  3FYE B;  4KL1 A;  5IYC O;  1QVG U;  4JI6 O;  2ZNI A;  3E8B A;  3SPC A;  1FPO A;  4X1K A;  2M7W A;  3K3W A;  2CAZ C;  5IJ9 A;  3L9D A;  4H37 A;  2P7T C;  3OGI B;  4LFA B;  1SZT A;  4EEQ A;  2ZCE A;  4DV0 B;  1HR0 O;  2ZKO A;  3QVN A;  1V55 B;  1VQ9 V;  5ITZ A;  5KHG A;  1VQL V;  3L74 H;  3WFV A;  1TUB B;  5EYP B;  2P4V A;  4O2A B;  2GDS A;  5FNV B;  2KSD A;  5IJ0 A;  1Y76 A;  4LNU B;  4HNA A;  4IIJ B;  1YSC A;  4H44 B;  4PA9 A;  4X9Q A;  4JI4 B;  2LFS A;  4JTC B;  4PHZ A;  4Z1V A;  1LNQ A;  3TXS A;  1XMO B;  4GYC B;  3E8H A;  4WBN A;  2BTQ A;  3N2G A;  2ZXW B;  2B9Z A;  4DUY O;  1O9G A;  1AI7 A;  2IJH A;  1FJG O;  2E76 B;  3LSU A;  1UJW B;  1GK9 A;  1SZX A;  3JD3 A;  2Q7E A;  2UXN A;  3CCV V;  1WPX A;  1WB7 A;  5EBM C;  1YZB A;  1NH2 B;  4PA7 A;  4P9O A;  1FXK C;  1K34 A;  3BAB A;  3CJH A;  1KKC A;  3F5W C;  3O9O A;  4X1Y A;  3CRA A;  3ZMU A;  4RQF A;  4FJC C;  4MW3 A;  2CDY A;  1V9P A;  1HNZ B;  3ETE A;  5JQG A;  4UUJ C;  1IXB A;  1EM1 A;  4DUY B;  4XDJ A;  3VQY A;  4ABM A;  2YC0 A;  1OV9 A;  2ITC C;  2Y69 B;  1BE3 H;  2XAG A;  5H2F Z;  3CC7 V;  4UB6 Z;  4OGQ B;  1P7B A;  1NJI W;  5GW7 A;  1VEW A;  1YF2 A;  5LXT A;  3OE7 G;  3LSQ A;  4X1I B;  1M1K W;  1CXZ B;  2DYS C;  1CP9 A;  2UUC B;  1XBL A;  3F7V C;  1XUQ A;  5F2V O;  4BAY A;  2K9P A;  1K7D A;  2QM8 A;  3A8T A;  4GKK O;  1MZF A;  4FLX A;  3UM7 A;  3CC4 V;  4D7T A;  2VQF B;  1XNQ B;  3CJH B;  5HFM A;  4GX0 A;  1NTZ H;  1Q7Y W;  3M7M X;  4O4I B;  2ETN A;  2F1M A;  5KLV H;  3SJA C;  3JAL A;  4U3J A;  3ZHS A;  2EIJ B;  1SES A;  3Q4H B;  2HHH O;  1NR7 A;  3OTO O;  3OUF A;  1M57 B;  2R9I A;  4AIL C;  2ATK C;  1N33 B;  5LGT A;  3OMI B;  1OCR B;  4RO2 A;  1ZWI C;  1ZL8 A;  2GV9 A;  1SQQ H;  2QWO B;  3BA9 A;  4GCZ A;  4FLT A;  1BL8 A;  1H2N A;  1Y76 B;  2WA4 A;  4XBF A;  2QDO A;  1Q86 W;  2GUZ B;  5CB4 A;  1N4C A;  4FLU A;  3P32 A;  3MHS C;  5L3D A;  3IGA C;  3ZHV A;  1FXK A;  1I0H A;  2N05 A;  1TUE B;  2PF4 E;  1K73 W;  1S5J A;  1LR1 A;  2EZO A;  2UXX A;  1FD9 A;  4LP8 A;  3UO2 A;  1X4T A;  2XT9 A;  1YEW A;  2P6J A;  1XDC A;  5EC1 C;  2ZDI A;  4CH6 A;  1YIJ V;  4DR7 B;  4B08 A;  1NU1 H;  4UCT A;  1AI5 A;  1KEC A;  1S0V A;  5KAI Z;  5GON B;  3KCX A;  3CWB H;  3TJT A;  1H2G A;  5KAF Z;  4TOI A;  4YHH B;  4DR2 O;  3I56 V;  2IJK A;  1TUB A;  4FPP A;  3SYP A;  4I5S A;  3JAK B;  3HKC B;  2X7R B;  2YIC A;  2F95 B;  2JS5 A;  4E2L A;  4FFB B;  4NR1 A;  1GN2 A;  3JAT B;  1I5X A;  2Q73 A; 
#chains in the Genus database with same CATH homology
 1ZX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...