1ZXHA

G311 mutant protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MYYLVVNKGQNAFYETLTKAVDAETARNAFIQSLKDDGVQGVWTYDDATKTFTVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system/protein binding
molecule keywords Immunoglobulin G binding protein G
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxhA00
1GB4A 1XCTL 4GLSC 2JXTA 2PLPA 1PGAA 1ZXHA 2ONQA 1XCQL 1Q10A 1KH0A 1YMHE 2J52A 5HHDG 1IGDA 2N7JA 2OEDA 5HG2A 2I38A 2NMQA 1HEZE 1HZ6A 4HJGE 3MP9A 2LUMA 2QSDA 1EM7A 3FILB 1FD6A 2K0PA 2N9KA 3V3XA 1F2RC 2ON8A 1IGCA 3FILA 4KGTA 2EELA 2LHEA 1K50A 1MPEA 4IKGA 1MVKA 1K52A 4OZBA 2N9LA 5BMHA 1FCCC 2ZW0A 2ZW1A 1UWXA 4D2KA 1PGBA 2RMMA 2GI9A 4WH4A 2J53A 2JSVX 1QKZA 2JU6X 2JZPA 2GB1A 1HZ5A 2KACA 1YNTE 4HKZE 2KN4A 3GB1A 4KGSA 2IGDA 5BMIA 1C9FA 1P7EA 2PTLA 1PGXA 1IBXB 2KDMA 2IGHA 2LHDA 4IOIE 2RPVA 2PW9A 1K53A 2LGIA 2KWDA 5BMGA 1GB1A 3UI3A 2KQ4X 1MHXA 4OZAA 1FCLA 1K51A 1JMLA 5HFYA 1P7FA 1D4BA 4KGRA 5HI1A 1MHHE 4OZCA 1F2RI 2I2YA 2JWUA 1MI0A 2IGGA 5JXVA 1XF5L 4MACA 1IBXA 2QMTA
chains in the Genus database with same CATH superfamily
2MP2A 1H8CA 1DOIA 5EE9A 4DDID 1V1OA 2HJ8A 4IWOA 2BW2A 4LDTD 3BWUD 3JW0X 3U7DA 2ZJDA 1XXGA 4FADA 1F9JA 1Q10A 4HPMB 1WGYA 3AXCA 2VZKD 2EMSA 4NAWB 2CKHB 5CHVC 4BBNC 3Q3NC 1KRHA 2KWCA 2FUG1 3AEFB 3TEZA 4O1NA 1LO5D 1FRRA 1RRBA 3DBRB 2QSDA 3APDA 4G3XB 1FXIA 1FXTB 3KYCD 1WMHA 3R2IA 2MHJA 4LNIA 1F2RC 4IWQA 3W1SC 3LYYA 4ANUA 4KGTA 1ZDVA 2KVZA 4TQ1A 4LK0M 1UD7A 3QK0A 2N9LA 1Y56A 4XDDA 1QOBA 2I1JA 2V3PA 1I4GA 3DCGA 1SF0A 1WGDA 4WAFA 3IAM1 3NZUA 3ZDTA 1R4NI 2QHOA 1R7SA 2QJLA 4MGZE 1P0RA 1ZW7A 1FNVA 2O6VD 3TBLD 2WDQB 3RULA 1FNUA 3ONSA 1WXMA 4QAYA 3TMPB 1XLNA 3V61A 1WYGA 3DBHI 2N7EA 2LGIA 4ZHOA 2W3RA 2Z0DB 2PMVA 2HTME 2MBBB 2L83A 2WXRA 1UZXB 1FMAD 2M19A 4W9LA 1UH6A 3U7ZA 2AL3A 1TTNA 4FHJA 3BINA 3GOEA 4HRSA 4WJNA 4TKNA 1JQ4A 3TEWA 4DHZE 2BB6A 1KF6B 2JF5A 2CHXA 1XLQA 3Q14C 1TJEA 1KH0A 2KZRA 3A9JA 4MJSA 2LGDA 3A9JB 3AH7A 3DHIC 3MP9A 3SHQA 2BS4B 1LXDA 5I4DA 1KFYB 4I6PA 4HK2A 2I1KA 3HM3A 3PHWB 3FILA 1WXSA 3PSEB 1DOXA 2KTRB 2KDIA 2D3CA 3R7QA 3NVVA 3ZJUA 2VZKB 2IYDB 3L08A 2HD5B 3VVWB 2KTRA 3T3NA 2D3GA 1JWMD 5FKAC 2JSVX 5FK9C 1SEBD 2IO0B 1SE3A 1KLVA 1GUAB 2INCC 2AQ1B 2RGFA 4GSWA 4XX5A 4MJSB 3ZKJC 3FKYA 1T6BX 2JPHA 1JRUA 2BWES 3C8YA 4IOIE 3U30A 4I6LB 3EA6A 1TY0A 3GE3C 2LXAA 3HRDD 2R61A 2KMAA 3AB5A 1BXTA 2GBMA 4OZAA 4NQLB 2EKEC 5DPRA 3IT4B 2WXQA 2Y3AA 1XLOA 5BYRA 5LXIB 2EMTA 1GC7A 4YTNB 2C60A 2UYZB 1R4MI 3HK0A 3VQIA 2VH1A 1WM3A 4FLHA 4EKUA 1MG8A 4K3BA 1UWMA 3E56A 3HVDA 4EZJA 4TUUA 1PQSA 2KANA 3HVZA 1SXTA 3DVNV 2DLBA 1VJKA 1WM2A 4IUMB 4US8A 1VCBA 4II2B 4AJWA 3PREA 3WAMA 2W82A 1V86A 5J2RA 2RSUA 2KT7A 1WGRA 1L0YB 3AE4B 2LMCA 1HEZE 2SEBD 4BZAA 2K8HA 5AZFA 1Z2MA 4IM3A 4A6QA 3L13A 2KX0A 2ON8A 3TEYA 3HIZA 3ZRCA 2K8BA 5FR3A 3MFGA 3ZO5B 4DXGA 3URYA 4LNFA 3QAQA 1T0RC 4YWGG 2LJIA 3P2BA 4URKA 1GAQB 4WWOA 4TMAB 3KH0A 1WX7A 1NENB 1SSNA 4M8MA 2L3ZA 2YEPF 1IPGA 2N0SB 3B1LX 5TSSA 3UQBA 4KDIC 3WAOA 2BKFA 4MH0E 3B9JA 3LXFA 3RT3B 3AE9B 1GG3A 4B95A 3Q3FA 1ZGUB 4DXFA 1K53A 2IZVB 2KJRA 4LJPB 2MA9B 3H7PB 3UI3A 3MC0B 2J0JA 3H8HA 1QOAA 1OTRB 2GRIA 3ZLZA 3T8MA 1P7FA 4TV3A 3AEBB 2PKOA 4W9JA 1L2NA 2HJ1A 1V1PB 2H88B 2WXLA 3QA8A 3IXSA 1WJ4A 4JIOU 2INNE 4FA6A 2O2VB 3U8ZA 5AZGA 3EC8A 3A9KA 5CX3A 1TIFA 1YMHE 4WIPA 3ZVVA 1TS3A 2RDBC 1FM0D 1CJEA 4RMAA 2BTEA 1HZ6A 5IP4D 4HROA 3Q8FA 5GXGB 2KN5A 1TS2A 1TYGB 4L23A 3V3XA 3I9V1 3H9DA 4LCDE 2KWUB 2WXPA 3ML9A 3BZDB 2REXA 4IKGA 4K7UA 1HE8A 2LRUA 3DWGC 3P1MA 4GDKB 1FIQA 1AARA 3CWIA 3CSFA 4ZOHC 4XWWA 1WZ3A 2KFKB 3Q3MC 5GMVA 3RYTA 3A1QB 1TS5A 2KACA 3NVYA 1YNTE 4HKZE 3KW5B 2N1WA 2FE8A 3N3KB 2WQYB 4RGTA 2WXMA 1P7EA 3NS1A 3AEAB 1L6VA 4MM3B 1IBXB 2KDMA 3SFEB 1N5XA 2C5LC 4EFOA 4J6IA 3BK2A 3RD2A 4X57B 1XEEA 1WR1A 2WU2B 2ZCCA 3N1YC 5BO4B 1IYFA 3P63A 1QOGA 4ANWA 4JPSA 4LJOB 3EECA 2LZ6A 4IWPA 1Q5WB 3Q2AC 4AUQC 1SE2A 1MI0A 3VH4B 5JXVA 4ZHPA 2NCNA 4ITKA 2M56B 2AYOB 2K9XA 1TGZB 2ICIA 1OEYA 3U2SC 3P4PB 1E7UA 1CQVA 2PLPA 4H2AA 4HLEA 1PGAA 2MH7A 5E6NA 4NZLB 2FUHB 4LNKA 1XCQL 2OOBB 3Q69A 2JRIB 1KM7A 1C4CA 2GOWA 4GN1A 3MHSD 1I4QA 2N7JA 4MSMB 1UBQA 2D3AA 3VR8B 1TZOA 2LWPA 3ALBA 2MSED 4FJZA 4YSZB 4TSSA 4GDLB 4GIVA 4RNAA 4FHKA 2WWZA 1VZ7A 3AE3B 3OLMD 4REZA 1WXAA 2K8CA 4P16A 4KZ0A 4E74A 3DHHC 3P4SB 2ZW1A 1UWXA 2DZJA 3PHXB 1YOVB 4ICUA 3KUZA 2KLCA 1FO4A 3J9CA 4EEWA 1WJ6A 2ZZPB 4BKSD 4DDGD 2FAZA 1YX5B 2Z59B 3LDZE 3PRMB 3AULA 4WWPA 3GB1A 2BB5A 2X38A 1VD2A 4WJPA 1B1ZA 1PGXA 3AE8B 2MW5A 2MWSB 1RYJA 3RUIB 2MJDA 4KSKC 1V2YA 3CIRB 2KWDA 4BFRA 3JSVB 5IN7A 3RNGC 1V80A 2G45B 4NJ7A 4ACFA 5IA7A 2L1AA 1KLUD 1FCLA 4W9CA 1PUTA 1F52A 3WCQA 1FFUA 2UWQA 2MLBA 1Z5SB 4YTPB 1WGGA 3IVFA 2G1EA 3L10B 3AV8A 5KHOA 4W9IA 2JWUA 3ZNZB 2NBVB 1UBIA 2WXGA 4DHJD 1WZ0A 1I4RA 4GLSC 1QQRA 4JGHB 2L7RA 3VFKA 2CJOA 2WP9B 3L16A 1E8XA 1V9JA 4XC2A 2BYFA 4P1CC 4JWSC 1Q0WB 4HCPB 3Q3JA 1Y8RC 3ML8A 3PO0A 3AE1B 5EE3A 1IGDA 4E3CA 1OFFA 1ZPSA 3R2TA 2DX5B 3RNBC 1YD8U 2MEKA 1WYWB 1ISNA 2BPSA 3VH3B 4YTMB 4RM8A 3AU4A 1LGRA 2JT4B 3RFZB 2LVPA 4JE3B 2NPTB 2V4IB 2N7DA 3GS2A 2JX5A 2XN9C 4AP4C 3NRZA 4BVUC 4OZBA 5BMHA 1FCCC 2LFIA 5TR5A 4GOCA 2BGFA 1N62A 1C78A 4UDUC 4WH4A 2CR5A 5BYQA 3UGBB 1QKZA 1NBFC 3ZQ4A 4YXDB 1FEHA 4ARCA 4ZRPA 5C3JB 2WXFA 3KWVA 3AU5A 1WJUA 3TIXA 4KGSA 2ZVNA 4FJVB 2FCSA 5BMIA 2M8SA 4AQ7A 4DBGA 4CQNA 4FXCA 2AX5A 5G5HA 2LHDA 4KSLC 2IY0B 1SE9A 1OQRA 4MGKE 1K51A 1JMLA 3QCAA 4DHZB 2M4NA 1D4BA 4KGRA 3P4QB 1MHHE 1E7VA 4EZKA 2WS3B 1IBXA 2Z0EB 2D11A 1UUPA 2ZPNA 3C19A 2WXKA 3V05A 2IO3B 4B6WA 2KNBA 2JXTA 3A1QA 3PV1A 2WHIA 1T0QC 4BKGA 1WFYA 1KLGD 3NJTA 1EU3A 3QQ8B 3W2DA 1SB3C 4ANXA 4GDKA 1F0ZA 2NTTA 1WSPA 2NVUI 2INDC 4MDKE 2ZNVC 2CU1A 4MGYE 1RAXA 1AN8A 1E5WA 1UGMA 3B2GA 2WGSA 2NPTA 2J7QB 3N1ZC 3AEDB 1ET9A 5FR6A 3PT2B 4BKSA 2LHEA 3UIOB 1K50A 5BYSA 1ACCA 3FC4A 4HKQA 4A55A 1N60A 2ASQA 2GBNA 1V6EA 4M00A 3AE2B 1LM8B 1GC6A 3PZDA 3Q8CA 3ZNGC 3TL5A 3PZ8A 2D10A 2JZPA 4BOZB 3KVFB 4GU2A 2TSSA 4C7ZA 1VRAB 3QARA 2RD0A 4RGMA 1ZP0B 1QZEA 2LXCA 2QDFA 2O6VB 1V1PA 2KDBA 1ZXIA 1YIWA 1EF5A 3EHVA 4RGNA 1SE4A 1VLBA 3AE7B 1GB1A 4TQ0A 3RPFC 4OVUA 1TY2A 4AWJA 1VDVA 3IFWB 2OHFA 2NTSA 1YJ1A 4M0WA 4DQOC 3SD5A 3R7RA 2IGGA 2R2QA 2L0TA 4RF0A 2N9XA 4F8CB 1FPYA 2N1VA 3UIPB 1RLFA 4HVBA 2BS2B 3W5UB 2JQRB 4ZDVA 2M17A 3W1SA 1N63A 2ONQA 3L54A 3IAS1 4C4VB 2PVGC 1J7CA 4OHJA 2JY6A 3FAHA 2JZ3B 1QT9A 4HXDA 4XE0A 1I7HA 2KXJA 3N20C 3WA0A 1G6JA 4GDLA 3APCA 3N32A 4N59A 3RNEC 5MPOA 3X23A 2QC8A 1ZDXA 2BVCA 3ZGZA 4HJKA 3R8BA 1K52A 4FULA 4JWUC 2CHWA 1UGJA 1L5PA 3PLVA 3B08A 1EU4A 1C77A 2ZCBA 1I35A 2LEKA 1HTQA 2KMCA 2KD0A 4CO7A 3QHTA 1P3QU 2WX0A 5DPWA 2XNAC 3KWLA 2PW9A 2LVOA 1H4RA 5BMGA 2BT6A 2JRHA 4MH8A 2DZIA 4EUTA 3N30A 2AEHA 2N9PC 1OQQA 2KYWA 3PZ7A 3AMZA 4W9EA 2WYQA 2KKCA 3DWMA 2I2YA 2IO2B 1TZ1A 2QIEB 4FN2A 2WXHA 3GE8C 1V5OA 3SU8X 4L1BA 2V9HA 4JLCA 5D3IB 3I5JC 1JW9D 1ZXHA 2KFKA 3ABVB 5C1ZA 3D32A 5IAAC 2FIDA 1RFKA 3PS6A 3IT6B 3QC8B 4M8NA 3WAPA 3PVLA 5HKHA 2PE9A 5E6JA 4WURA 1E0ZA 2ACZB 3PRZA 4PT5A 3W1YA 4P6VF 3FILB 2XK5A 1NDDA 4K7WA 2WX1A 2G4DB 4OVZA 1WX9A 1QF6A 4W9HA 1F1HA 3U4EG 1JWSD 4R3DA 1L6UA 4W9KA 2G4SA 1YN5A 3SFDB 3PGEA 3OJ3A 2MJEA 2O2VA 3AECB 2PEAA 1TT5B 2GMIC 2KVRA 2RR9A 3HUIA 2ZPYA 3RNFC 2KO3A 2BKRB 2V1YA 4W9FA 4XGAB 3RNCC 1C9FA 2NBWB 1EWCA 1U4AA 3I3TB 4K81A 4C80A 1WRDB 5J17A 2AWTA 4RM9A 1JALA 2QCZA 5IKCM 3R3MA 2Y5BB 1JWAD 2PPHA 2K6DB 2JXXA 4K3CA 3H7PA 5CTRC 4B0EA 3ZNID 3B0AA 3AE5B 4MELA 1HQRD 4KX6B 1FXAA 3IHPC 2K6QA 1STEA 1OEYJ 5G55A 4DXAB 4FBJB 1M94A 1OGWA 1EO6A 4A20A 1FNWA 1Q1OA 1ZUD2 2KC2A 5AZHA 2JWZA 4LNNA 5HHDG 1WX8A 2PVOD 3AI5A 3SR6A 2V4LA 4US9A 2WLBA 4KZCA 3H1UA 3KUCB 1BUIC 4HCNB 5E6OA 3GZNI 2KWVB 1ENFA 1GNUA 1AYFA 1PDXA 4I6NB 2VH2A 2BYTA 2KJ6A 4KIKB 2OJWA 1I4XA 3MC8A 1PFDA 3ZXRA 1J8CA 4WJQA 4KIKA 2DENB 4D2KA 3ZYYX 2RMMA 3K9PB 1ZKHA 5CHWA 2DAJA 2J53A 3BYTB 2B76B 1WI0A 2PIAA 1B9RA 5LXHA 2K39A 1T0YA 1NEKB 2WDRB 4YSYB 5KHQA 1WGKA 1SGHA 4BKTA 1CK1A 3L17A 3ZNHB 3BY4B 4XZ4A 3NY5A 4N9F4 4II3B 2K25A 3TUOA 3V6EB 2GBJA 2VRRB 4IC7B 4MSQB 5LNK1 3ZXVA 2MQJA 1TS4A 4LTUA 3KQ4A 3I57A 1DGJA 3RMKC 4YSXB 3EUB2 2G9HD 1WXQA 3NVZA 2FNJB 4N58A 1MJDA 2DYBA 2CS4A 4IDIA 3PTFC 1C3TA 1WF9A 2NS5A 4KVGB 5JZEB 1YN4A 1GOZA 3KUDB 2QMTA 5L83A 4K1RB 3DDCB 1GB4A 3R66C 3AEGB 3VTUA 2MBQA 3O13A 3ZUNA 2KQ7A 4NAMA 4A9AA 2Y5PA 1D5MC 2FIFA 4DHJB 3M62B 1A5RA 3TJPA 2LUMA 3MJWA 2KTFA 1WGHA 2AL6A 2DWQA 3BVMA 2J0KA 5DCNA 2GLSA 2HDEA 5J18A 4WJOA 4ICVA 2D07B 1IGCA 1R4MB 2L32A 3KYDD 4PYZA 1MPEA 2J4XA 3VTVA 2LASA 2FCQA 2K3UA 3V62A 2DHZA 4A8XC 5DPTA 1RWSA 1RFAA 2KOXA 3S2AA 3UQAA 2JU6X 3CSTA 4MT5A 4RCOA 4WWMA 2DBYA 4HPPA 2L8JA 2XK5B 3EFCA 4XWTA 4MEMA 1L7YA 4WQOB 4BOSC 1ET6A 2M1MA 2HTHA 2BQQA 2NR2A 4E71A 1C79A 4HWIB 3VRAB 2E3TA 1SJED 1D5XC 4RH6A 1I42A 3IG3A 4G50A 1TBEA 2MJ3A 2LD9A 4KDLB 2RDGA 1AW7A 4XYCA 2GBKA 4OZCA 1F2RI 4WQMA 3K9OB 3VHTC 4FJYA 3W5VB 1V8CA 1QOFA 4IW0A 5L95C 4CYEA 2WXIA 1I4HA 3ENEA 1P98A 1JCKB 3RI7C 2JZZA 1T0SC 5H92C 3M95A 4PS3A 2MRPA 1WRIA 1J7AA 3IBEA 3DBSA 1WJNA 4W9GA 1KOTA 2FCNA 2W54A 4ANVA 2WDVB 4A90A 3AM9A 4ZRJA 1FD6A 5D7GA 1P1AA 5EDSA 1WMHB 4IM2A 3P42A 4JL9A 2BYEA 2UU7A 1GPXA 3LB8C 2R2OA 5T8IA 1XD3B 3U52E 1MVKA 3TSSA 5LLIA 4NAWA 4HDOA 2JYEA 5EE1A 2KJHB 1IUEA 2YLMA 2SAKA 3H6NA 5EE0A 4C00A 3ZDMC 1HZ5A 1R4NB 2RDHA 2AQ2B 2J42A 5IO9A 2IGDA 2J0MA 1SJHD 5G2NA 2MP2B 2PE6B 4A3PA 2Y5CA 5C23A 2CJNA 2L0FA 4W9DA 2L52A 1NYQA 5D6JB 5C2TB 2N9EB 2QEJC 4C4VA 4RFBA 3UF8A 3W9CB 4KKJA 1WE6A 4G11A 2NBUA 1CZPA 2YVCA 5DPSA 2AQ3B 3NHEB 2DYOA 4GMVA 1V49A 4P7IA 3NG0A 5E6PA 2BYVE 3CF6E 3EFUA 5HFYA 2WDTB 5HI1A 3TEXA 4ZRQA 3APFA 3KLSX 3N9YC 1WR6E 4M0WB 2CU3A 1JWUD 1KJTA 5JHAA 4C56C 4PS8A 1E6EB 1DOYA 2WXOA 3A4SC 4NNJB 4GGQA 2WNMA 2X8XX 2KK8A 1GJZA 1AWDA 3ECIA 1EF1A 1T5XD 1QILA 3Q8EA 3C0RB 1EUVB 2LGSA 4DK5A 2O6VA 2OEDA 5HG2A 4B9KA 3QX1A 2NMQA 2KHWB 3BYYB 1HXYD 4J3OD 1NI3A 3DPDA 3RNAC 2LGYA 3SEBA 1WY8A 2LUEA 2KX3A 2DNFA 2EELA 4XDCA 1NYRA 3V6CB 2BS3B 1M4VA 2A5UA 2WU5B 3DBRI 4WAAA 1JWBD 1ROEA 1NI2A 4KKIA 1PGBA 3VUXA 3QJZA 4EE2A 4NJ6A 1I4PA 2MCNB 2BF8B 4YL8A 2GB1A 3LJ3A 2YEPB 1UNSA 3MHZA 2IY1B 4HPLB 3B2FA 3WALA 4CHKA 1N6ZA 2DAFA 2IGHA 3TCAA 3HHMA 3NS8A 1MFWA 5D94A 1TKYA 2JVCA 2IPKD 4EOYA 3DBLB 2KQ4X 2A4ZA 4ARIA 1F77A 2IDYA 3Q8BA 3DQVA 1D5ZC 1DYQA 2JUOA 3BVZA 3Q6BA 3T3OA 1V81A 3Q8AA 1XQQA 4PS7A 2LRWA 1P9DU 2G3QB 5H8YE 2W3SA 3AN1A 4NQKE 1SBBB 3RZFA 1E10A 3VXWA 3P4RB 2Q5WD 1J19A 1YQ4B 1ESFA 3DBLI 1E8WA 3AE6B 3OG5A 4RF1A 1MG4A 4N6EB 4OVVA 2IO1B 2KDEB 3NZSA 3NOBA 5D2MB 1VZ8A 3BK1A 4A3OA 3NUHB 4NPNA 4PYUA 1TKEA 2FBWB 1A70A 3SDLC 3PPAA 1V97A 5AUKA 4S17A 2LVQA 3X0WA 1UELA 2KQSA 1L4ZB 5D3DA 2KDFB 3ZJVA 3OAWA 1UF0A 2LI5A 4IG7B 1WWTA 2B3AA 2DZMA 1E90A 2INPE 2H89B 3DBHB 4AJYB 4IM0A 1YQBA 2L00B 4F1SA 4WWNA 3ZTCA 4C7YA 4AS1A 3VUWA 2BBCA 2XBBC 4ZRIA 4ZRKA 1FRDA 1YQ3B 3I63C 1RM6C 3VDZA 4LNOA 4LLGM 1E8YA 3T9LA 2LJ5A 4MACA 3ETRA 2IJ0A 1V5TA 3A4RA 4BBNF 4JX1C 1XCTL 3OJ4B 4MGIE 1WH3A 1LFDA 1J0GA 1N61A 2JYTA 2WXNA 3JSVA 4DWFA 1XT9B 2N4FA 1PYWD 1C1YB 2I38A 2K1FA 2L76A 4HJGE 1SIJA 1YJJA 4YT0B 2E6XA 4HDQA 2FCMA 1XLPA 3Q3OC 2K0PA 2N9KA 1L0VB 1BT0A 3OWEB 3CMMB 5CHFA 3DVGX 2MBHA 4KV2A 3O65B 2GBRA 4PK1A 1C76A 1SIFA 5IOIA 1YJIA 2C7HA 3RCZA 3ZIMA 2OJRA 2RPQA 4NY0A 1WE7A 1ZE3D 3RN9C 4ZYNA 4F7ZA 1E8ZA 4AOFA 2C7NB 3NVWA 1S3SG 4ZYSA 2V3SA 3GZNB 2KMMA 3DVNU 2HE7A 2MBEA 4MM3A 2MBOA 2D3BA 3PLUA 2D5GA 3VAWA 1CMXB 4JQWC 2DZKA 1C4PA 3L4PA 3M63B 2ZEQA 3QWZB 5AUIA 4K7SA 1TKGA 3V60A 2BWFA 2V3NA 1XF5L 3BIID 3L0WB 2V0GA 2M0XA 4S0RA 4HEA1 3RZWC 1HA5A 2EKIA 1N5WA 2L05A 4G0NB 3N1XC 4EZLA 1E7PB 4M01A 2KC1A 3HM6X 1X1MA 3BVGA 3VTWA 2LGXA 1LQBA 1D3ZA 5JH5C 2J52A 3ZJTA 3DVGY 4L2YA 1KTKA 3MTNB 1FFVA 4GB9A 1ZOYB 3DOWA 4GXBA 2D2QA 1EM7A 4BAXA 1HTOA 1YN3A 1K8RB 4RGOS 1QLBB 1YX6B 2C7MB 3ZW3A 2IBIB 2M0AA 2K22A 3VUYA 2W9NA 2CHZA 1NVID 2PJHA 2ZNVB 4M02A 3E9SA 1JROA 1BMLC 2KLGA 2ZW0A 1J7BA 4NJCA 1OQYA 1VR9A 4LDTB 3JVZX 2GI9A 3A33B 1T3QA 1E9MA 3ZTDA 3PRPB 1C4AA 1IP9A 1L4DB 2DYMA 5AEKB 2QILA 3ZRFA 2KN4A 3GP7A 4USAA 1EWYC 3WIMA 3EGRA 3VR9B 2Z8LA 2PTLA 3H7SA 2WXJA 3JYUA 1D6EC 1WXVA 3QIJA 1L0XB 3UINB 2KAJA 2RPVA 5G5GA 2ZVOA 1JRPA 3A9KB 3NZ3A 3MJ5A 3WANA 2W55A 4B0MA 4Q2JA 1VZ6A 1S1QB 2C9WB 1MHXA 4OW0A 3VRBB 4P1BC 4ASWC 5JHBA 3DHGC 2MX2A 2KFJA 2XEWA 3AEEB 3MC9A 1WIAA 1XO3A 3M3JA 2K5PA
chains in the Genus database with same CATH topology
2QIEB 2K9XA 2CU3A 1JWUD 1DOIA 5EE9A 2ICIA 1V1OA 3U2SC 2WXHA 3P4PB 4C56C 2BW2A 1E6EB 3BWUD 1CQVA 2PLPA 4H2AA 4L1BA 1DOYA 1PGAA 2MH7A 2WXOA 5D3IB 1JW9D 1ZXHA 2WNMA 3ABVB 4NZLB 1XXGA 1AWDA 1RFKA 1XCQL 3Q69A 1Q10A 1T5XD 1QILA 3Q8EA 1C4CA 3IT6B 2VZKD 4NAWB 1I4QA 2N7JA 1KRHA 2OEDA 5HG2A 2FUG1 3AEFB 3TEZA 4O1NA 3VR8B 2NMQA 5E6JA 1TZOA 1LO5D 1FRRA 4WURA 1E0ZA 2ACZB 4PT5A 3BYYB 1HXYD 2QSDA 4J3OD 4P6VF 3FILB 1FXIA 1NI3A 4YSZB 4TSSA 3R2IA 4GDLB 4OVZA 1F2RC 4RNAA 3SEBA 3LYYA 1QF6A 1VZ7A 3AE3B 4KGTA 1ZDVA 4TQ1A 2EELA 4REZA 4XDCA 1NYRA 4P16A 4LK0M 2BS3B 3U4EG 1JWSD 1M4VA 4R3DA 1L6UA 2N9LA 1Y56A 2WU5B 4XDDA 3P4SB 2ZW1A 1YN5A 1QOBA 1UWXA 3SFDB 1JWBD 1ROEA 2V3PA 2MJEA 4KKIA 1I4GA 1SF0A 1PGBA 1FO4A 4WAFA 3IAM1 3J9CA 4EE2A 1I4PA 3AECB 1R7SA 2QJLA 1FNVA 2GB1A 2YEPB 3HUIA 2WDQB 1FNUA 1UNSA 3MHZA 3GB1A 2BB5A 2X38A 3B2FA 1C9FA 1EWCA 1B1ZA 1XLNA 1PGXA 3AE8B 2IGHA 1RYJA 1WYGA 2MJDA 1TKYA 4C80A 2IPKD 3CIRB 2LGIA 4ZHOA 2KWDA 1JALA 2W3RA 2PMVA 2HTME 1JWAD 2L83A 2WXRA 2L1AA 2KQ4X 1KLUD 1FCLA 2M19A 1FMAD 1PUTA 3WCQA 1FFUA 3N9YC 4ARIA 3U7ZA 4YTPB 1F77A 2IDYA 3Q8BA 1D5ZC 1DYQA 3BVZA 2G1EA 4B0EA 3AV8A 3AE5B 3T3OA 2JWUA 4HRSA 1HQRD 3Q8AA 4KX6B 2WXGA 1FXAA 1JQ4A 3TEWA 1I4RA 4GLSC 1QQRA 1STEA 5H8YE 2BB6A 2W3SA 3AN1A 1SBBB 1E10A 1KF6B 2CJOA 2WP9B 3P4RB 2Q5WD 1FNWA 1XLQA 1YQ4B 1ESFA 4JWSC 3AE6B 4RF1A 1TJEA 1KH0A 1ZUD2 4N6EB 3PO0A 3AE1B 5EE3A 5HHDG 1IGDA 2PVOD 1OFFA 1ZPSA 3R2TA 3AH7A 1VZ8A 3BK1A 3SR6A 3MP9A 4US9A 2MEKA 2WLBA 2BS4B 5I4DA 4YTMB 1KFYB 3NUHB 1TKEA 3RFZB 4JE3B 2FBWB 1BUIC 2V4IB 3GS2A 1A70A 1ENFA 2JX5A 2XN9C 3FILA 1AYFA 1V97A 5AUKA 1DOXA 1PDXA 3NRZA 2BYTA 1L4ZB 4OZBA 5D3DA 1I4XA 5BMHA 3ZJVA 1PFDA 1FCCC 2LFIA 3NVVA 3ZJUA 1N62A 2VZKB 1C78A 4UDUC 4D2KA 3T3NA 1JWMD 3ZYYX 2RMMA 4WH4A 2J53A 3BYTB 2B76B 5FKAC 5BYQA 2JSVX 5FK9C 1QKZA 1SEBD 1WWTA 3ZQ4A 4YXDB 1FEHA 4ARCA 4ZRPA 5C3JB 2WXFA 1SE3A 3KWVA 2PIAA 1B9RA 2AQ1B 2INPE 1NEKB 4KGSA 2WDRB 4YSYB 5BMIA 1WGKA 2H89B 4AQ7A 1CK1A 4CQNA 4FXCA 1T6BX 2AX5A 5G5HA 2LHDA 3C8YA 4IOIE 3TUOA 3EA6A 5LNK1 1TY0A 4C7YA 4AS1A 1OQRA 1TS4A 2BBCA 4LTUA 3KQ4A 3HRDD 3I57A 1DGJA 1FRDA 2R61A 4YSXB 3EUB2 3AB5A 1BXTA 4OZAA 1YQ3B 2G9HD 1K51A 1WXQA 1JMLA 3NVZA 3IT4B 1RM6C 4N58A 2WXQA 2Y3AA 1XLOA 5BYRA 1D4BA 4LLGM 4KGRA 3P4QB 4IDIA 4YTNB 1MHHE 3VQIA 2WS3B 4MACA 1IBXA 1YN4A 1GOZA 1UUPA 2QMTA 3ETRA 2IJ0A 2WXKA 1UWMA 4JX1C 1XCTL 3E56A 3V05A 3HVDA 1GB4A 3AEGB 2JXTA 3O13A 3HVZA 1N61A 1SXTA 4NAMA 2DLBA 2JYTA 2WXNA 1D5MC 2Y5PA 4A9AA 1KLGD 1VJKA 1EU3A 3W2DA 4US8A 1SB3C 1PYWD 1F0ZA 2NTTA 2W82A 1WSPA 3AE4B 1L0YB 2I38A 2LMCA 1HEZE 4HJGE 1SIJA 1YJJA 4YT0B 2LUMA 2SEBD 2E6XA 1AN8A 1XLPA 2K0PA 2N9KA 2DWQA 3BVMA 3B2GA 4A6QA 1L0VB 2HDEA 2ON8A 3TEYA 3AEDB 1IGCA 1ET9A 3OWEB 5FR3A 2L32A 3MFGA 4DXGA 3URYA 2LHEA 1K50A 1MPEA 2J4XA 5BYSA 1ACCA 3FC4A 4YWGG 4HKQA 4A55A 2LJIA 2K3UA 1N60A 1C76A 1GAQB 4A8XC 3AE2B 4TMAB 1RWSA 1YJIA 1NENB 1SSNA 2YEPF 3Q8CA 2JU6X 2N0SB 3PZ8A 4MT5A 4RCOA 2JZPA 4WWMA 2DBYA 1ZE3D 5TSSA 2TSSA 4C7ZA 4XWTA 1VRAB 3B9JA 3LXFA 3NVWA 3AE9B 4RGMA 1ZP0B 4ZYSA 1ET6A 2KMMA 1V1PA 1C79A 1ZXIA 3VRAB 4DXFA 2D5GA 1K53A 2E3TA 4RGNA 1SJED 1SE4A 1D5XC 1VLBA 4RH6A 3AE7B 3UI3A 1GB1A 3MC0B 4TQ0A 3RPFC 1TY2A 1VDVA 1C4PA 2OHFA 2MJ3A 2NTSA 3H8HA 1QOAA 3L4PA 2RDGA 2GRIA 5AUIA 1P7FA 1AW7A 1TKGA 3AEBB 4M0WA 4DQOC 2PKOA 4OZCA 1F2RI 2V3NA 2IGGA 4RF0A 4WQMA 1XF5L 3BIID 2V0GA 2H88B 1V1PB 4HEA1 2WXLA 3W5VB 1HA5A 1V8CA 2EKIA 1N5WA 1QOFA 3IXSA 2BS2B 2WXIA 3W5UB 2JQRB 1I4HA 1E7PB 3W1SA 1N63A 1JCKB 2INNE 5H92C 2ONQA 3BVGA 3IAS1 2PVGC 1J7CA 1YMHE 4WIPA 4OHJA 1WRIA 1J7AA 2J52A 1TS3A 3FAHA 3ZJTA 4L2YA 1KTKA 1QT9A 1FFVA 4XE0A 1ZOYB 1FM0D 1CJEA 2BTEA 2W54A 1HZ6A 1I7HA 4HROA 3Q8FA 5GXGB 2WDVB 4A90A 1EM7A 1TS2A 1TYGB 3AM9A 1FD6A 4RGOS 1YN3A 5D7GA 4L23A 3V3XA 1QLBB 4N59A 5MPOA 3I9V1 2M0AA 2K22A 3P42A 1GPXA 1ZDXA 2WXPA 1NVID 3LB8C 5T8IA 3ZGZA 3BZDB 4IKGA 3R8BA 3U52E 1MVKA 3E9SA 3TSSA 1JROA 1BMLC 1K52A 2ZW0A 1J7BA 5EE1A 2JYEA 3DWGC 3P1MA 4GDKB 4JWUC 1IUEA 4NJCA 1UGJA 1FIQA 1VR9A 1L5PA 2SAKA 3CWIA 4ZOHC 2GI9A 5EE0A 4XWWA 1T3QA 1E9MA 1EU4A 1C77A 1C4AA 1L4DB 2DYMA 1HZ5A 1TS5A 2KACA 2LEKA 3NVYA 2RDHA 2QILA 1YNTE 2AQ2B 2J42A 2KN4A 3GP7A 4HKZE 4USAA 1EWYC 2FE8A 2IGDA 2WQYB 1SJHD 3EGRA 4RGTA 2Y5CA 3VR9B 2CJNA 2Z8LA 2WXMA 1P7EA 2L52A 2PTLA 1L6VA 3AEAB 3NS1A 2WXJA 4MM3B 2KDMA 1IBXB 1D6EC 1NYQA 3SFEB 1N5XA 5C2TB 1L0XB 2KAJA 2QEJC 2RPVA 2XNAC 2PW9A 3BK2A 3KWLA 5G5GA 4RFBA 1JRPA 1XEEA 3NZ3A 5BMGA 2WU2B 3MJ5A 3W9CB 2W55A 4B0MA 2BT6A 4KKJA 4MH8A 4Q2JA 3P63A 1CZPA 1VZ6A 1MHXA 1QOGA 2AQ3B 4OW0A 2DYOA 3VRBB 5HFYA 4JPSA 1OQQA 3PZ7A 3AMZA 5HI1A 3AEEB 3DWMA 3TEXA 2I2YA 1SE2A 1MI0A 1XO3A 4ZRQA 5JXVA 2K5PA 4ZHPA 4ITKA 3KLSX 2M56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GB4 A;  1XCT L;  4GLS C;  2JXT A;  2PLP A;  1PGA A;  1ZXH A;  2ONQ A;  1XCQ L;  1Q10 A;  1KH0 A;  1YMH E;  2J52 A;  5HHD G;  1IGD A;  2N7J A;  2OED A;  5HG2 A;  2I38 A;  2NMQ A;  1HEZ E;  1HZ6 A;  4HJG E;  3MP9 A;  2LUM A;  2QSD A;  1EM7 A;  3FIL B;  1FD6 A;  2K0P A;  2N9K A;  3V3X A;  1F2R C;  2ON8 A;  1IGC A;  3FIL A;  4KGT A;  2EEL A;  2LHE A;  1K50 A;  1MPE A;  4IKG A;  1MVK A;  1K52 A;  4OZB A;  2N9L A;  5BMH A;  1FCC C;  2ZW0 A;  2ZW1 A;  1UWX A;  4D2K A;  1PGB A;  2RMM A;  2GI9 A;  4WH4 A;  2J53 A;  2JSV X;  1QKZ A;  2JU6 X;  2JZP A;  2GB1 A;  1HZ5 A;  2KAC A;  1YNT E;  4HKZ E;  2KN4 A;  3GB1 A;  4KGS A;  2IGD A;  5BMI A;  1C9F A;  1P7E A;  2PTL A;  1PGX A;  1IBX B;  2KDM A;  2IGH A;  2LHD A;  4IOI E;  2RPV A;  2PW9 A;  1K53 A;  2LGI A;  2KWD A;  5BMG A;  1GB1 A;  3UI3 A;  2KQ4 X;  1MHX A;  4OZA A;  1FCL A;  1K51 A;  1JML A;  5HFY A;  1P7F A;  1D4B A;  4KGR A;  5HI1 A;  1MHH E;  4OZC A;  1F2R I;  2I2Y A;  2JWU A;  1MI0 A;  2IGG A;  5JXV A;  1XF5 L;  4MAC A;  1IBX A;  2QMT A; 
#chains in the Genus database with same CATH topology
 2MP2 A;  1H8C A;  1DOI A;  5EE9 A;  4DDI D;  1V1O A;  2HJ8 A;  4IWO A;  2BW2 A;  4LDT D;  3BWU D;  3JW0 X;  3U7D A;  2ZJD A;  1XXG A;  4FAD A;  1F9J A;  1Q10 A;  4HPM B;  1WGY A;  3AXC A;  2VZK D;  2EMS A;  4NAW B;  2CKH B;  5CHV C;  4BBN C;  3Q3N C;  1KRH A;  2KWC A;  2FUG 1;  3AEF B;  3TEZ A;  4O1N A;  1LO5 D;  1FRR A;  1RRB A;  3DBR B;  2QSD A;  3APD A;  4G3X B;  1FXI A;  1FXT B;  3KYC D;  1WMH A;  3R2I A;  2MHJ A;  4LNI A;  1F2R C;  4IWQ A;  3W1S C;  3LYY A;  4ANU A;  4KGT A;  1ZDV A;  2KVZ A;  4TQ1 A;  4LK0 M;  1UD7 A;  3QK0 A;  2N9L A;  1Y56 A;  4XDD A;  1QOB A;  2I1J A;  2V3P A;  1I4G A;  3DCG A;  1SF0 A;  1WGD A;  4WAF A;  3IAM 1;  3NZU A;  3ZDT A;  1R4N I;  2QHO A;  1R7S A;  2QJL A;  4MGZ E;  1P0R A;  1ZW7 A;  1FNV A;  2O6V D;  3TBL D;  2WDQ B;  3RUL A;  1FNU A;  3ONS A;  1WXM A;  4QAY A;  3TMP B;  1XLN A;  3V61 A;  1WYG A;  3DBH I;  2N7E A;  2LGI A;  4ZHO A;  2W3R A;  2Z0D B;  2PMV A;  2HTM E;  2MBB B;  2L83 A;  2WXR A;  1UZX B;  1FMA D;  2M19 A;  4W9L A;  1UH6 A;  3U7Z A;  2AL3 A;  1TTN A;  4FHJ A;  3BIN A;  3GOE A;  4HRS A;  4WJN A;  4TKN A;  1JQ4 A;  3TEW A;  4DHZ E;  2BB6 A;  1KF6 B;  2JF5 A;  2CHX A;  1XLQ A;  3Q14 C;  1TJE A;  1KH0 A;  2KZR A;  3A9J A;  4MJS A;  2LGD A;  3A9J B;  3AH7 A;  3DHI C;  3MP9 A;  3SHQ A;  2BS4 B;  1LXD A;  5I4D A;  1KFY B;  4I6P A;  4HK2 A;  2I1K A;  3HM3 A;  3PHW B;  3FIL A;  1WXS A;  3PSE B;  1DOX A;  2KTR B;  2KDI A;  2D3C A;  3R7Q A;  3NVV A;  3ZJU A;  2VZK B;  2IYD B;  3L08 A;  2HD5 B;  3VVW B;  2KTR A;  3T3N A;  2D3G A;  1JWM D;  5FKA C;  2JSV X;  5FK9 C;  1SEB D;  2IO0 B;  1SE3 A;  1KLV A;  1GUA B;  2INC C;  2AQ1 B;  2RGF A;  4GSW A;  4XX5 A;  4MJS B;  3ZKJ C;  3FKY A;  1T6B X;  2JPH A;  1JRU A;  2BWE S;  3C8Y A;  4IOI E;  3U30 A;  4I6L B;  3EA6 A;  1TY0 A;  3GE3 C;  2LXA A;  3HRD D;  2R61 A;  2KMA A;  3AB5 A;  1BXT A;  2GBM A;  4OZA A;  4NQL B;  2EKE C;  5DPR A;  3IT4 B;  2WXQ A;  2Y3A A;  1XLO A;  5BYR A;  5LXI B;  2EMT A;  1GC7 A;  4YTN B;  2C60 A;  2UYZ B;  1R4M I;  3HK0 A;  3VQI A;  2VH1 A;  1WM3 A;  4FLH A;  4EKU A;  1MG8 A;  4K3B A;  1UWM A;  3E56 A;  3HVD A;  4EZJ A;  4TUU A;  1PQS A;  2KAN A;  3HVZ A;  1SXT A;  3DVN V;  2DLB A;  1VJK A;  1WM2 A;  4IUM B;  4US8 A;  1VCB A;  4II2 B;  4AJW A;  3PRE A;  3WAM A;  2W82 A;  1V86 A;  5J2R A;  2RSU A;  2KT7 A;  1WGR A;  1L0Y B;  3AE4 B;  2LMC A;  1HEZ E;  2SEB D;  4BZA A;  2K8H A;  5AZF A;  1Z2M A;  4IM3 A;  4A6Q A;  3L13 A;  2KX0 A;  2ON8 A;  3TEY A;  3HIZ A;  3ZRC A;  2K8B A;  5FR3 A;  3MFG A;  3ZO5 B;  4DXG A;  3URY A;  4LNF A;  3QAQ A;  1T0R C;  4YWG G;  2LJI A;  3P2B A;  4URK A;  1GAQ B;  4WWO A;  4TMA B;  3KH0 A;  1WX7 A;  1NEN B;  1SSN A;  4M8M A;  2L3Z A;  2YEP F;  1IPG A;  2N0S B;  3B1L X;  5TSS A;  3UQB A;  4KDI C;  3WAO A;  2BKF A;  4MH0 E;  3B9J A;  3LXF A;  3RT3 B;  3AE9 B;  1GG3 A;  4B95 A;  3Q3F A;  1ZGU B;  4DXF A;  1K53 A;  2IZV B;  2KJR A;  4LJP B;  2MA9 B;  3H7P B;  3UI3 A;  3MC0 B;  2J0J A;  3H8H A;  1QOA A;  1OTR B;  2GRI A;  3ZLZ A;  3T8M A;  1P7F A;  4TV3 A;  3AEB B;  2PKO A;  4W9J A;  1L2N A;  2HJ1 A;  1V1P B;  2H88 B;  2WXL A;  3QA8 A;  3IXS A;  1WJ4 A;  4JIO U;  2INN E;  4FA6 A;  2O2V B;  3U8Z A;  5AZG A;  3EC8 A;  3A9K A;  5CX3 A;  1TIF A;  1YMH E;  4WIP A;  3ZVV A;  1TS3 A;  2RDB C;  1FM0 D;  1CJE A;  4RMA A;  2BTE A;  1HZ6 A;  5IP4 D;  4HRO A;  3Q8F A;  5GXG B;  2KN5 A;  1TS2 A;  1TYG B;  4L23 A;  3V3X A;  3I9V 1;  3H9D A;  4LCD E;  2KWU B;  2WXP A;  3ML9 A;  3BZD B;  2REX A;  4IKG A;  4K7U A;  1HE8 A;  2LRU A;  3DWG C;  3P1M A;  4GDK B;  1FIQ A;  1AAR A;  3CWI A;  3CSF A;  4ZOH C;  4XWW A;  1WZ3 A;  2KFK B;  3Q3M C;  5GMV A;  3RYT A;  3A1Q B;  1TS5 A;  2KAC A;  3NVY A;  1YNT E;  4HKZ E;  3KW5 B;  2N1W A;  2FE8 A;  3N3K B;  2WQY B;  4RGT A;  2WXM A;  1P7E A;  3NS1 A;  3AEA B;  1L6V A;  4MM3 B;  1IBX B;  2KDM A;  3SFE B;  1N5X A;  2C5L C;  4EFO A;  4J6I A;  3BK2 A;  3RD2 A;  4X57 B;  1XEE A;  1WR1 A;  2WU2 B;  2ZCC A;  3N1Y C;  5BO4 B;  1IYF A;  3P63 A;  1QOG A;  4ANW A;  4JPS A;  4LJO B;  3EEC A;  2LZ6 A;  4IWP A;  1Q5W B;  3Q2A C;  4AUQ C;  1SE2 A;  1MI0 A;  3VH4 B;  5JXV A;  4ZHP A;  2NCN A;  4ITK A;  2M56 B;  2AYO B;  2K9X A;  1TGZ B;  2ICI A;  1OEY A;  3U2S C;  3P4P B;  1E7U A;  1CQV A;  2PLP A;  4H2A A;  4HLE A;  1PGA A;  2MH7 A;  5E6N A;  4NZL B;  2FUH B;  4LNK A;  1XCQ L;  2OOB B;  3Q69 A;  2JRI B;  1KM7 A;  1C4C A;  2GOW A;  4GN1 A;  3MHS D;  1I4Q A;  2N7J A;  4MSM B;  1UBQ A;  2D3A A;  3VR8 B;  1TZO A;  2LWP A;  3ALB A;  2MSE D;  4FJZ A;  4YSZ B;  4TSS A;  4GDL B;  4GIV A;  4RNA A;  4FHK A;  2WWZ A;  1VZ7 A;  3AE3 B;  3OLM D;  4REZ A;  1WXA A;  2K8C A;  4P16 A;  4KZ0 A;  4E74 A;  3DHH C;  3P4S B;  2ZW1 A;  1UWX A;  2DZJ A;  3PHX B;  1YOV B;  4ICU A;  3KUZ A;  2KLC A;  1FO4 A;  3J9C A;  4EEW A;  1WJ6 A;  2ZZP B;  4BKS D;  4DDG D;  2FAZ A;  1YX5 B;  2Z59 B;  3LDZ E;  3PRM B;  3AUL A;  4WWP A;  3GB1 A;  2BB5 A;  2X38 A;  1VD2 A;  4WJP A;  1B1Z A;  1PGX A;  3AE8 B;  2MW5 A;  2MWS B;  1RYJ A;  3RUI B;  2MJD A;  4KSK C;  1V2Y A;  3CIR B;  2KWD A;  4BFR A;  3JSV B;  5IN7 A;  3RNG C;  1V80 A;  2G45 B;  4NJ7 A;  4ACF A;  5IA7 A;  2L1A A;  1KLU D;  1FCL A;  4W9C A;  1PUT A;  1F52 A;  3WCQ A;  1FFU A;  2UWQ A;  2MLB A;  1Z5S B;  4YTP B;  1WGG A;  3IVF A;  2G1E A;  3L10 B;  3AV8 A;  5KHO A;  4W9I A;  2JWU A;  3ZNZ B;  2NBV B;  1UBI A;  2WXG A;  4DHJ D;  1WZ0 A;  1I4R A;  4GLS C;  1QQR A;  4JGH B;  2L7R A;  3VFK A;  2CJO A;  2WP9 B;  3L16 A;  1E8X A;  1V9J A;  4XC2 A;  2BYF A;  4P1C C;  4JWS C;  1Q0W B;  4HCP B;  3Q3J A;  1Y8R C;  3ML8 A;  3PO0 A;  3AE1 B;  5EE3 A;  1IGD A;  4E3C A;  1OFF A;  1ZPS A;  3R2T A;  2DX5 B;  3RNB C;  1YD8 U;  2MEK A;  1WYW B;  1ISN A;  2BPS A;  3VH3 B;  4YTM B;  4RM8 A;  3AU4 A;  1LGR A;  2JT4 B;  3RFZ B;  2LVP A;  4JE3 B;  2NPT B;  2V4I B;  2N7D A;  3GS2 A;  2JX5 A;  2XN9 C;  4AP4 C;  3NRZ A;  4BVU C;  4OZB A;  5BMH A;  1FCC C;  2LFI A;  5TR5 A;  4GOC A;  2BGF A;  1N62 A;  1C78 A;  4UDU C;  4WH4 A;  2CR5 A;  5BYQ A;  3UGB B;  1QKZ A;  1NBF C;  3ZQ4 A;  4YXD B;  1FEH A;  4ARC A;  4ZRP A;  5C3J B;  2WXF A;  3KWV A;  3AU5 A;  1WJU A;  3TIX A;  4KGS A;  2ZVN A;  4FJV B;  2FCS A;  5BMI A;  2M8S A;  4AQ7 A;  4DBG A;  4CQN A;  4FXC A;  2AX5 A;  5G5H A;  2LHD A;  4KSL C;  2IY0 B;  1SE9 A;  1OQR A;  4MGK E;  1K51 A;  1JML A;  3QCA A;  4DHZ B;  2M4N A;  1D4B A;  4KGR A;  3P4Q B;  1MHH E;  1E7V A;  4EZK A;  2WS3 B;  1IBX A;  2Z0E B;  2D11 A;  1UUP A;  2ZPN A;  3C19 A;  2WXK A;  3V05 A;  2IO3 B;  4B6W A;  2KNB A;  2JXT A;  3A1Q A;  3PV1 A;  2WHI A;  1T0Q C;  4BKG A;  1WFY A;  1KLG D;  3NJT A;  1EU3 A;  3QQ8 B;  3W2D A;  1SB3 C;  4ANX A;  4GDK A;  1F0Z A;  2NTT A;  1WSP A;  2NVU I;  2IND C;  4MDK E;  2ZNV C;  2CU1 A;  4MGY E;  1RAX A;  1AN8 A;  1E5W A;  1UGM A;  3B2G A;  2WGS A;  2NPT A;  2J7Q B;  3N1Z C;  3AED B;  1ET9 A;  5FR6 A;  3PT2 B;  4BKS A;  2LHE A;  3UIO B;  1K50 A;  5BYS A;  1ACC A;  3FC4 A;  4HKQ A;  4A55 A;  1N60 A;  2ASQ A;  2GBN A;  1V6E A;  4M00 A;  3AE2 B;  1LM8 B;  1GC6 A;  3PZD A;  3Q8C A;  3ZNG C;  3TL5 A;  3PZ8 A;  2D10 A;  2JZP A;  4BOZ B;  3KVF B;  4GU2 A;  2TSS A;  4C7Z A;  1VRA B;  3QAR A;  2RD0 A;  4RGM A;  1ZP0 B;  1QZE A;  2LXC A;  2QDF A;  2O6V B;  1V1P A;  2KDB A;  1ZXI A;  1YIW A;  1EF5 A;  3EHV A;  4RGN A;  1SE4 A;  1VLB A;  3AE7 B;  1GB1 A;  4TQ0 A;  3RPF C;  4OVU A;  1TY2 A;  4AWJ A;  1VDV A;  3IFW B;  2OHF A;  2NTS A;  1YJ1 A;  4M0W A;  4DQO C;  3SD5 A;  3R7R A;  2IGG A;  2R2Q A;  2L0T A;  4RF0 A;  2N9X A;  4F8C B;  1FPY A;  2N1V A;  3UIP B;  1RLF A;  4HVB A;  2BS2 B;  3W5U B;  2JQR B;  4ZDV A;  2M17 A;  3W1S A;  1N63 A;  2ONQ A;  3L54 A;  3IAS 1;  4C4V B;  2PVG C;  1J7C A;  4OHJ A;  2JY6 A;  3FAH A;  2JZ3 B;  1QT9 A;  4HXD A;  4XE0 A;  1I7H A;  2KXJ A;  3N20 C;  3WA0 A;  1G6J A;  4GDL A;  3APC A;  3N32 A;  4N59 A;  3RNE C;  5MPO A;  3X23 A;  2QC8 A;  1ZDX A;  2BVC A;  3ZGZ A;  4HJK A;  3R8B A;  1K52 A;  4FUL A;  4JWU C;  2CHW A;  1UGJ A;  1L5P A;  3PLV A;  3B08 A;  1EU4 A;  1C77 A;  2ZCB A;  1I35 A;  2LEK A;  1HTQ A;  2KMC A;  2KD0 A;  4CO7 A;  3QHT A;  1P3Q U;  2WX0 A;  5DPW A;  2XNA C;  3KWL A;  2PW9 A;  2LVO A;  1H4R A;  5BMG A;  2BT6 A;  2JRH A;  4MH8 A;  2DZI A;  4EUT A;  3N30 A;  2AEH A;  2N9P C;  1OQQ A;  2KYW A;  3PZ7 A;  3AMZ A;  4W9E A;  2WYQ A;  2KKC A;  3DWM A;  2I2Y A;  2IO2 B;  1TZ1 A;  2QIE B;  4FN2 A;  2WXH A;  3GE8 C;  1V5O A;  3SU8 X;  4L1B A;  2V9H A;  4JLC A;  5D3I B;  3I5J C;  1JW9 D;  1ZXH A;  2KFK A;  3ABV B;  5C1Z A;  3D32 A;  5IAA C;  2FID A;  1RFK A;  3PS6 A;  3IT6 B;  3QC8 B;  4M8N A;  3WAP A;  3PVL A;  5HKH A;  2PE9 A;  5E6J A;  4WUR A;  1E0Z A;  2ACZ B;  3PRZ A;  4PT5 A;  3W1Y A;  4P6V F;  3FIL B;  2XK5 A;  1NDD A;  4K7W A;  2WX1 A;  2G4D B;  4OVZ A;  1WX9 A;  1QF6 A;  4W9H A;  1F1H A;  3U4E G;  1JWS D;  4R3D A;  1L6U A;  4W9K A;  2G4S A;  1YN5 A;  3SFD B;  3PGE A;  3OJ3 A;  2MJE A;  2O2V A;  3AEC B;  2PEA A;  1TT5 B;  2GMI C;  2KVR A;  2RR9 A;  3HUI A;  2ZPY A;  3RNF C;  2KO3 A;  2BKR B;  2V1Y A;  4W9F A;  4XGA B;  3RNC C;  1C9F A;  2NBW B;  1EWC A;  1U4A A;  3I3T B;  4K81 A;  4C80 A;  1WRD B;  5J17 A;  2AWT A;  4RM9 A;  1JAL A;  2QCZ A;  5IKC M;  3R3M A;  2Y5B B;  1JWA D;  2PPH A;  2K6D B;  2JXX A;  4K3C A;  3H7P A;  5CTR C;  4B0E A;  3ZNI D;  3B0A A;  3AE5 B;  4MEL A;  1HQR D;  4KX6 B;  1FXA A;  3IHP C;  2K6Q A;  1STE A;  1OEY J;  5G55 A;  4DXA B;  4FBJ B;  1M94 A;  1OGW A;  1EO6 A;  4A20 A;  1FNW A;  1Q1O A;  1ZUD 2;  2KC2 A;  5AZH A;  2JWZ A;  4LNN A;  5HHD G;  1WX8 A;  2PVO D;  3AI5 A;  3SR6 A;  2V4L A;  4US9 A;  2WLB A;  4KZC A;  3H1U A;  3KUC B;  1BUI C;  4HCN B;  5E6O A;  3GZN I;  2KWV B;  1ENF A;  1GNU A;  1AYF A;  1PDX A;  4I6N B;  2VH2 A;  2BYT A;  2KJ6 A;  4KIK B;  2OJW A;  1I4X A;  3MC8 A;  1PFD A;  3ZXR A;  1J8C A;  4WJQ A;  4KIK A;  2DEN B;  4D2K A;  3ZYY X;  2RMM A;  3K9P B;  1ZKH A;  5CHW A;  2DAJ A;  2J53 A;  3BYT B;  2B76 B;  1WI0 A;  2PIA A;  1B9R A;  5LXH A;  2K39 A;  1T0Y A;  1NEK B;  2WDR B;  4YSY B;  5KHQ A;  1WGK A;  1SGH A;  4BKT A;  1CK1 A;  3L17 A;  3ZNH B;  3BY4 B;  4XZ4 A;  3NY5 A;  4N9F 4;  4II3 B;  2K25 A;  3TUO A;  3V6E B;  2GBJ A;  2VRR B;  4IC7 B;  4MSQ B;  5LNK 1;  3ZXV A;  2MQJ A;  1TS4 A;  4LTU A;  3KQ4 A;  3I57 A;  1DGJ A;  3RMK C;  4YSX B;  3EUB 2;  2G9H D;  1WXQ A;  3NVZ A;  2FNJ B;  4N58 A;  1MJD A;  2DYB A;  2CS4 A;  4IDI A;  3PTF C;  1C3T A;  1WF9 A;  2NS5 A;  4KVG B;  5JZE B;  1YN4 A;  1GOZ A;  3KUD B;  2QMT A;  5L83 A;  4K1R B;  3DDC B;  1GB4 A;  3R66 C;  3AEG B;  3VTU A;  2MBQ A;  3O13 A;  3ZUN A;  2KQ7 A;  4NAM A;  4A9A A;  2Y5P A;  1D5M C;  2FIF A;  4DHJ B;  3M62 B;  1A5R A;  3TJP A;  2LUM A;  3MJW A;  2KTF A;  1WGH A;  2AL6 A;  2DWQ A;  3BVM A;  2J0K A;  5DCN A;  2GLS A;  2HDE A;  5J18 A;  4WJO A;  4ICV A;  2D07 B;  1IGC A;  1R4M B;  2L32 A;  3KYD D;  4PYZ A;  1MPE A;  2J4X A;  3VTV A;  2LAS A;  2FCQ A;  2K3U A;  3V62 A;  2DHZ A;  4A8X C;  5DPT A;  1RWS A;  1RFA A;  2KOX A;  3S2A A;  3UQA A;  2JU6 X;  3CST A;  4MT5 A;  4RCO A;  4WWM A;  2DBY A;  4HPP A;  2L8J A;  2XK5 B;  3EFC A;  4XWT A;  4MEM A;  1L7Y A;  4WQO B;  4BOS C;  1ET6 A;  2M1M A;  2HTH A;  2BQQ A;  2NR2 A;  4E71 A;  1C79 A;  4HWI B;  3VRA B;  2E3T A;  1SJE D;  1D5X C;  4RH6 A;  1I42 A;  3IG3 A;  4G50 A;  1TBE A;  2MJ3 A;  2LD9 A;  4KDL B;  2RDG A;  1AW7 A;  4XYC A;  2GBK A;  4OZC A;  1F2R I;  4WQM A;  3K9O B;  3VHT C;  4FJY A;  3W5V B;  1V8C A;  1QOF A;  4IW0 A;  5L95 C;  4CYE A;  2WXI A;  1I4H A;  3ENE A;  1P98 A;  1JCK B;  3RI7 C;  2JZZ A;  1T0S C;  5H92 C;  3M95 A;  4PS3 A;  2MRP A;  1WRI A;  1J7A A;  3IBE A;  3DBS A;  1WJN A;  4W9G A;  1KOT A;  2FCN A;  2W54 A;  4ANV A;  2WDV B;  4A90 A;  3AM9 A;  4ZRJ A;  1FD6 A;  5D7G A;  1P1A A;  5EDS A;  1WMH B;  4IM2 A;  3P42 A;  4JL9 A;  2BYE A;  2UU7 A;  1GPX A;  3LB8 C;  2R2O A;  5T8I A;  1XD3 B;  3U52 E;  1MVK A;  3TSS A;  5LLI A;  4NAW A;  4HDO A;  2JYE A;  5EE1 A;  2KJH B;  1IUE A;  2YLM A;  2SAK A;  3H6N A;  5EE0 A;  4C00 A;  3ZDM C;  1HZ5 A;  1R4N B;  2RDH A;  2AQ2 B;  2J42 A;  5IO9 A;  2IGD A;  2J0M A;  1SJH D;  5G2N A;  2MP2 B;  2PE6 B;  4A3P A;  2Y5C A;  5C23 A;  2CJN A;  2L0F A;  4W9D A;  2L52 A;  1NYQ A;  5D6J B;  5C2T B;  2N9E B;  2QEJ C;  4C4V A;  4RFB A;  3UF8 A;  3W9C B;  4KKJ A;  1WE6 A;  4G11 A;  2NBU A;  1CZP A;  2YVC A;  5DPS A;  2AQ3 B;  3NHE B;  2DYO A;  4GMV A;  1V49 A;  4P7I A;  3NG0 A;  5E6P A;  2BYV E;  3CF6 E;  3EFU A;  5HFY A;  2WDT B;  5HI1 A;  3TEX A;  4ZRQ A;  3APF A;  3KLS X;  3N9Y C;  1WR6 E;  4M0W B;  2CU3 A;  1JWU D;  1KJT A;  5JHA A;  4C56 C;  4PS8 A;  1E6E B;  1DOY A;  2WXO A;  3A4S C;  4NNJ B;  4GGQ A;  2WNM A;  2X8X X;  2KK8 A;  1GJZ A;  1AWD A;  3ECI A;  1EF1 A;  1T5X D;  1QIL A;  3Q8E A;  3C0R B;  1EUV B;  2LGS A;  4DK5 A;  2O6V A;  2OED A;  5HG2 A;  4B9K A;  3QX1 A;  2NMQ A;  2KHW B;  3BYY B;  1HXY D;  4J3O D;  1NI3 A;  3DPD A;  3RNA C;  2LGY A;  3SEB A;  1WY8 A;  2LUE A;  2KX3 A;  2DNF A;  2EEL A;  4XDC A;  1NYR A;  3V6C B;  2BS3 B;  1M4V A;  2A5U A;  2WU5 B;  3DBR I;  4WAA A;  1JWB D;  1ROE A;  1NI2 A;  4KKI A;  1PGB A;  3VUX A;  3QJZ A;  4EE2 A;  4NJ6 A;  1I4P A;  2MCN B;  2BF8 B;  4YL8 A;  2GB1 A;  3LJ3 A;  2YEP B;  1UNS A;  3MHZ A;  2IY1 B;  4HPL B;  3B2F A;  3WAL A;  4CHK A;  1N6Z A;  2DAF A;  2IGH A;  3TCA A;  3HHM A;  3NS8 A;  1MFW A;  5D94 A;  1TKY A;  2JVC A;  2IPK D;  4EOY A;  3DBL B;  2KQ4 X;  2A4Z A;  4ARI A;  1F77 A;  2IDY A;  3Q8B A;  3DQV A;  1D5Z C;  1DYQ A;  2JUO A;  3BVZ A;  3Q6B A;  3T3O A;  1V81 A;  3Q8A A;  1XQQ A;  4PS7 A;  2LRW A;  1P9D U;  2G3Q B;  5H8Y E;  2W3S A;  3AN1 A;  4NQK E;  1SBB B;  3RZF A;  1E10 A;  3VXW A;  3P4R B;  2Q5W D;  1J19 A;  1YQ4 B;  1ESF A;  3DBL I;  1E8W A;  3AE6 B;  3OG5 A;  4RF1 A;  1MG4 A;  4N6E B;  4OVV A;  2IO1 B;  2KDE B;  3NZS A;  3NOB A;  5D2M B;  1VZ8 A;  3BK1 A;  4A3O A;  3NUH B;  4NPN A;  4PYU A;  1TKE A;  2FBW B;  1A70 A;  3SDL C;  3PPA A;  1V97 A;  5AUK A;  4S17 A;  2LVQ A;  3X0W A;  1UEL A;  2KQS A;  1L4Z B;  5D3D A;  2KDF B;  3ZJV A;  3OAW A;  1UF0 A;  2LI5 A;  4IG7 B;  1WWT A;  2B3A A;  2DZM A;  1E90 A;  2INP E;  2H89 B;  3DBH B;  4AJY B;  4IM0 A;  1YQB A;  2L00 B;  4F1S A;  4WWN A;  3ZTC A;  4C7Y A;  4AS1 A;  3VUW A;  2BBC A;  2XBB C;  4ZRI A;  4ZRK A;  1FRD A;  1YQ3 B;  3I63 C;  1RM6 C;  3VDZ A;  4LNO A;  4LLG M;  1E8Y A;  3T9L A;  2LJ5 A;  4MAC A;  3ETR A;  2IJ0 A;  1V5T A;  3A4R A;  4BBN F;  4JX1 C;  1XCT L;  3OJ4 B;  4MGI E;  1WH3 A;  1LFD A;  1J0G A;  1N61 A;  2JYT A;  2WXN A;  3JSV A;  4DWF A;  1XT9 B;  2N4F A;  1PYW D;  1C1Y B;  2I38 A;  2K1F A;  2L76 A;  4HJG E;  1SIJ A;  1YJJ A;  4YT0 B;  2E6X A;  4HDQ A;  2FCM A;  1XLP A;  3Q3O C;  2K0P A;  2N9K A;  1L0V B;  1BT0 A;  3OWE B;  3CMM B;  5CHF A;  3DVG X;  2MBH A;  4KV2 A;  3O65 B;  2GBR A;  4PK1 A;  1C76 A;  1SIF A;  5IOI A;  1YJI A;  2C7H A;  3RCZ A;  3ZIM A;  2OJR A;  2RPQ A;  4NY0 A;  1WE7 A;  1ZE3 D;  3RN9 C;  4ZYN A;  4F7Z A;  1E8Z A;  4AOF A;  2C7N B;  3NVW A;  1S3S G;  4ZYS A;  2V3S A;  3GZN B;  2KMM A;  3DVN U;  2HE7 A;  2MBE A;  4MM3 A;  2MBO A;  2D3B A;  3PLU A;  2D5G A;  3VAW A;  1CMX B;  4JQW C;  2DZK A;  1C4P A;  3L4P A;  3M63 B;  2ZEQ A;  3QWZ B;  5AUI A;  4K7S A;  1TKG A;  3V60 A;  2BWF A;  2V3N A;  1XF5 L;  3BII D;  3L0W B;  2V0G A;  2M0X A;  4S0R A;  4HEA 1;  3RZW C;  1HA5 A;  2EKI A;  1N5W A;  2L05 A;  4G0N B;  3N1X C;  4EZL A;  1E7P B;  4M01 A;  2KC1 A;  3HM6 X;  1X1M A;  3BVG A;  3VTW A;  2LGX A;  1LQB A;  1D3Z A;  5JH5 C;  2J52 A;  3ZJT A;  3DVG Y;  4L2Y A;  1KTK A;  3MTN B;  1FFV A;  4GB9 A;  1ZOY B;  3DOW A;  4GXB A;  2D2Q A;  1EM7 A;  4BAX A;  1HTO A;  1YN3 A;  1K8R B;  4RGO S;  1QLB B;  1YX6 B;  2C7M B;  3ZW3 A;  2IBI B;  2M0A A;  2K22 A;  3VUY A;  2W9N A;  2CHZ A;  1NVI D;  2PJH A;  2ZNV B;  4M02 A;  3E9S A;  1JRO A;  1BML C;  2KLG A;  2ZW0 A;  1J7B A;  4NJC A;  1OQY A;  1VR9 A;  4LDT B;  3JVZ X;  2GI9 A;  3A33 B;  1T3Q A;  1E9M A;  3ZTD A;  3PRP B;  1C4A A;  1IP9 A;  1L4D B;  2DYM A;  5AEK B;  2QIL A;  3ZRF A;  2KN4 A;  3GP7 A;  4USA A;  1EWY C;  3WIM A;  3EGR A;  3VR9 B;  2Z8L A;  2PTL A;  3H7S A;  2WXJ A;  3JYU A;  1D6E C;  1WXV A;  3QIJ A;  1L0X B;  3UIN B;  2KAJ A;  2RPV A;  5G5G A;  2ZVO A;  1JRP A;  3A9K B;  3NZ3 A;  3MJ5 A;  3WAN A;  2W55 A;  4B0M A;  4Q2J A;  1VZ6 A;  1S1Q B;  2C9W B;  1MHX A;  4OW0 A;  3VRB B;  4P1B C;  4ASW C;  5JHB A;  3DHG C;  2MX2 A;  2KFJ A;  2XEW A;  3AEE B;  3MC9 A;  1WIA A;  1XO3 A;  3M3J A;  2K5P A; 
#chains in the Genus database with same CATH homology
 2QIE B;  2K9X A;  2CU3 A;  1JWU D;  1DOI A;  5EE9 A;  2ICI A;  1V1O A;  3U2S C;  2WXH A;  3P4P B;  4C56 C;  2BW2 A;  1E6E B;  3BWU D;  1CQV A;  2PLP A;  4H2A A;  4L1B A;  1DOY A;  1PGA A;  2MH7 A;  2WXO A;  5D3I B;  1JW9 D;  1ZXH A;  2WNM A;  3ABV B;  4NZL B;  1XXG A;  1AWD A;  1RFK A;  1XCQ L;  3Q69 A;  1Q10 A;  1T5X D;  1QIL A;  3Q8E A;  1C4C A;  3IT6 B;  2VZK D;  4NAW B;  1I4Q A;  2N7J A;  1KRH A;  2OED A;  5HG2 A;  2FUG 1;  3AEF B;  3TEZ A;  4O1N A;  3VR8 B;  2NMQ A;  5E6J A;  1TZO A;  1LO5 D;  1FRR A;  4WUR A;  1E0Z A;  2ACZ B;  4PT5 A;  3BYY B;  1HXY D;  2QSD A;  4J3O D;  4P6V F;  3FIL B;  1FXI A;  1NI3 A;  4YSZ B;  4TSS A;  3R2I A;  4GDL B;  4OVZ A;  1F2R C;  4RNA A;  3SEB A;  3LYY A;  1QF6 A;  1VZ7 A;  3AE3 B;  4KGT A;  1ZDV A;  4TQ1 A;  2EEL A;  4REZ A;  4XDC A;  1NYR A;  4P16 A;  4LK0 M;  2BS3 B;  3U4E G;  1JWS D;  1M4V A;  4R3D A;  1L6U A;  2N9L A;  1Y56 A;  2WU5 B;  4XDD A;  3P4S B;  2ZW1 A;  1YN5 A;  1QOB A;  1UWX A;  3SFD B;  1JWB D;  1ROE A;  2V3P A;  2MJE A;  4KKI A;  1I4G A;  1SF0 A;  1PGB A;  1FO4 A;  4WAF A;  3IAM 1;  3J9C A;  4EE2 A;  1I4P A;  3AEC B;  1R7S A;  2QJL A;  1FNV A;  2GB1 A;  2YEP B;  3HUI A;  2WDQ B;  1FNU A;  1UNS A;  3MHZ A;  3GB1 A;  2BB5 A;  2X38 A;  3B2F A;  1C9F A;  1EWC A;  1B1Z A;  1XLN A;  1PGX A;  3AE8 B;  2IGH A;  1RYJ A;  1WYG A;  2MJD A;  1TKY A;  4C80 A;  2IPK D;  3CIR B;  2LGI A;  4ZHO A;  2KWD A;  1JAL A;  2W3R A;  2PMV A;  2HTM E;  1JWA D;  2L83 A;  2WXR A;  2L1A A;  2KQ4 X;  1KLU D;  1FCL A;  2M19 A;  1FMA D;  1PUT A;  3WCQ A;  1FFU A;  3N9Y C;  4ARI A;  3U7Z A;  4YTP B;  1F77 A;  2IDY A;  3Q8B A;  1D5Z C;  1DYQ A;  3BVZ A;  2G1E A;  4B0E A;  3AV8 A;  3AE5 B;  3T3O A;  2JWU A;  4HRS A;  1HQR D;  3Q8A A;  4KX6 B;  2WXG A;  1FXA A;  1JQ4 A;  3TEW A;  1I4R A;  4GLS C;  1QQR A;  1STE A;  5H8Y E;  2BB6 A;  2W3S A;  3AN1 A;  1SBB B;  1E10 A;  1KF6 B;  2CJO A;  2WP9 B;  3P4R B;  2Q5W D;  1FNW A;  1XLQ A;  1YQ4 B;  1ESF A;  4JWS C;  3AE6 B;  4RF1 A;  1TJE A;  1KH0 A;  1ZUD 2;  4N6E B;  3PO0 A;  3AE1 B;  5EE3 A;  5HHD G;  1IGD A;  2PVO D;  1OFF A;  1ZPS A;  3R2T A;  3AH7 A;  1VZ8 A;  3BK1 A;  3SR6 A;  3MP9 A;  4US9 A;  2MEK A;  2WLB A;  2BS4 B;  5I4D A;  4YTM B;  1KFY B;  3NUH B;  1TKE A;  3RFZ B;  4JE3 B;  2FBW B;  1BUI C;  2V4I B;  3GS2 A;  1A70 A;  1ENF A;  2JX5 A;  2XN9 C;  3FIL A;  1AYF A;  1V97 A;  5AUK A;  1DOX A;  1PDX A;  3NRZ A;  2BYT A;  1L4Z B;  4OZB A;  5D3D A;  1I4X A;  5BMH A;  3ZJV A;  1PFD A;  1FCC C;  2LFI A;  3NVV A;  3ZJU A;  1N62 A;  2VZK B;  1C78 A;  4UDU C;  4D2K A;  3T3N A;  1JWM D;  3ZYY X;  2RMM A;  4WH4 A;  2J53 A;  3BYT B;  2B76 B;  5FKA C;  5BYQ A;  2JSV X;  5FK9 C;  1QKZ A;  1SEB D;  1WWT A;  3ZQ4 A;  4YXD B;  1FEH A;  4ARC A;  4ZRP A;  5C3J B;  2WXF A;  1SE3 A;  3KWV A;  2PIA A;  1B9R A;  2AQ1 B;  2INP E;  1NEK B;  4KGS A;  2WDR B;  4YSY B;  5BMI A;  1WGK A;  2H89 B;  4AQ7 A;  1CK1 A;  4CQN A;  4FXC A;  1T6B X;  2AX5 A;  5G5H A;  2LHD A;  3C8Y A;  4IOI E;  3TUO A;  3EA6 A;  5LNK 1;  1TY0 A;  4C7Y A;  4AS1 A;  1OQR A;  1TS4 A;  2BBC A;  4LTU A;  3KQ4 A;  3HRD D;  3I57 A;  1DGJ A;  1FRD A;  2R61 A;  4YSX B;  3EUB 2;  3AB5 A;  1BXT A;  4OZA A;  1YQ3 B;  2G9H D;  1K51 A;  1WXQ A;  1JML A;  3NVZ A;  3IT4 B;  1RM6 C;  4N58 A;  2WXQ A;  2Y3A A;  1XLO A;  5BYR A;  1D4B A;  4LLG M;  4KGR A;  3P4Q B;  4IDI A;  4YTN B;  1MHH E;  3VQI A;  2WS3 B;  4MAC A;  1IBX A;  1YN4 A;  1GOZ A;  1UUP A;  2QMT A;  3ETR A;  2IJ0 A;  2WXK A;  1UWM A;  4JX1 C;  1XCT L;  3E56 A;  3V05 A;  3HVD A;  1GB4 A;  3AEG B;  2JXT A;  3O13 A;  3HVZ A;  1N61 A;  1SXT A;  4NAM A;  2DLB A;  2JYT A;  2WXN A;  1D5M C;  2Y5P A;  4A9A A;  1KLG D;  1VJK A;  1EU3 A;  3W2D A;  4US8 A;  1SB3 C;  1PYW D;  1F0Z A;  2NTT A;  2W82 A;  1WSP A;  3AE4 B;  1L0Y B;  2I38 A;  2LMC A;  1HEZ E;  4HJG E;  1SIJ A;  1YJJ A;  4YT0 B;  2LUM A;  2SEB D;  2E6X A;  1AN8 A;  1XLP A;  2K0P A;  2N9K A;  2DWQ A;  3BVM A;  3B2G A;  4A6Q A;  1L0V B;  2HDE A;  2ON8 A;  3TEY A;  3AED B;  1IGC A;  1ET9 A;  3OWE B;  5FR3 A;  2L32 A;  3MFG A;  4DXG A;  3URY A;  2LHE A;  1K50 A;  1MPE A;  2J4X A;  5BYS A;  1ACC A;  3FC4 A;  4YWG G;  4HKQ A;  4A55 A;  2LJI A;  2K3U A;  1N60 A;  1C76 A;  1GAQ B;  4A8X C;  3AE2 B;  4TMA B;  1RWS A;  1YJI A;  1NEN B;  1SSN A;  2YEP F;  3Q8C A;  2JU6 X;  2N0S B;  3PZ8 A;  4MT5 A;  4RCO A;  2JZP A;  4WWM A;  2DBY A;  1ZE3 D;  5TSS A;  2TSS A;  4C7Z A;  4XWT A;  1VRA B;  3B9J A;  3LXF A;  3NVW A;  3AE9 B;  4RGM A;  1ZP0 B;  4ZYS A;  1ET6 A;  2KMM A;  1V1P A;  1C79 A;  1ZXI A;  3VRA B;  4DXF A;  2D5G A;  1K53 A;  2E3T A;  4RGN A;  1SJE D;  1SE4 A;  1D5X C;  1VLB A;  4RH6 A;  3AE7 B;  3UI3 A;  1GB1 A;  3MC0 B;  4TQ0 A;  3RPF C;  1TY2 A;  1VDV A;  1C4P A;  2OHF A;  2MJ3 A;  2NTS A;  3H8H A;  1QOA A;  3L4P A;  2RDG A;  2GRI A;  5AUI A;  1P7F A;  1AW7 A;  1TKG A;  3AEB B;  4M0W A;  4DQO C;  2PKO A;  4OZC A;  1F2R I;  2V3N A;  2IGG A;  4RF0 A;  4WQM A;  1XF5 L;  3BII D;  2V0G A;  2H88 B;  1V1P B;  4HEA 1;  2WXL A;  3W5V B;  1HA5 A;  1V8C A;  2EKI A;  1N5W A;  1QOF A;  3IXS A;  2BS2 B;  2WXI A;  3W5U B;  2JQR B;  1I4H A;  1E7P B;  3W1S A;  1N63 A;  1JCK B;  2INN E;  5H92 C;  2ONQ A;  3BVG A;  3IAS 1;  2PVG C;  1J7C A;  1YMH E;  4WIP A;  4OHJ A;  1WRI A;  1J7A A;  2J52 A;  1TS3 A;  3FAH A;  3ZJT A;  4L2Y A;  1KTK A;  1QT9 A;  1FFV A;  4XE0 A;  1ZOY B;  1FM0 D;  1CJE A;  2BTE A;  2W54 A;  1HZ6 A;  1I7H A;  4HRO A;  3Q8F A;  5GXG B;  2WDV B;  4A90 A;  1EM7 A;  1TS2 A;  1TYG B;  3AM9 A;  1FD6 A;  4RGO S;  1YN3 A;  5D7G A;  4L23 A;  3V3X A;  1QLB B;  4N59 A;  5MPO A;  3I9V 1;  2M0A A;  2K22 A;  3P42 A;  1GPX A;  1ZDX A;  2WXP A;  1NVI D;  3LB8 C;  5T8I A;  3ZGZ A;  3BZD B;  4IKG A;  3R8B A;  3U52 E;  1MVK A;  3E9S A;  3TSS A;  1JRO A;  1BML C;  1K52 A;  2ZW0 A;  1J7B A;  5EE1 A;  2JYE A;  3DWG C;  3P1M A;  4GDK B;  4JWU C;  1IUE A;  4NJC A;  1UGJ A;  1FIQ A;  1VR9 A;  1L5P A;  2SAK A;  3CWI A;  4ZOH C;  2GI9 A;  5EE0 A;  4XWW A;  1T3Q A;  1E9M A;  1EU4 A;  1C77 A;  1C4A A;  1L4D B;  2DYM A;  1HZ5 A;  1TS5 A;  2KAC A;  2LEK A;  3NVY A;  2RDH A;  2QIL A;  1YNT E;  2AQ2 B;  2J42 A;  2KN4 A;  3GP7 A;  4HKZ E;  4USA A;  1EWY C;  2FE8 A;  2IGD A;  2WQY B;  1SJH D;  3EGR A;  4RGT A;  2Y5C A;  3VR9 B;  2CJN A;  2Z8L A;  2WXM A;  1P7E A;  2L52 A;  2PTL A;  1L6V A;  3AEA B;  3NS1 A;  2WXJ A;  4MM3 B;  2KDM A;  1IBX B;  1D6E C;  1NYQ A;  3SFE B;  1N5X A;  5C2T B;  1L0X B;  2KAJ A;  2QEJ C;  2RPV A;  2XNA C;  2PW9 A;  3BK2 A;  3KWL A;  5G5G A;  4RFB A;  1JRP A;  1XEE A;  3NZ3 A;  5BMG A;  2WU2 B;  3MJ5 A;  3W9C B;  2W55 A;  4B0M A;  2BT6 A;  4KKJ A;  4MH8 A;  4Q2J A;  3P63 A;  1CZP A;  1VZ6 A;  1MHX A;  1QOG A;  2AQ3 B;  4OW0 A;  2DYO A;  3VRB B;  5HFY A;  4JPS A;  1OQQ A;  3PZ7 A;  3AMZ A;  5HI1 A;  3AEE B;  3DWM A;  3TEX A;  2I2Y A;  1SE2 A;  1MI0 A;  1XO3 A;  4ZRQ A;  5JXV A;  2K5P A;  4ZHP A;  4ITK A;  3KLS X;  2M56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...