1ZX3A

Structure of ne0241 protein of unknown function from nitrosomonas europaea
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
EVQQPDPMRKNWIMENMDSGVIYLLESWLKAKSQETGKEISDIFANAVEFNIVLKDWGKEKLEETNTEYQNQQRKLRKTYIEYYDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of hypothetical protein NE0241 from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein NE0241
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2005-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1020 Mainly Alpha Orthogonal Bundle Helix Hairpins NE0241-like 1zx3A01
1ZX3A
chains in the Genus database with same CATH superfamily
4E2LA 4QPJA 3FB8C 1TUBA 1DLBA 3C90A 2UXBO 2HLDG 2YI9A 2P7TC 4EFBA 1Q3EA 1F51A 2EX3A 3M7MX 2Q73A 3R65A 1DF5A 1ZX3A 4O4HA 1F23A 4WCEV 2DJVA 5IY5B 4UVAA 5J2UA 4P2ZA 3E8GA 5CA0A 3WFVA 3SPJA 1VF7A 5BMVB 1OCCC 4LFCO 3UO2A 2CTRA 4DR2B 1P49A 2KG7A 1BS3A 2P5OA 2ADPA 2IU0A 3K58A 3QNEA 1HDJA 1OCZC 1NTMH 3L70H 3IC7A 1ENVA 5IYZA 5IJ9B 1HWYA 1RM1C 5D5PA 3W7SA 4B7EA 2XOKG 1H2SB 1DTOA 5A9GA 5L3EA 1HP8A 1M1KW 3BHPA 2UUBB 2UXXA 1XQ8A 1VIBA 2JRIA 3RFRA 4AQYB 2NLJC 3OAAG 1UFIA 3B2EE 1M57B 3I55V 1JA8A 2Y69B 4B3TB 5LXTB 4LFBB 3ZMUA 4DV0O 3OD4A 2N04A 1URFA 3NR7A 3DC6A 5FPOA 1N4CA 1AP5A 3AG1C 4ZHQA 5JVDA 1BCCH 1NT2B 1OCOB 4DR1O 5LHGA 4NTWA 3ABMB 4FPPA 4CZZA 1GMGA 4NTYA 1SZXA 2QJ1A 5EBLC 2Q0AA 3JALA 2AHYA 4H37A 3CYOA 4JTCB 3ZMVA 1J5EB 3FB7C 1X4TA 4J9ZB 4GX1A 2Z5UA 3AG2B 2KG7B 5FNVB 5GTIZ 1XL6A 4YXWG 5D5QA 1M56B 3CD6V 4DXWA 2B1GA 3B77A 4Q6GA 5EC1C 4DO2A 1SA0A 1PNMA 1XDCA 1IBLB 2JJ1G 4MVSA 2XAQA 2YC0A 3SPIA 2EBOA 5L3BA 5IYDO 1ZAUA 2A79B 2Y0PA 4U3JA 1K5SA 2DMXA 4MW8A 1XNRO 2QKAA 5KX5A 2X7RB 1NH2D 2ETNA 1OZ0A 4U3FH 2ZIMA 2QEXV 1YF2A 2F66C 4DUYB 1VQ7V 4I0XB 3HKBB 3OMIB 3ABKC 1YEWA 3BCCH 1XNQO 3SYCA 2WA4A 4BIOA 1ZWIC 4FFKA 4X89A 1WP8A 2ILMA 3J7AU 1HW7A 1XBLA 2YIBD 5CA3A 4FM1A 4NXNO 4RWUA 3I5DA 5CN0A 4UV8A 4I50A 4LR3A 3FYIB 5LOVB 4IYHA 4XDLA 2IU3A 4UUJC 1N32B 3RYCA 4B3RB 3BABA 4JF3A 3UKMA 4JI6O 5KAFZ 3F5WC 3STLC 2RQ6A 1JQ0A 3HB3B 5B5EZ 5B3SB 4O2AB 2H94A 1TVKA 2IJJA 1WB8A 3F7VC 1MMMA 1NZ6A 4WFHA 5CA1B 5KHJA 4FIPC 2EILB 2A3QA 1LNQA 2Y4UA 1WP7A 4FJCC 4X1YA 1JMKC 4BAYA 3JARA 1CPYA 3TXSA 1KD1W 4TV9B 4DRXA 3WG7C 4PA4A 4Z1MG 2YIAA 4GX2A 2Q69A 4QIWF 2ZR3A 5LA6A 4J42A 2JJ2G 4WF9V 2UXDO 4UXNA 4X1IB 1T5EA 1QQCA 2HJDA 4DV4B 1I5YA 1H2MA 3A0BZ 1G4YB 4HBNA 4TT3G 3SR2C 4I5SA 4JV5B 2UXCB 3ETGA 4OPAA 4AQYO 1H2KA 3OUSA 2BTQA 3RYCB 4Z1VA 4LF4O 3VQWA 4FLWA 1KQSU 5FNVA 3I56V 2ZE5A 4B7KA 2P4KA 3SYAA 1GAXA 1U97A 4KHPB 5K1PA 1SF9A 1L0NH 3RT3C 2IW5A 3EVKA 4DV1O 4X62O 4DR3B 4PA9A 3ZRWB 1AR4A 3JASA 3CRQA 4CC6A 4MVMA 4CH5A 1LUWA 3K57A 4DR5O 1GRJA 2RMKB 3DXRB 4ZI7B 1G6UA 1AR5A 2BCCH 3K0GA 2QA4V 3ZCCA 4LFAB 1FXVA 3TXQA 4TSFG 5F2VO 3WB1A 3KCYA 4N21A 4XDJA 1EM1A 1H2LA 1FJGO 3SYOA 3W7TA 1UJWB 3TCUA 1QLNA 2P22C 3VBBA 1E1QG 4I55B 3ABLB 4CH4A 2IJIA 3FAVA 2DN9A 4UCTA 3RVYA 1Q8IA 2AXTZ 2ZE8A 4X8AA 1K73W 4U7OA 2Q9LA 1VQNV 4PDVA 4O4JB 1OCRB 2HJFC 1JX9A 3ZMZA 4LF4B 1SRYA 3TK1A 1ZUQA 3H1LH 5IDJA 4O2BA 5EBWC 4BW9A 3MDSA 2IM9A 1EN4A 1FD9A 3FX7A 1DK1A 3UT5A 1ZSPA 4GUNA 3RWRD 2ZNIA 2F23A 4DR3O 4G28B 5LMUO 4MTOA 4B08A 1BSMA 4KP4A 5BXZA 1YCIA 4D7TA 1ZTEA 2Q7EA 5BY1A 5KLVH 2QTOA 4DK1A 2NNUA 4B3MB 5B1BC 2BE3A 1OV9A 3LDEA 4U3JB 1QU7A 4PELA 1H8HG 4RQEA 4R50A 3G6BA 3WB2A 4EKWA 4UB6Z 4TV8B 1Q81W 1N8RW 1AP6A 4P9PA 4DV4O 4LF6O 1S72V 1N36O 3PJSK 3HKCA 3VOUA 4ASUG 2P6JA 3HPLC 3FYEB 4FZ1A 3SJBC 3LSUA 2DYSC 2PYJA 2A0LA 3ASNB 3RYIB 2Y4TA 3T1HO 2QE7G 1CP9A 1UPGA 4DR7B 2V1DA 4CH3A 3T1CA 1QR8A 1SQXH 2G38A 2YIDA 4CBCA 4X1KA 1LUVA 5GONB 1YIJV 1IURA 2LFRA 1J95A 3DXRA 3OMAB 1BGYH 1QVFU 2OTJV 1I5XA 4JI8B 4TWKA 3JAWA 5LBQA 2GSMB 1N0NA 2PI5A 4WFBV 3O9OA 1VARA 3ABLC 5J2TA 1SQFA 1VF6C 1Q90D 2W6IG 1SQVH 2A06H 1S0VA 2Y0IA 2WWWA 1IZ3A 1GH6A 1VF6A 4RUEA 2WLIA 1K34A 3AG7A 1M56C 4JYBA 3H9VA 5B1AB 4JI5O 3JSLA 3RYIA 2ZIOA 2FL4A 1NKDA 3PN1A 4J80A 2QDOA 3JASB 1IXBA 4DUZB 4TUYA 3BFRA 1D5AA 2WLJA 1Y66A 1YHQV 2JGDA 3E22B 3GWKC 3ASOC 3SYQA 4FZ0A 1E1RG 4MVOA 1MA1A 5DEDA 4AHCA 1MZEA 4X1KB 2EZOA 3JCUZ 2FTKA 4X9QA 2Q7HA 5FPRA 2Y69C 4IGGA 5CA0B 5J2UB 1S5HC 3K79A 2R9IA 5LHHA 1P7BA 3CJHA 1SETA 4HYOA 3BA9A 5B1BB 4BIZA 5JJJB 4X1IA 2UU9B 1H2NA 4FLUA 1VQ9V 5JH7A 2EINC 3HKDB 2PI4A 5CA1A 2V4DA 4WBNB 4X62B 5IJ9A 2R72A 3OMNB 1WA8A 4K0KO 3K9AA 1R3IC 4GZRB 2EIMB 1W0JG 3S3XA 3D8CA 2FKXA 1OCZB 4QE7A 3FFQA 1OCRC 5KA6A 1R1BA 3K5LA 4BIUA 1WA8B 1NQTA 1FFXA 3MHHC 4B3MO 2LQTA 4JASA 4JI4O 1BQ0A 2QM8A 5DN6G 1V54B 1XMQB 4JI4B 4X88A 2LJ2A 3K5MA 5IE9A 1P4RA 2Q68A 2W0FC 3E22A 4NXMO 1RPOA 1V9PA 4J7KA 3STZC 3JATA 3APOA 2C2AA 2UUBO 1RP3B 1WLEA 1O9HA 4DV6B 2QR4A 5IYBO 4LF5O 2VS0A 4I4TA 4DV5O 3CSXA 3IFXA 2Q67A 1N32O 3UCSC 4DR2O 1FXHA 3JCZA 4KUMA 1V55C 2QTSA 3CXCU 4DYLA 4DV7B 1XHZA 2VQFB 1S5JA 3ZEDA 1N36B 3CJHB 3K08A 2X6BA 4D6TH 1PL4A 1MOFA 1KKCA 4YJ3B 4WFAV 1I7FA 1M93A 1E79G 4FLVA 2Q0OC 1K4CC 3FKSG 5BR8B 3SPCA 4OX9O 1I08A 4X64O 4LH7A 4P30A 1BMFG 3DSQA 1K9MW 3M8AA 2P4VA 5LP6C 3E8FA 3ABUA 2AW9A 2UXDB 2KB1A 2CH7B 3OEHG 4DV3O 2Q6AA 5GTHZ 4J10A 2EIJB 3G6EV 4DV2B 4R6ZA 2E3CA 1VQOV 1M5IA 1Y4MA 1R73A 2F1MA 2ATKC 1XEQA 1JFFA 1IX9A 5ITZB 3OFNG 5LA6B 3JD3A 2UXBB 4OXSA 4F6EA 1L0LH 3R66A 1QCEA 1KKDA 3AEIA 5L3DA 3QTCA 5LP6B 3JD4A 2WLNA 3X2QB 5LMNO 1WNSA 2X0LA 5KUMA 5GW7A 4MVRA 3OUFA 2BSKB 2XASA 4EFEA 4UV9A 1KU9A 4OGQB 4Q20A 4EB6B 5AG2A 1BHBA 3ZHTA 5LL6Y 4JYAB 3W7UA 4YHHB 1GN6A 4I4TB 4YY3B 3P32A 2YS8A 4IIJB 1MZFA 1SQGA 2W6JG 1KC8W 2LGWA 4YIOA 3JATB 5BZBA 2IJKA 3JD1A 1YXBA 2YIBA 4LF9B 1V55B 4LFAO 3CB2A 4GCZA 3AG3C 5HFLA 3N27A 3U11A 3NXSA 4EEQA 2UXNA 3GWOA 5EYPB 1SERA 1M4UA 4O2BB 1IBMO 2EULA 4LBEC 1TGOA 3W7WA 4JPRA 3P3PA 3LDCA 2RNBA 4K35A 2YEVB 5EZYB 2Q7GA 1NI8A 2GV9A 1DF4A 3RGBA 4GKJO 1YDXA 3K0DA 1PPJH 2UUCO 2WLHA 4RUFA 2XT9A 3ZHUA 4JI7B 1H2GA 4F6RA 5LMUB 4DK0A 3WB0A 2E76B 1K4DC 4CC5A 4Z2WA 5CBHA 4KXRA 1AJQA 4FMTA 1QLEB 4QE9A 1N34B 2WAMA 4PDRA 5JH7B 1NVPD 1AB3A 3ABKB 2DW4A 3OEEG 2E5LO 2E74B 3RVZA 3H01A 1AJPA 2IBZH 1VQPV 4YIPA 3F7YC 4DR6B 3U0ZA 1YTFD 4FFBB 4JI2B 5DECA 1GN2A 4E4EA 5KHIA 4NKGB 1EZJA 1QBZA 2LGQA 2CE4A 4NB5A 1KBHA 4YHHO 4LF6B 4LF9O 1GKFA 4IHJA 3OTFA 5KMGB 3ZIAG 5E79Z 1TA8A 5BR8O 2PZSA 4LFCB 4RQFA 3CC4V 3C3TA 3HKEB 3FD9A 1D5NA 2XHBA 3AK3A 4IYIA 5EC2C 3CS5A 4JTAB 1DGSA 4JYAO 5B1NA 3K3WA 1TUEB 2VWJA 2GUZB 4J7ZA 1SC5B 4JGSA 4PA7A 3RW0A 5KHHA 3OR7C 2UXCO 4FVMA 4RO2A 2QWOB 3HR0A 5LYJA 2WA3A 3QO5A 5CBGA 4X65B 3DGEA 1OJHA 2FYUH 3BEHA 4O4LB 2ZD9A 2M7WA 5JWPA 3E83A 4IHJB 5KMGA 1N33O 1Q6HA 4JI7O 3ZRWA 4TUYB 1NVPB 4DV0B 3KZIZ 4MSWC 1YITV 1GTOA 5FLXN 3JAWB 1M9NA 3CC7V 1BT8A 2B1IA 3ZRVA 4MW3A 1SQPH 5LXTA 3ZRXA 1JR9A 4CH6A 2JGUA 1VMGA 1FYJA 3SPGA 1AI5A 2HVKC 4X66B 4K0KB 3CCUV 3B4SA 4MVZA 3JAKB 5IWAO 3C3SA 2HHHO 3AK2A 4ICGA 1WPXA 1QHTA 3CCJV 1QLEC 4GKKO 2Z3YA 1IXMA 4PI2A 1PV0A 1FPOA 3B8NA 4FLTA 1FXKC 4OX9B 4JI8O 3EFFK 2QM4A 2CDYA 1FFXB 1KMIZ 2PYLA 4LFBO 1W59A 1I94B 2XAFA 3L73H 3H1HH 1JCHA 1TUBB 4NXMB 2EINB 4QGPA 5L3FA 5IJ0B 1PNLA 1ZLZA 2O57A 3FAVB 4I9QA 4DV6O 1FAFA 3F5TA 1AI7A 5KAIZ 1MG1A 5B66Z 4K3AA 2CGNA 1TVKB 4LNUA 5H5NA 4I9WA 2UU9O 1BQZA 1XMOB 4J11A 4H13B 1SA0B 3RYHB 4JI0B 4JI6B 2E5LB 4LWSA 4PV1B 4DRXB 1N34O 4BWAA 3ZHVA 3TGUH 2OIGA 2WLKA 3VQVA 3ZS8C 4QJFB 2ZXWC 1QNMA 3TETA 2M6YA 3T1HB 1IVSA 2DWDC 3J80N 4L8JA 3KKYA 5H6QA 3QO7A 4XDKA 1HNXO 2ZM6O 4LF8O 3CWBH 4IT5A 3EXAA 2KKWA 1COWG 3OW2U 4KFMA 5JVDB 2PGGA 4X66O 2DOSA 2PF4E 3THOA 1F4NA 5DM6V 4JZGA 2ZINA 1BZKA 2OYQA 1NR7A 2JEUA 5J9PC 3G71V 2JIZG 3L72H 2RN9A 2EIJC 2OIEA 1KP3A 4QPKA 3ZMSA 2QKSA 5H9CA 4I55A 1RSOB 4B3SO 4JAAA 2YSUB 2N05A 3TJTA 2JGDB 2PTMA 1BE3H 4XBFA 3BA8A 1KUQA 1BHAA 2L35A 2WLIB 3SJCC 4ZI7A 2MW2B 2X6AA 3K03A 1PKXA 2B9ZA 1ZL8B 5GONA 3T1YB 3D3IA 2HP8A 4CS3A 1A32A 3ASNC 5JCOC 4HNAB 2DYSB 4TQFA 2GHYA 1S3JA 3IC9A 2R70A 4LH6A 3W7XA 2OT5A 3A0HZ 1Z2GA 2DQ0A 4UB8Z 2YXYA 2JS3A 4GKJB 4KHPO 1NU1H 4G27B 5LYJB 2HEPA 1MSDA 1GM7A 2HG5C 3CC2V 4R7CA 1NR1A 1K7DA 1AI4A 1W2BU 2EZPA 1PL0A 1B04A 1HNXB 1U96A 2EJ7A 1XMQO 2A9HA 1NJIW 4FLXA 3AG3B 4ZOLA 4GYCB 1Q6UA 2JEXA 2QWQB 5LGTA 1AROP 4MT8A 1FJGB 1THZA 3ZN1A 4WFEA 1R3LC 3SYPA 4ZHQB 1G1XB 3D3QA 1KYOF 4MVQA 5KA5A 2PUSA 3D36A 2ZR2A 3MAQA 1F7YA 2N74A 3KG2A 1K97A 3RBZA 4C7UA 3GB7C 1F4MA 5LGUA 3ZBHA 2OWOA 4JYYA 2D3OW 2XUMA 2EIMC 2DQ3A 1XMOO 4JV5O 2X6CA 2RDCA 3AK1A 1YI2V 2D2CB 4JI1O 3ABTA 4H0LB 2ZCEA 4JYCA 2H3OA 2ZE6A 2EILC 4LC1A 4O4JA 2ZE7A 4LF5B 5C8YB 3RYFA 2BSKA 3AG4C 3HKBA 3P3NA 2FB5A 4I50B 2Z0AA 2JK5C 2AGAA 3KCXA 3IAYA 4HZ3A 1GK9A 1WJZA 2RCVA 2HKOA 3QO8A 5H6RA 5CMUA 1WPBA 3CPWU 4DV1B 2VRZA 1XUQA 2WLLA 1O9GA 4PI0A 1Y67A 3ETQA 4UCVA 2WLMA 3BAAA 3JAMN 3K04A 3ZJZA 4FK5C 3WU2Z 5LOVA 4MTFA 1HR0O 4UVCA 3ASOB 4JI5B 5CB4B 4WFFA 3SDLA 3E89A 1P84F 1AVMA 1WAZA 3A2FA 3CRMA 2YUAA 2OCHA 1RPRA 2LFSA 3CRCA 4DR4B 3EHBB 4FM2A 3ZN0A 2YDEA 4FLYA 1EBOA 3UM7A 2VQFO 2ITDC 5B1AC 4LCUC 2ARHA 2YI8A 4F6RB 3E86A 1QR9A 5LP6A 1XOUA 1AR1B 3UQ8A 4GT1A 3QF7A 1XNQB 4P9OA 5A2QN 1Q7YW 3OT7A 4UCUA 1Z5WA 4JZ2A 4JTDB 5CBFA 2CTPA 1EN5A 2AZ0A 5EYPA 3GVMA 1G8MA 3HKCB 3JAKA 3T4ZA 4MTXA 2OTLV 3CXHF 3OM3B 1SS3A 1Y74A 2ADQB 2P67A 1HNZB 4W4KA 3ABMC 5KHKA 3RYHA 3OGCC 2AZ2A 3LNNA 4UCOA 5TISZ 3WG7B 4J41A 3OTOO 5K1XA 1HR0B 3M99B 1YVWA 4ZBMA 4JI0O 1VQLV 4HNAA 4MS2A 3JD0A 2Y48A 4MTGA 1IDSA 3CCRV 4X1YB 5JJNB 5JQGA 5BMVA 4DV3B 3CP1A 3CMEV 3B40A 5LMNB 1HNZO 5IJ0A 5LGNA 4TV9A 4HAMA 1CEZA 5JJEB 3BVOA 4GX5A 1R6KA 3CCVV 4DR4O 2Q8VA 4B3SB 1YJNV 2B5UA 5JQGB 2ZNJA 2V7QG 2HFEC 3VQXA 4O4LA 4NTXA 1PM9A 3T4DA 2GTAA 2QWPB 2WSSG 1KP2A 4PDLA 3LDDA 2KSDA 2DWEC 2AHZA 1S5LZ 3OE7G 3VQYA 2L6LA 4GX0A 2BOBC 4NXNB 4DW1A 1YTFB 3H1KH 1OCCB 4CS2A 1YJWV 4O2AA 1VQKV 3JSNA 5FL7G 4ZKIA 1H8EG 4YY3O 2EJRA 1XREA 1US6A 2CGOA 2QGNA 1IBKB 2LW1A 1NS1A 4ZIBA 4L87A 1EZVH 1VF5B 4X20A 1SESA 4LP8A 1LR1A 2ZKOA 3ZHQA 1WN7A 4W4LA 3UT5B 5L3CA 4GLXA 2MK3A 1JJ2U 3K59A 2F95B 2NR5A 2R9RB 1EFRG 3QG5A 4PJ0Z 3AG2C 4DW0A 5IWAB 2HHHB 1VEWA 3CCMV 3ML0A 3E8BA 1CXZB 2EIKC 4I0XA 1GN4A 3Q4HA 3CE2A 1K92A 4OPHA 4UFZA 5E1AC 4DV2O 4PDMA 2CTWA 4FM0A 3J81N 2YXHA 3G67A 1B06A 1SQBH 4TV8A 3DTUB 2BOCC 3A8TA 4DV5B 4DR1B 2JS5A 2LP7A 4LF7O 3LUTB 3K06A 1VQMV 2GUZA 2XTAA 2JVDA 4LF8B 1S76D 3BY6A 1GM8A 3B09A 1R6NA 1Y6XA 4B3RO 1XL4A 4PA3A 2QSAA 1K3EA 3RYFB 3JALB 3N2GA 3N2GB 4J9YB 5KUKA 4JI1B 2GTSA 3AG4B 2K9PA 4RAIA 1L1FA 4WBNA 2BTQB 2F93B 4N23A 3ETEA 1Q43A 1Q6IA 3U10A 1TAEA 1XHXA 1RM1B 5KHGA 3CEIA 3ZHRA 3O65A 1N33B 3IJ4A 2PY5A 2E75B 3OGIB 3QVNA 5L3GA 1J5EO 1MABG 2FMLA 4ZOLB 4TOIA 2IH1C 2P06A 1AJNA 2XAGA 4PD4F 4X65O 4H44B 4I7ZB 1MNGA 1NTKH 1Y76A 1SKVA 4DUZO 1R3JC 1YSCA 5EBMC 1FXKA 4DR5B 2DYRB 4O4HB 3N2KA 3N2KB 3ICXA 2VQEB 2UUAB 1AI6A 3S3WA 2NN4A 2VQEO 1FFTB 3JD2A 3CRRA 2K1EA 2R9AA 1AILA 1FS0G 3SGIA 4X64B 1K8AW 4DR6O 5IYCO 3D36C 4JI3B 2CUGA 1QVGU 2QM7A 3H1JH 3ZHSA 1RFYA 1VP7A 5J2TB 4KL1A 1GN3A 3LSSA 3CRAA 4O4IA 2WLLB 2BTOA 5C93A 4EB6A 1D2DA 3A0RA 4YJ2B 2F43G 1JOYA 2Q4PA 4JAUA 2OCCC 1VQ8V 1VQ4V 1YJ9V 4BW5A 2QWNB 1B3QA 2ZM6B 3BPZA 1EN6A 3X2QC 2JDIG 1R3KC 1SQQH 3H1IH 2P90A 4TQDA 1W0KG 4A5UB 3JYCA 2H8PC 4K8ZA 4X20B 2CAZC 4H33A 3UO3A 1S77D 2CH7A 4WFGA 5KX5B 5HFMA 3SPHA 3ZRSA 5LHIA 2KQXA 3MHSC 2YEVA 5EZYA 2CTQA 1GO3F 2ODMA 1PD3A 4B3TO 1Q5OA 3CCQV 4K8XA 1WB7A 1HNWB 4QNHB 4LF7B 4LWSB 1ROPA 2WPDG 3RN4A 3CMAV 2ZT9B 5B1OA 4BR6A 3B8MA 3FB6C 1M90W 2UUAO 1ORQC 4IIJA 4UCRA 4JI2O 1Y76B 4UCSA 1P7GA 1KB9F 2DE0X 3MD0A 3ZMTA 1XILA 1JPXA 2GBOA 4GKKB 4YJ2A 1XI1A 2VWKA 3L9DA 4YJ3A 3K5NA 5JCOA 1K5QA 4O4IB 1Y74B 4NR1A 1NBMG 5EK0A 1XNRB 3E35A 2A7WA 3G4SV 2ITCC 2Q5ZA 5EIBC 4J7JA 2IJHA 2LW7A 1PNKA 3P30A 1M57C 1N0JA 4PA6A 3CCSV 1MSWD 2CK3G 5B3SC 1NH2B 4CS4A 1L8DA 2LO1A 3CCLV 3IGAC 1YZBA 4IL6Z 3E8HA 5ITZA 2DYRC 1GM9A 3CCEV 5IYZB 2YXLA 1JJOA 3K5OA 4FLZA 3OR6C 3SJAC 3E2EA 2QKCA 1I0HA 1IBKO 1K33A 1V54C 1HNWO 1FXKB 5EIBD 1ZL8A 4NVPA 4G2KA 1FKAO 2XNDG 3L74H 4U7NA 1SZTA 1X59A 3T2MA 1JVMA 4AILC 1Q86W 5IT9N 3CHXA 3HKDA 1OHHG 1Z5VA 4R8CA 5IY5C 2F4VO 1VQ5V 4UVBA 2ZDIA 4JAVA 4AI8A 4JI3O 3JARB 4PHZA 2XAJA 3G80A 4DV7O 3L75H 4NYKA 2ZQMA 1NTZH 3Q4HB 1BL8A 4ABMA 2ZDIC 5H2FZ 4MVUA 3CX5F 3BRCA 3DC5A 3K9SA 1KECA 1PP9H 1JFFB 2F4VB 3HKEA 3APQA 3FB5C 1RSOA 3SJQC 3ETDA 2W0XA 1R6TA 1H38A 4DR7O 5CB4A 1Q82W 2OCCB 1IBLO 2QWRB 5C8YA 2HVJC 3OTOB 1B6QA 3LSQA 2XAHA 2YICA 2RJZA 4D7SA 2ZXWB 2IH3C 3L71H 4FFBA 1OCOC 3T1YO 3AG1B 1IBMB 4LNUB 3ZX6A 2GDSA 2HR3A 2EIKB 1I94O 3LNMB 1VQ6V 2UUCB 4F4LA 4DUYO
chains in the Genus database with same CATH topology
1ZX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX3 A; 
#chains in the Genus database with same CATH topology
 4E2L A;  4QPJ A;  3FB8 C;  1TUB A;  1DLB A;  3C90 A;  2UXB O;  2HLD G;  2YI9 A;  2P7T C;  4EFB A;  1Q3E A;  1F51 A;  2EX3 A;  3M7M X;  2Q73 A;  3R65 A;  1DF5 A;  1ZX3 A;  4O4H A;  1F23 A;  4WCE V;  2DJV A;  5IY5 B;  4UVA A;  5J2U A;  4P2Z A;  3E8G A;  5CA0 A;  3WFV A;  3SPJ A;  1VF7 A;  5BMV B;  1OCC C;  4LFC O;  3UO2 A;  2CTR A;  4DR2 B;  1P49 A;  2KG7 A;  1BS3 A;  2P5O A;  2ADP A;  2IU0 A;  3K58 A;  3QNE A;  1HDJ A;  1OCZ C;  1NTM H;  3L70 H;  3IC7 A;  1ENV A;  5IYZ A;  5IJ9 B;  1HWY A;  1RM1 C;  5D5P A;  3W7S A;  4B7E A;  2XOK G;  1H2S B;  1DTO A;  5A9G A;  5L3E A;  1HP8 A;  1M1K W;  3BHP A;  2UUB B;  2UXX A;  1XQ8 A;  1VIB A;  2JRI A;  3RFR A;  4AQY B;  2NLJ C;  3OAA G;  1UFI A;  3B2E E;  1M57 B;  3I55 V;  1JA8 A;  2Y69 B;  4B3T B;  5LXT B;  4LFB B;  3ZMU A;  4DV0 O;  3OD4 A;  2N04 A;  1URF A;  3NR7 A;  3DC6 A;  5FPO A;  1N4C A;  1AP5 A;  3AG1 C;  4ZHQ A;  5JVD A;  1BCC H;  1NT2 B;  1OCO B;  4DR1 O;  5LHG A;  4NTW A;  3ABM B;  4FPP A;  4CZZ A;  1GMG A;  4NTY A;  1SZX A;  2QJ1 A;  5EBL C;  2Q0A A;  3JAL A;  2AHY A;  4H37 A;  3CYO A;  4JTC B;  3ZMV A;  1J5E B;  3FB7 C;  1X4T A;  4J9Z B;  4GX1 A;  2Z5U A;  3AG2 B;  2KG7 B;  5FNV B;  5GTI Z;  1XL6 A;  4YXW G;  5D5Q A;  1M56 B;  3CD6 V;  4DXW A;  2B1G A;  3B77 A;  4Q6G A;  5EC1 C;  4DO2 A;  1SA0 A;  1PNM A;  1XDC A;  1IBL B;  2JJ1 G;  4MVS A;  2XAQ A;  2YC0 A;  3SPI A;  2EBO A;  5L3B A;  5IYD O;  1ZAU A;  2A79 B;  2Y0P A;  4U3J A;  1K5S A;  2DMX A;  4MW8 A;  1XNR O;  2QKA A;  5KX5 A;  2X7R B;  1NH2 D;  2ETN A;  1OZ0 A;  4U3F H;  2ZIM A;  2QEX V;  1YF2 A;  2F66 C;  4DUY B;  1VQ7 V;  4I0X B;  3HKB B;  3OMI B;  3ABK C;  1YEW A;  3BCC H;  1XNQ O;  3SYC A;  2WA4 A;  4BIO A;  1ZWI C;  4FFK A;  4X89 A;  1WP8 A;  2ILM A;  3J7A U;  1HW7 A;  1XBL A;  2YIB D;  5CA3 A;  4FM1 A;  4NXN O;  4RWU A;  3I5D A;  5CN0 A;  4UV8 A;  4I50 A;  4LR3 A;  3FYI B;  5LOV B;  4IYH A;  4XDL A;  2IU3 A;  4UUJ C;  1N32 B;  3RYC A;  4B3R B;  3BAB A;  4JF3 A;  3UKM A;  4JI6 O;  5KAF Z;  3F5W C;  3STL C;  2RQ6 A;  1JQ0 A;  3HB3 B;  5B5E Z;  5B3S B;  4O2A B;  2H94 A;  1TVK A;  2IJJ A;  1WB8 A;  3F7V C;  1MMM A;  1NZ6 A;  4WFH A;  5CA1 B;  5KHJ A;  4FIP C;  2EIL B;  2A3Q A;  1LNQ A;  2Y4U A;  1WP7 A;  4FJC C;  4X1Y A;  1JMK C;  4BAY A;  3JAR A;  1CPY A;  3TXS A;  1KD1 W;  4TV9 B;  4DRX A;  3WG7 C;  4PA4 A;  4Z1M G;  2YIA A;  4GX2 A;  2Q69 A;  4QIW F;  2ZR3 A;  5LA6 A;  4J42 A;  2JJ2 G;  4WF9 V;  2UXD O;  4UXN A;  4X1I B;  1T5E A;  1QQC A;  2HJD A;  4DV4 B;  1I5Y A;  1H2M A;  3A0B Z;  1G4Y B;  4HBN A;  4TT3 G;  3SR2 C;  4I5S A;  4JV5 B;  2UXC B;  3ETG A;  4OPA A;  4AQY O;  1H2K A;  3OUS A;  2BTQ A;  3RYC B;  4Z1V A;  4LF4 O;  3VQW A;  4FLW A;  1KQS U;  5FNV A;  3I56 V;  2ZE5 A;  4B7K A;  2P4K A;  3SYA A;  1GAX A;  1U97 A;  4KHP B;  5K1P A;  1SF9 A;  1L0N H;  3RT3 C;  2IW5 A;  3EVK A;  4DV1 O;  4X62 O;  4DR3 B;  4PA9 A;  3ZRW B;  1AR4 A;  3JAS A;  3CRQ A;  4CC6 A;  4MVM A;  4CH5 A;  1LUW A;  3K57 A;  4DR5 O;  1GRJ A;  2RMK B;  3DXR B;  4ZI7 B;  1G6U A;  1AR5 A;  2BCC H;  3K0G A;  2QA4 V;  3ZCC A;  4LFA B;  1FXV A;  3TXQ A;  4TSF G;  5F2V O;  3WB1 A;  3KCY A;  4N21 A;  4XDJ A;  1EM1 A;  1H2L A;  1FJG O;  3SYO A;  3W7T A;  1UJW B;  3TCU A;  1QLN A;  2P22 C;  3VBB A;  1E1Q G;  4I55 B;  3ABL B;  4CH4 A;  2IJI A;  3FAV A;  2DN9 A;  4UCT A;  3RVY A;  1Q8I A;  2AXT Z;  2ZE8 A;  4X8A A;  1K73 W;  4U7O A;  2Q9L A;  1VQN V;  4PDV A;  4O4J B;  1OCR B;  2HJF C;  1JX9 A;  3ZMZ A;  4LF4 B;  1SRY A;  3TK1 A;  1ZUQ A;  3H1L H;  5IDJ A;  4O2B A;  5EBW C;  4BW9 A;  3MDS A;  2IM9 A;  1EN4 A;  1FD9 A;  3FX7 A;  1DK1 A;  3UT5 A;  1ZSP A;  4GUN A;  3RWR D;  2ZNI A;  2F23 A;  4DR3 O;  4G28 B;  5LMU O;  4MTO A;  4B08 A;  1BSM A;  4KP4 A;  5BXZ A;  1YCI A;  4D7T A;  1ZTE A;  2Q7E A;  5BY1 A;  5KLV H;  2QTO A;  4DK1 A;  2NNU A;  4B3M B;  5B1B C;  2BE3 A;  1OV9 A;  3LDE A;  4U3J B;  1QU7 A;  4PEL A;  1H8H G;  4RQE A;  4R50 A;  3G6B A;  3WB2 A;  4EKW A;  4UB6 Z;  4TV8 B;  1Q81 W;  1N8R W;  1AP6 A;  4P9P A;  4DV4 O;  4LF6 O;  1S72 V;  1N36 O;  3PJS K;  3HKC A;  3VOU A;  4ASU G;  2P6J A;  3HPL C;  3FYE B;  4FZ1 A;  3SJB C;  3LSU A;  2DYS C;  2PYJ A;  2A0L A;  3ASN B;  3RYI B;  2Y4T A;  3T1H O;  2QE7 G;  1CP9 A;  1UPG A;  4DR7 B;  2V1D A;  4CH3 A;  3T1C A;  1QR8 A;  1SQX H;  2G38 A;  2YID A;  4CBC A;  4X1K A;  1LUV A;  5GON B;  1YIJ V;  1IUR A;  2LFR A;  1J95 A;  3DXR A;  3OMA B;  1BGY H;  1QVF U;  2OTJ V;  1I5X A;  4JI8 B;  4TWK A;  3JAW A;  5LBQ A;  2GSM B;  1N0N A;  2PI5 A;  4WFB V;  3O9O A;  1VAR A;  3ABL C;  5J2T A;  1SQF A;  1VF6 C;  1Q90 D;  2W6I G;  1SQV H;  2A06 H;  1S0V A;  2Y0I A;  2WWW A;  1IZ3 A;  1GH6 A;  1VF6 A;  4RUE A;  2WLI A;  1K34 A;  3AG7 A;  1M56 C;  4JYB A;  3H9V A;  5B1A B;  4JI5 O;  3JSL A;  3RYI A;  2ZIO A;  2FL4 A;  1NKD A;  3PN1 A;  4J80 A;  2QDO A;  3JAS B;  1IXB A;  4DUZ B;  4TUY A;  3BFR A;  1D5A A;  2WLJ A;  1Y66 A;  1YHQ V;  2JGD A;  3E22 B;  3GWK C;  3ASO C;  3SYQ A;  4FZ0 A;  1E1R G;  4MVO A;  1MA1 A;  5DED A;  4AHC A;  1MZE A;  4X1K B;  2EZO A;  3JCU Z;  2FTK A;  4X9Q A;  2Q7H A;  5FPR A;  2Y69 C;  4IGG A;  5CA0 B;  5J2U B;  1S5H C;  3K79 A;  2R9I A;  5LHH A;  1P7B A;  3CJH A;  1SET A;  4HYO A;  3BA9 A;  5B1B B;  4BIZ A;  5JJJ B;  4X1I A;  2UU9 B;  1H2N A;  4FLU A;  1VQ9 V;  5JH7 A;  2EIN C;  3HKD B;  2PI4 A;  5CA1 A;  2V4D A;  4WBN B;  4X62 B;  5IJ9 A;  2R72 A;  3OMN B;  1WA8 A;  4K0K O;  3K9A A;  1R3I C;  4GZR B;  2EIM B;  1W0J G;  3S3X A;  3D8C A;  2FKX A;  1OCZ B;  4QE7 A;  3FFQ A;  1OCR C;  5KA6 A;  1R1B A;  3K5L A;  4BIU A;  1WA8 B;  1NQT A;  1FFX A;  3MHH C;  4B3M O;  2LQT A;  4JAS A;  4JI4 O;  1BQ0 A;  2QM8 A;  5DN6 G;  1V54 B;  1XMQ B;  4JI4 B;  4X88 A;  2LJ2 A;  3K5M A;  5IE9 A;  1P4R A;  2Q68 A;  2W0F C;  3E22 A;  4NXM O;  1RPO A;  1V9P A;  4J7K A;  3STZ C;  3JAT A;  3APO A;  2C2A A;  2UUB O;  1RP3 B;  1WLE A;  1O9H A;  4DV6 B;  2QR4 A;  5IYB O;  4LF5 O;  2VS0 A;  4I4T A;  4DV5 O;  3CSX A;  3IFX A;  2Q67 A;  1N32 O;  3UCS C;  4DR2 O;  1FXH A;  3JCZ A;  4KUM A;  1V55 C;  2QTS A;  3CXC U;  4DYL A;  4DV7 B;  1XHZ A;  2VQF B;  1S5J A;  3ZED A;  1N36 B;  3CJH B;  3K08 A;  2X6B A;  4D6T H;  1PL4 A;  1MOF A;  1KKC A;  4YJ3 B;  4WFA V;  1I7F A;  1M93 A;  1E79 G;  4FLV A;  2Q0O C;  1K4C C;  3FKS G;  5BR8 B;  3SPC A;  4OX9 O;  1I08 A;  4X64 O;  4LH7 A;  4P30 A;  1BMF G;  3DSQ A;  1K9M W;  3M8A A;  2P4V A;  5LP6 C;  3E8F A;  3ABU A;  2AW9 A;  2UXD B;  2KB1 A;  2CH7 B;  3OEH G;  4DV3 O;  2Q6A A;  5GTH Z;  4J10 A;  2EIJ B;  3G6E V;  4DV2 B;  4R6Z A;  2E3C A;  1VQO V;  1M5I A;  1Y4M A;  1R73 A;  2F1M A;  2ATK C;  1XEQ A;  1JFF A;  1IX9 A;  5ITZ B;  3OFN G;  5LA6 B;  3JD3 A;  2UXB B;  4OXS A;  4F6E A;  1L0L H;  3R66 A;  1QCE A;  1KKD A;  3AEI A;  5L3D A;  3QTC A;  5LP6 B;  3JD4 A;  2WLN A;  3X2Q B;  5LMN O;  1WNS A;  2X0L A;  5KUM A;  5GW7 A;  4MVR A;  3OUF A;  2BSK B;  2XAS A;  4EFE A;  4UV9 A;  1KU9 A;  4OGQ B;  4Q20 A;  4EB6 B;  5AG2 A;  1BHB A;  3ZHT A;  5LL6 Y;  4JYA B;  3W7U A;  4YHH B;  1GN6 A;  4I4T B;  4YY3 B;  3P32 A;  2YS8 A;  4IIJ B;  1MZF A;  1SQG A;  2W6J G;  1KC8 W;  2LGW A;  4YIO A;  3JAT B;  5BZB A;  2IJK A;  3JD1 A;  1YXB A;  2YIB A;  4LF9 B;  1V55 B;  4LFA O;  3CB2 A;  4GCZ A;  3AG3 C;  5HFL A;  3N27 A;  3U11 A;  3NXS A;  4EEQ A;  2UXN A;  3GWO A;  5EYP B;  1SER A;  1M4U A;  4O2B B;  1IBM O;  2EUL A;  4LBE C;  1TGO A;  3W7W A;  4JPR A;  3P3P A;  3LDC A;  2RNB A;  4K35 A;  2YEV B;  5EZY B;  2Q7G A;  1NI8 A;  2GV9 A;  1DF4 A;  3RGB A;  4GKJ O;  1YDX A;  3K0D A;  1PPJ H;  2UUC O;  2WLH A;  4RUF A;  2XT9 A;  3ZHU A;  4JI7 B;  1H2G A;  4F6R A;  5LMU B;  4DK0 A;  3WB0 A;  2E76 B;  1K4D C;  4CC5 A;  4Z2W A;  5CBH A;  4KXR A;  1AJQ A;  4FMT A;  1QLE B;  4QE9 A;  1N34 B;  2WAM A;  4PDR A;  5JH7 B;  1NVP D;  1AB3 A;  3ABK B;  2DW4 A;  3OEE G;  2E5L O;  2E74 B;  3RVZ A;  3H01 A;  1AJP A;  2IBZ H;  1VQP V;  4YIP A;  3F7Y C;  4DR6 B;  3U0Z A;  1YTF D;  4FFB B;  4JI2 B;  5DEC A;  1GN2 A;  4E4E A;  5KHI A;  4NKG B;  1EZJ A;  1QBZ A;  2LGQ A;  2CE4 A;  4NB5 A;  1KBH A;  4YHH O;  4LF6 B;  4LF9 O;  1GKF A;  4IHJ A;  3OTF A;  5KMG B;  3ZIA G;  5E79 Z;  1TA8 A;  5BR8 O;  2PZS A;  4LFC B;  4RQF A;  3CC4 V;  3C3T A;  3HKE B;  3FD9 A;  1D5N A;  2XHB A;  3AK3 A;  4IYI A;  5EC2 C;  3CS5 A;  4JTA B;  1DGS A;  4JYA O;  5B1N A;  3K3W A;  1TUE B;  2VWJ A;  2GUZ B;  4J7Z A;  1SC5 B;  4JGS A;  4PA7 A;  3RW0 A;  5KHH A;  3OR7 C;  2UXC O;  4FVM A;  4RO2 A;  2QWO B;  3HR0 A;  5LYJ A;  2WA3 A;  3QO5 A;  5CBG A;  4X65 B;  3DGE A;  1OJH A;  2FYU H;  3BEH A;  4O4L B;  2ZD9 A;  2M7W A;  5JWP A;  3E83 A;  4IHJ B;  5KMG A;  1N33 O;  1Q6H A;  4JI7 O;  3ZRW A;  4TUY B;  1NVP B;  4DV0 B;  3KZI Z;  4MSW C;  1YIT V;  1GTO A;  5FLX N;  3JAW B;  1M9N A;  3CC7 V;  1BT8 A;  2B1I A;  3ZRV A;  4MW3 A;  1SQP H;  5LXT A;  3ZRX A;  1JR9 A;  4CH6 A;  2JGU A;  1VMG A;  1FYJ A;  3SPG A;  1AI5 A;  2HVK C;  4X66 B;  4K0K B;  3CCU V;  3B4S A;  4MVZ A;  3JAK B;  5IWA O;  3C3S A;  2HHH O;  3AK2 A;  4ICG A;  1WPX A;  1QHT A;  3CCJ V;  1QLE C;  4GKK O;  2Z3Y A;  1IXM A;  4PI2 A;  1PV0 A;  1FPO A;  3B8N A;  4FLT A;  1FXK C;  4OX9 B;  4JI8 O;  3EFF K;  2QM4 A;  2CDY A;  1FFX B;  1KMI Z;  2PYL A;  4LFB O;  1W59 A;  1I94 B;  2XAF A;  3L73 H;  3H1H H;  1JCH A;  1TUB B;  4NXM B;  2EIN B;  4QGP A;  5L3F A;  5IJ0 B;  1PNL A;  1ZLZ A;  2O57 A;  3FAV B;  4I9Q A;  4DV6 O;  1FAF A;  3F5T A;  1AI7 A;  5KAI Z;  1MG1 A;  5B66 Z;  4K3A A;  2CGN A;  1TVK B;  4LNU A;  5H5N A;  4I9W A;  2UU9 O;  1BQZ A;  1XMO B;  4J11 A;  4H13 B;  1SA0 B;  3RYH B;  4JI0 B;  4JI6 B;  2E5L B;  4LWS A;  4PV1 B;  4DRX B;  1N34 O;  4BWA A;  3ZHV A;  3TGU H;  2OIG A;  2WLK A;  3VQV A;  3ZS8 C;  4QJF B;  2ZXW C;  1QNM A;  3TET A;  2M6Y A;  3T1H B;  1IVS A;  2DWD C;  3J80 N;  4L8J A;  3KKY A;  5H6Q A;  3QO7 A;  4XDK A;  1HNX O;  2ZM6 O;  4LF8 O;  3CWB H;  4IT5 A;  3EXA A;  2KKW A;  1COW G;  3OW2 U;  4KFM A;  5JVD B;  2PGG A;  4X66 O;  2DOS A;  2PF4 E;  3THO A;  1F4N A;  5DM6 V;  4JZG A;  2ZIN A;  1BZK A;  2OYQ A;  1NR7 A;  2JEU A;  5J9P C;  3G71 V;  2JIZ G;  3L72 H;  2RN9 A;  2EIJ C;  2OIE A;  1KP3 A;  4QPK A;  3ZMS A;  2QKS A;  5H9C A;  4I55 A;  1RSO B;  4B3S O;  4JAA A;  2YSU B;  2N05 A;  3TJT A;  2JGD B;  2PTM A;  1BE3 H;  4XBF A;  3BA8 A;  1KUQ A;  1BHA A;  2L35 A;  2WLI B;  3SJC C;  4ZI7 A;  2MW2 B;  2X6A A;  3K03 A;  1PKX A;  2B9Z A;  1ZL8 B;  5GON A;  3T1Y B;  3D3I A;  2HP8 A;  4CS3 A;  1A32 A;  3ASN C;  5JCO C;  4HNA B;  2DYS B;  4TQF A;  2GHY A;  1S3J A;  3IC9 A;  2R70 A;  4LH6 A;  3W7X A;  2OT5 A;  3A0H Z;  1Z2G A;  2DQ0 A;  4UB8 Z;  2YXY A;  2JS3 A;  4GKJ B;  4KHP O;  1NU1 H;  4G27 B;  5LYJ B;  2HEP A;  1MSD A;  1GM7 A;  2HG5 C;  3CC2 V;  4R7C A;  1NR1 A;  1K7D A;  1AI4 A;  1W2B U;  2EZP A;  1PL0 A;  1B04 A;  1HNX B;  1U96 A;  2EJ7 A;  1XMQ O;  2A9H A;  1NJI W;  4FLX A;  3AG3 B;  4ZOL A;  4GYC B;  1Q6U A;  2JEX A;  2QWQ B;  5LGT A;  1ARO P;  4MT8 A;  1FJG B;  1THZ A;  3ZN1 A;  4WFE A;  1R3L C;  3SYP A;  4ZHQ B;  1G1X B;  3D3Q A;  1KYO F;  4MVQ A;  5KA5 A;  2PUS A;  3D36 A;  2ZR2 A;  3MAQ A;  1F7Y A;  2N74 A;  3KG2 A;  1K97 A;  3RBZ A;  4C7U A;  3GB7 C;  1F4M A;  5LGU A;  3ZBH A;  2OWO A;  4JYY A;  2D3O W;  2XUM A;  2EIM C;  2DQ3 A;  1XMO O;  4JV5 O;  2X6C A;  2RDC A;  3AK1 A;  1YI2 V;  2D2C B;  4JI1 O;  3ABT A;  4H0L B;  2ZCE A;  4JYC A;  2H3O A;  2ZE6 A;  2EIL C;  4LC1 A;  4O4J A;  2ZE7 A;  4LF5 B;  5C8Y B;  3RYF A;  2BSK A;  3AG4 C;  3HKB A;  3P3N A;  2FB5 A;  4I50 B;  2Z0A A;  2JK5 C;  2AGA A;  3KCX A;  3IAY A;  4HZ3 A;  1GK9 A;  1WJZ A;  2RCV A;  2HKO A;  3QO8 A;  5H6R A;  5CMU A;  1WPB A;  3CPW U;  4DV1 B;  2VRZ A;  1XUQ A;  2WLL A;  1O9G A;  4PI0 A;  1Y67 A;  3ETQ A;  4UCV A;  2WLM A;  3BAA A;  3JAM N;  3K04 A;  3ZJZ A;  4FK5 C;  3WU2 Z;  5LOV A;  4MTF A;  1HR0 O;  4UVC A;  3ASO B;  4JI5 B;  5CB4 B;  4WFF A;  3SDL A;  3E89 A;  1P84 F;  1AVM A;  1WAZ A;  3A2F A;  3CRM A;  2YUA A;  2OCH A;  1RPR A;  2LFS A;  3CRC A;  4DR4 B;  3EHB B;  4FM2 A;  3ZN0 A;  2YDE A;  4FLY A;  1EBO A;  3UM7 A;  2VQF O;  2ITD C;  5B1A C;  4LCU C;  2ARH A;  2YI8 A;  4F6R B;  3E86 A;  1QR9 A;  5LP6 A;  1XOU A;  1AR1 B;  3UQ8 A;  4GT1 A;  3QF7 A;  1XNQ B;  4P9O A;  5A2Q N;  1Q7Y W;  3OT7 A;  4UCU A;  1Z5W A;  4JZ2 A;  4JTD B;  5CBF A;  2CTP A;  1EN5 A;  2AZ0 A;  5EYP A;  3GVM A;  1G8M A;  3HKC B;  3JAK A;  3T4Z A;  4MTX A;  2OTL V;  3CXH F;  3OM3 B;  1SS3 A;  1Y74 A;  2ADQ B;  2P67 A;  1HNZ B;  4W4K A;  3ABM C;  5KHK A;  3RYH A;  3OGC C;  2AZ2 A;  3LNN A;  4UCO A;  5TIS Z;  3WG7 B;  4J41 A;  3OTO O;  5K1X A;  1HR0 B;  3M99 B;  1YVW A;  4ZBM A;  4JI0 O;  1VQL V;  4HNA A;  4MS2 A;  3JD0 A;  2Y48 A;  4MTG A;  1IDS A;  3CCR V;  4X1Y B;  5JJN B;  5JQG A;  5BMV A;  4DV3 B;  3CP1 A;  3CME V;  3B40 A;  5LMN B;  1HNZ O;  5IJ0 A;  5LGN A;  4TV9 A;  4HAM A;  1CEZ A;  5JJE B;  3BVO A;  4GX5 A;  1R6K A;  3CCV V;  4DR4 O;  2Q8V A;  4B3S B;  1YJN V;  2B5U A;  5JQG B;  2ZNJ A;  2V7Q G;  2HFE C;  3VQX A;  4O4L A;  4NTX A;  1PM9 A;  3T4D A;  2GTA A;  2QWP B;  2WSS G;  1KP2 A;  4PDL A;  3LDD A;  2KSD A;  2DWE C;  2AHZ A;  1S5L Z;  3OE7 G;  3VQY A;  2L6L A;  4GX0 A;  2BOB C;  4NXN B;  4DW1 A;  1YTF B;  3H1K H;  1OCC B;  4CS2 A;  1YJW V;  4O2A A;  1VQK V;  3JSN A;  5FL7 G;  4ZKI A;  1H8E G;  4YY3 O;  2EJR A;  1XRE A;  1US6 A;  2CGO A;  2QGN A;  1IBK B;  2LW1 A;  1NS1 A;  4ZIB A;  4L87 A;  1EZV H;  1VF5 B;  4X20 A;  1SES A;  4LP8 A;  1LR1 A;  2ZKO A;  3ZHQ A;  1WN7 A;  4W4L A;  3UT5 B;  5L3C A;  4GLX A;  2MK3 A;  1JJ2 U;  3K59 A;  2F95 B;  2NR5 A;  2R9R B;  1EFR G;  3QG5 A;  4PJ0 Z;  3AG2 C;  4DW0 A;  5IWA B;  2HHH B;  1VEW A;  3CCM V;  3ML0 A;  3E8B A;  1CXZ B;  2EIK C;  4I0X A;  1GN4 A;  3Q4H A;  3CE2 A;  1K92 A;  4OPH A;  4UFZ A;  5E1A C;  4DV2 O;  4PDM A;  2CTW A;  4FM0 A;  3J81 N;  2YXH A;  3G67 A;  1B06 A;  1SQB H;  4TV8 A;  3DTU B;  2BOC C;  3A8T A;  4DV5 B;  4DR1 B;  2JS5 A;  2LP7 A;  4LF7 O;  3LUT B;  3K06 A;  1VQM V;  2GUZ A;  2XTA A;  2JVD A;  4LF8 B;  1S76 D;  3BY6 A;  1GM8 A;  3B09 A;  1R6N A;  1Y6X A;  4B3R O;  1XL4 A;  4PA3 A;  2QSA A;  1K3E A;  3RYF B;  3JAL B;  3N2G A;  3N2G B;  4J9Y B;  5KUK A;  4JI1 B;  2GTS A;  3AG4 B;  2K9P A;  4RAI A;  1L1F A;  4WBN A;  2BTQ B;  2F93 B;  4N23 A;  3ETE A;  1Q43 A;  1Q6I A;  3U10 A;  1TAE A;  1XHX A;  1RM1 B;  5KHG A;  3CEI A;  3ZHR A;  3O65 A;  1N33 B;  3IJ4 A;  2PY5 A;  2E75 B;  3OGI B;  3QVN A;  5L3G A;  1J5E O;  1MAB G;  2FML A;  4ZOL B;  4TOI A;  2IH1 C;  2P06 A;  1AJN A;  2XAG A;  4PD4 F;  4X65 O;  4H44 B;  4I7Z B;  1MNG A;  1NTK H;  1Y76 A;  1SKV A;  4DUZ O;  1R3J C;  1YSC A;  5EBM C;  1FXK A;  4DR5 B;  2DYR B;  4O4H B;  3N2K A;  3N2K B;  3ICX A;  2VQE B;  2UUA B;  1AI6 A;  3S3W A;  2NN4 A;  2VQE O;  1FFT B;  3JD2 A;  3CRR A;  2K1E A;  2R9A A;  1AIL A;  1FS0 G;  3SGI A;  4X64 B;  1K8A W;  4DR6 O;  5IYC O;  3D36 C;  4JI3 B;  2CUG A;  1QVG U;  2QM7 A;  3H1J H;  3ZHS A;  1RFY A;  1VP7 A;  5J2T B;  4KL1 A;  1GN3 A;  3LSS A;  3CRA A;  4O4I A;  2WLL B;  2BTO A;  5C93 A;  4EB6 A;  1D2D A;  3A0R A;  4YJ2 B;  2F43 G;  1JOY A;  2Q4P A;  4JAU A;  2OCC C;  1VQ8 V;  1VQ4 V;  1YJ9 V;  4BW5 A;  2QWN B;  1B3Q A;  2ZM6 B;  3BPZ A;  1EN6 A;  3X2Q C;  2JDI G;  1R3K C;  1SQQ H;  3H1I H;  2P90 A;  4TQD A;  1W0K G;  4A5U B;  3JYC A;  2H8P C;  4K8Z A;  4X20 B;  2CAZ C;  4H33 A;  3UO3 A;  1S77 D;  2CH7 A;  4WFG A;  5KX5 B;  5HFM A;  3SPH A;  3ZRS A;  5LHI A;  2KQX A;  3MHS C;  2YEV A;  5EZY A;  2CTQ A;  1GO3 F;  2ODM A;  1PD3 A;  4B3T O;  1Q5O A;  3CCQ V;  4K8X A;  1WB7 A;  1HNW B;  4QNH B;  4LF7 B;  4LWS B;  1ROP A;  2WPD G;  3RN4 A;  3CMA V;  2ZT9 B;  5B1O A;  4BR6 A;  3B8M A;  3FB6 C;  1M90 W;  2UUA O;  1ORQ C;  4IIJ A;  4UCR A;  4JI2 O;  1Y76 B;  4UCS A;  1P7G A;  1KB9 F;  2DE0 X;  3MD0 A;  3ZMT A;  1XIL A;  1JPX A;  2GBO A;  4GKK B;  4YJ2 A;  1XI1 A;  2VWK A;  3L9D A;  4YJ3 A;  3K5N A;  5JCO A;  1K5Q A;  4O4I B;  1Y74 B;  4NR1 A;  1NBM G;  5EK0 A;  1XNR B;  3E35 A;  2A7W A;  3G4S V;  2ITC C;  2Q5Z A;  5EIB C;  4J7J A;  2IJH A;  2LW7 A;  1PNK A;  3P30 A;  1M57 C;  1N0J A;  4PA6 A;  3CCS V;  1MSW D;  2CK3 G;  5B3S C;  1NH2 B;  4CS4 A;  1L8D A;  2LO1 A;  3CCL V;  3IGA C;  1YZB A;  4IL6 Z;  3E8H A;  5ITZ A;  2DYR C;  1GM9 A;  3CCE V;  5IYZ B;  2YXL A;  1JJO A;  3K5O A;  4FLZ A;  3OR6 C;  3SJA C;  3E2E A;  2QKC A;  1I0H A;  1IBK O;  1K33 A;  1V54 C;  1HNW O;  1FXK B;  5EIB D;  1ZL8 A;  4NVP A;  4G2K A;  1FKA O;  2XND G;  3L74 H;  4U7N A;  1SZT A;  1X59 A;  3T2M A;  1JVM A;  4AIL C;  1Q86 W;  5IT9 N;  3CHX A;  3HKD A;  1OHH G;  1Z5V A;  4R8C A;  5IY5 C;  2F4V O;  1VQ5 V;  4UVB A;  2ZDI A;  4JAV A;  4AI8 A;  4JI3 O;  3JAR B;  4PHZ A;  2XAJ A;  3G80 A;  4DV7 O;  3L75 H;  4NYK A;  2ZQM A;  1NTZ H;  3Q4H B;  1BL8 A;  4ABM A;  2ZDI C;  5H2F Z;  4MVU A;  3CX5 F;  3BRC A;  3DC5 A;  3K9S A;  1KEC A;  1PP9 H;  1JFF B;  2F4V B;  3HKE A;  3APQ A;  3FB5 C;  1RSO A;  3SJQ C;  3ETD A;  2W0X A;  1R6T A;  1H38 A;  4DR7 O;  5CB4 A;  1Q82 W;  2OCC B;  1IBL O;  2QWR B;  5C8Y A;  2HVJ C;  3OTO B;  1B6Q A;  3LSQ A;  2XAH A;  2YIC A;  2RJZ A;  4D7S A;  2ZXW B;  2IH3 C;  3L71 H;  4FFB A;  1OCO C;  3T1Y O;  3AG1 B;  1IBM B;  4LNU B;  3ZX6 A;  2GDS A;  2HR3 A;  2EIK B;  1I94 O;  3LNM B;  1VQ6 V;  2UUC B;  4F4L A;  4DUY O; 
#chains in the Genus database with same CATH homology
 1ZX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...