1ZXHA

G311 mutant protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MYYLVVNKGQNAFYETLTKAVDAETARNAFIQSLKDDGVQGVWTYDDATKTFTVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
molecule keywords Immunoglobulin G binding protein G
molecule tags Immune system/protein binding
source organism Streptococcus sp.
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxhA00
1PGAA 1XCTL 2ZW0A 4GLSC 1XF5L 1XCQL 2EELA 2JU6X 1IGDA 5BMGA 1HEZE 2LUMA 1ZXHA 2KWDA 1K51A 1GB4A 2N9LA 4MACA 2JSVX 1D4BA 4OZBA 1P7FA 1FCLA 2N7JA 1UWXA 1KH0A 4D2KA 2IGGA 3GB1A 2GB1A 1F2RC 4IOIE 4OZCA 2LHEA 1PGBA 5HFYA 2KACA 2JXTA 5HG2A 2J52A 2KDMA 1MVKA 2ON8A 2LGIA 1HZ6A 2IGDA 3FILB 3FILA 5BMIA 2J53A 2OEDA 1YNTE 3UI3A 1HZ5A 1IBXB 1MPEA 1GB1A 1YMHE 2QSDA 2RPVA 1IBXA 3MP9A 1QKZA 4IKGA 2KQ4X 2KN4A 1FCCC 5HHDG 1PGXA 2GI9A 1MHXA 2N9KA 4WH4A 4KGRA 1FD6A 2QMTA 2PLPA 2RMMA 4KGSA 5HI1A 2ZW1A 4HKZE 1MI0A 1IGCA 2K0PA 2ONQA 1K50A 4OZAA 2PW9A 2I2YA 2JWUA 5JXVA 4KGTA 1EM7A 2LHDA 1C9FA 2NMQA 2JZPA 2I38A 1F2RI 1K52A 2IGHA 1MHHE 4HJGE 1K53A 1P7EA 1Q10A 1JMLA 5BMHA 3V3XA 2PTLA
chains in the Genus database with same CATH superfamily
1ZDVA 3ZVVA 3UIOB 3VHTC 1Q1OA 3URYA 3EGRA 1C1YB 1YQBA 2NBVB 3MC8A 4IM0A 3Q8FA 2QIEB 4FA6A 2JXXA 1BT0A 1ZXHA 2BS3B 3AULA 3VXWA 3BYYB 4GDLB 1VDVA 2YVCA 3C0RB 3OG5A 2HJ8A 1ZGUB 3NVVA 4D2KA 2O6VD 2UWQA 2IGGA 1RFKA 2KN5A 4W9IA 2D3BA 2KC1A 4E71A 3Q3NC 5HFYA 3PO0A 3A33B 4BBNF 1ZDXA 4DXFA 2K8HA 3V05A 2N7DA 5AZHA 1WH3A 2M1MA 1UGMA 4NQKE 4YTNB 4C00A 1G6JA 3FILA 4WAAA 3TCAA 3BVMA 2AQ3B 4IWOA 5G5HA 4M0WB 3Q3FA 5AZFA 2JYEA 4WWOA 1LFDA 1N63A 3PTFC 2KVRA 3EHVA 5CX3A 4PYZA 2JT4B 2IO2B 1E7VA 5CHVC 2AWTA 3WAMA 1UZXB 1N61A 3KUCB 2KFKA 4HVBA 2WXLA 5DCNA 3ZNHB 4G0NB 1WSPA 3TEXA 4JQWC 1CK1A 4AP4C 2GBNA 1QLBB 4PS3A 2RD0A 2BKRB 1T5XD 2J0JA 1R4NI 3ABVB 4GSWA 1GUAB 2WXRA 4XE0A 1ZPSA 5MPOA 4WQMA 2V3NA 4MGIE 1GOZA 2EMSA 1NI2A 1SJED 1MHHE 3B08A 3NVYA 3R2IA 2J7QB 2AQ1B 4GMVA 3W1YA 2ACZB 3AEDB 4M8NA 1C4AA 1NYQA 2WX0A 3K9OB 2N0SB 3L16A 2M19A 3GP7A 4P6VF 2B76B 1TT5B 2LASA 5BMGA 1FXIA 2BT6A 3VR8B 1ACCA 2KT7A 4BFRA 1FIQA 3KQ4A 2LVPA 2N7JA 4NAWA 3NS1A 1L6VA 2ZVOA 1SJHD 2JRIB 3I5JC 3RNAC 4P1BC 4X57B 1F2RC 3KYDD 1L4ZB 2BWFA 4IM3A 1WYWB 4C7YA 5D6JB 4W9FA 2IJ0A 4ZRQA 2KDMA 3ZUNA 2MBOA 5JHAA 2IBIB 3L10B 3U2SC 3HVZA 3N1XC 3LJ3A 2N9XA 1N60A 2KLCA 3PT2B 4KX6B 3UGBB 2WXIA 1N5XA 1WX9A 1EF5A 2KDBA 1IBXA 2DBYA 1E8WA 1E7PB 4JIOU 2MHJA 3DHGC 3N20C 1FEHA 1SE9A 1YX5B 4P1CC 4L23A 4ANXA 4IW0A 2OHFA 3JW0X 1I4GA 4EE2A 3L13A 1L4DB 3QIJA 1ESFA 1C77A 3DCGA 2QDFA 2D3CA 3R8BA 1NENB 3IFWB 1HE8A 1D6EC 2C7NB 4A6QA 2KX3A 3O13A 3AE8B 2RDBC 2BB6A 5EE3A 4ACFA 1K52A 2WXNA 4XC2A 2INPE 2LXAA 3L54A 2EMTA 2K8CA 2BYVE 4C7ZA 2K39A 1WM2A 1XLPA 2MSED 3QAQA 1WE7A 4DDID 3KW5B 4ANWA 1FRDA 2CHWA 1GG3A 2N9LA 3HIZA 3W5VB 1QQRA 2J42A 1FO4A 2HTME 1Y8RC 4DHJB 1E90A 1FFVA 4BKSA 4FBJB 1S1QB 1BMLC 2LZ6A 4EEWA 4AUQC 1YN3A 2I1JA 1MFWA 2KK8A 1C79A 4M02A 4KKJA 2TSSA 2WXJA 4IUMB 2MW5A 3Q3MC 4K7SA 4MGKE 2KDFB 2IYDB 3PGEA 3UINB 1QKZA 1D5ZC 1WY8A 1ZUD2 2O6VB 3A9KB 4ZHPA 2KWVB 3ZNID 4ZOHC 4WH4A 1RAXA 1KLGD 1FFUA 3RNBC 3M95A 3Q3JA 1IGCA 4EKUA 3C8YA 3MC0B 1LM8B 2QCZA 3TMPB 2Y5PA 3H7SA 1H8CA 1R4MB 1AARA 2LVOA 1FNUA 1T6BX 2JPHA 1IPGA 3ZGZA 1V80A 3BK1A 1WXQA 3MFGA 1TYGB 3OLMD 2IGHA 3A1QB 2KZRA 3GE8C 1SBBB 2LJ5A 2JZ3B 2PKOA 4NQLB 2K6QA 5L95C 3ZRCA 4C80A 1ZXIA 2L1AA 2N7EA 2LUEA 5AUKA 2BF8B 4JPSA 3VRBB 2EKEC 3Q8EA 1XLOA 2MA9B 2C5LC 2N4FA 1I7HA 2PIAA 1HEZE 2LUMA 5G2NA 1TS2A 1DOYA 4N58A 3MHSD 2FE8A 4CHKA 1P7FA 2C7MB 3A9JB 4A55A 4HJKA 4II2B 2NBWB 3ZXVA 2PMVA 2ZPNA 1WFYA 3QARA 4WQOB 5HG2A 2Y3AA 1MVKA 5IN7A 4GIVA 4BAXA 4BVUC 4WJQA 4GB9A 1HZ5A 3AEGB 2K6DB 1I4XA 5EE9A 2QSDA 2KLGA 2GBMA 1I4PA 5CHWA 5EE0A 1V1PA 1MHXA 2MP2B 4KGRA 1AWDA 1LO5D 4G11A 5HI1A 4GU2A 4K81A 3R7QA 2FCNA 1TIFA 2OJWA 3N1YC 4ASWC 4PT5A 4XGAB 3P63A 4WURA 2LD9A 3QK0A 2D5GA 1ZP0B 4YTMB 1C9FA 1UELA 3MJ5A 4W9EA 2K5PA 2YEPB 3PZ7A 3S2AA 1TGZB 1YIWA 2KVZA 3UQBA 1ISNA 1DOXA 1V49A 3B9JA 1QZEA 3OJ4B 1NDDA 2FAZA 3WAOA 1OTRB 1V5OA 2PVOD 2Y5CA 1S3SG 4M8MA 3VTWA 3M63B 2D3AA 3KUDB 2XK5B 1NVID 3IHPC 1WRDB 1UNSA 3VDZA 1FM0D 3KWVA 1SE2A 5C3JB 2MWSB 1WYGA 2KX0A 3HRDD 4WJPA 2MRPA 4KIKA 5IKCM 1WX7A 3DBLB 3N9YC 4EFOA 3ZTCA 1N62A 1NYRA 3P1MA 1V6EA 2N9PC 1WF9A 4F8CB 1UD7A 3ZJTA 3JYUA 2ASQA 4IG7B 2GBJA 2LWPA 2ZZPB 2K3UA 3VRAB 3AU5A 2PE6B 1UH6A 4I6LB 5FKAC 4JE3B 3NZ3A 2KTRA 2HD5B 2RDHA 1TKGA 2CS4A 4R3DA 4HROA 3W1SA 4ICVA 1WJNA 3EECA 3WA0A 1KRHA 1SE3A 4IKGA 5HHDG 5IAAC 2KNBA 4URKA 3GOEA 3DBRI 1TZ1A 1SE4A 2FCSA 4MT5A 4KDLB 3IG3A 4AOFA 4A8XC 2KO3A 2LXCA 2WQYB 2JWUA 1NI3A 1HQRD 4GDKA 1WGRA 4KGTA 4RH6A 3MTNB 2NVUI 4GN1A 3Q6BA 3B2FA 1WGYA 2NS5A 4MJSA 4RGOS 4AQ7A 3H7PA 5FR3A 1WXAA 2Z8LA 3AE4B 3IXSA 3AH7A 2ZW0A 3GZNB 2JWZA 2BYFA 5AZGA 3GS2A 5HKHA 1UUPA 4GLSC 5J2RA 4HDOA 4A3OA 3AE7B 3ZDTA 2LRUA 3PRPB 4JX1C 4DHJD 3GE3C 1J19A 4XDCA 1OQQA 2AL3A 2V3SA 1KF6B 2L05A 2PE9A 3UIPB 3P4SB 2R61A 3U7DA 1YN4A 3NZUA 2MJDA 4OVUA 4HPLB 1OEYA 2LVQA 4NJCA 1KJTA 2O2VA 3SFEB 4RM9A 2KYWA 1T0RC 4REZA 1WE6A 4HK2A 3LDZE 3NVZA 3TEYA 3H8HA 2KJ6A 4M0WA 3DHHC 2AX5A 2KTFA 2QILA 2N9EB 2GI9A 2DLBA 3H6NA 2D3GA 3UF8A 3AV8A 2M0XA 1V9JA 3TIXA 4HKZE 3KYCD 1XXGA 4K3CA 1VZ6A 2WP9B 2HJ1A 4OZAA 2I2YA 2MBHA 1EWYC 2L83A 4WJNA 4LNOA 3QX1A 1L0YB 2DX5B 1WZ0A 2PPHA 2L00B 5LNK1 2V9HA 3M62B 4W9JA 1CJEA 2G1EA 2DHZA 2LI5A 5BMHA 2QHOA 2RPQA 2K9XA 3RPFC 4HDQA 2WXHA 4EUTA 1ZKHA 3AMZA 1WIAA 1H4RA 2VZKB 4LCDE 1M4VA 4FHJA 2KXJA 3APDA 3AEFB 4LNNA 3ZDMC 3LXFA 2H88B 3AE5B 1K51A 2KQSA 1GB4A 2WDTB 4LTUA 1CMXB 3LB8C 3EA6A 4YSZB 3PS6A 1UWXA 4XYCA 3TEZA 3FC4A 2WXKA 2AQ2B 1HTQA 2E6XA 2J4XA 3JSVB 4OZCA 3DWMA 4B0MA 4LNFA 4PS8A 1QT9A 2KFKB 4C56C 3B0AA 2ZNVB 1YD8U 1L6UA 2XBBC 2LJIA 2WHIA 3AN1A 4M01A 4RFBA 4LK0M 5CHFA 1VZ7A 1ZE3D 3TL5A 1WX8A 5BMIA 4MH8A 3AECB 2CU3A 3QCAA 2VH2A 3ECIA 1L5PA 3BK2A 4KKIA 5BYQA 5DPRA 3T9LA 4USAA 2FNJB 4OW0A 3KVFB 2UU7A 4IWQA 3VUYA 1AN8A 3X23A 3HM6X 3DPDA 3NG0A 1Z2MA 2CU1A 2RSUA 3OWEB 5CTRC 2QMTA 4ICUA 3AEEB 3DVNU 3H9DA 4FULA 2ZW1A 2INDC 2KWUB 4ZRJA 1VZ8A 2Z59B 1FNVA 2BS4B 3R2TA 2D11A 4AJYB 3PLVA 3EFUA 4LDTB 3FAHA 2B3AA 4HXDA 2AEHA 1JRPA 4NAWB 3RNGC 1A5RA 3RULA 1M94A 3NUHB 4HRSA 2PTLA 1RM6C 1HTOA 4CYEA 2NCNA 4I6PA 4S17A 3RNEC 5D94A 2W9NA 3ZIMA 1A70A 1XF5L 2KWCA 4IDIA 1XCQL 3PZDA 1WJUA 2LRWA 4FHKA 2KWDA 2LMCA 2JSVX 1D4BA 3Q8CA 3PPAA 1OQYA 2M56B 3WAPA 4J3OD 2KMCA 5IP4D 3V6EB 2GB1A 4QAYA 2FIDA 1QF6A 3IVFA 1PYWD 5IA7A 5D7GA 2CR5A 4L1BA 2KACA 2K8BA 3NVWA 3PHXB 3AE6B 3AXCA 2QC8A 3B2GA 4W9DA 2J0KA 1PFDA 2BVCA 5E6PA 3BIID 3T3OA 3CF6E 1JROA 3CIRB 1Z5SB 1SSNA 4WJOA 3V6CB 3I9V1 2EKIA 3P4RB 1JQ4A 3CWIA 2IDYA 1EF1A 4FN2A 2RR9A 1I42A 1RLFA 4LJPB 3N32A 2LFIA 4BOZB 4BOSC 2O6VA 2M8SA 5I4DA 4RGTA 2GOWA 2FCMA 2V1YA 2MCNB 3BINA 2K0PA 1FRRA 2IO0B 3OJ3A 1RFAA 2C7HA 1R4MI 1JWBD 3VQIA 1D3ZA 4G50A 2WU5B 3Q14C 5JXVA 4TUUA 3V62A 2MLBA 4KSKC 4MGYE 1V97A 1WGKA 3W1SC 1E8XA 1C4CA 1RRBA 2IY0B 3ZRFA 3PHWB 3DWGC 1STEA 2IO1B 3A1QA 1OFFA 2WDVB 2LGYA 1E5WA 5KHOA 2NR2A 5C23A 4XDDA 3RD2A 2ZEQA 2VH1A 3UQAA 4DK5A 1OEYJ 3Q3OC 1Q0WB 2KMAA 3ZJUA 1WR6E 4W9GA 2DYOA 3RZWC 4AJWA 4MM3B 4A20A 4EZJA 3NOBA 1JALA 1EUVB 2GMIC 2G9HD 4E3CA 3A4SC 2KKCA 3U4EG 4ZYNA 2KAJA 1ROEA 1GJZA 2MEKA 2M17A 4JWUC 2SEBD 1TS3A 1JWSD 2G45B 2N1WA 3A9JA 3WANA 1ZOYB 1MG8A 1PGBA 1NBFC 2VRRB 1K8RB 4FJVB 4TSSA 4ARCA 4HPMB 2W3SA 1P98A 2NTSA 3IAS1 4NNJB 5KHQA 1E6EB 2DAFA 3DBSA 5C2TB 1F52A 1YNTE 1XLNA 2WXFA 1GB1A 2FCQA 3QA8A 3WIMA 1ZW7A 4CQNA 2Y5BB 2WXMA 2W55A 2D07B 5EE1A 1XD3B 1WM3A 5EDSA 4MH0E 2BW2A 3A4RA 3BVZA 4ZRIA 2GLSA 1KTKA 2KJHB 1K50A 2ZVNA 1TY0A 2PJHA 4F7ZA 1EU4A 1ET6A 4JWSC 4DWFA 3N30A 4YTPB 4N9F4 3RNFC 4US8A 3FKYA 1JMLA 4YWGG 2VZKD 3AU4A 1XCTL 2L0TA 3MC9A 1NEKB 2K25A 1R7SA 4YL8A 1AYFA 3U52E 3U8ZA 2D2QA 1VRAB 3K9PB 3Q8BA 1HXYD 3AE1B 3ZTDA 5BYRA 1L0XB 4N59A 5IO9A 2G4SA 3VTUA 2KMMA 1VLBA 3MHZA 3AE2B 1C78A 3N3KB 3PRMB 1LGRA 1DOIA 1TKEA 2L52A 4ZRPA 4HLEA 4EZKA 2IPKD 2R2OA 3P4QB 4C4VA 2DZKA 2ON8A 4WAFA 1I4RA 4TQ1A 3L4PA 1B9RA 4B0EA 1WR1A 2MH7A 3L08A 1TS4A 3RZFA 1Q5WB 2AL6A 3ZJVA 2JVCA 3PRZA 2DZMA 2KOXA 4XWTA 1JWMD 2WXOA 2BTEA 3RUIB 2YLMA 2DENB 4K7WA 2KN4A 2DZJA 2Q5WD 5E6JA 3DOWA 4YXDB 3NZSA 3O65B 3ZKJC 4NJ6A 1KM7A 1I4QA 4P7IA 2C60A 2NPTB 4KDIC 3N1ZC 2A5UA 4US9A 4LDTD 3T8MA 2WYQA 3RCZA 3HM3A 2W54A 3SHQA 4B95A 4BKGA 4JLCA 4FXCA 3QJZA 1E9MA 4KV2A 3QQ8B 1V81A 2CJOA 2JY6A 2OOBB 4OHJA 3E56A 1XT9B 3Q2AC 4HJGE 2BBCA 3P2BA 1GC7A 1P7EA 3VUWA 4TMAB 3ETRA 3V3XA 2BWES 3IAM1 1LXDA 1WJ6A 2JRHA 1YOVB 2JUOA 3GZNI 1UF0A 4FJZA 4LNIA 4UDUC 4E74A 3BVGA 1FXTB 1WGHA 1XQQA 4ZHOA 2IZVB 3EFCA 3ZNZB 1UBIA 4RMAA 5H8YE 2BGFA 4MACA 2Z0EB 4OZBA 2XN9C 4TV3A 4XWWA 2KTRB 3AM9A 4ZYSA 4K1RB 1V86A 3RMKC 1WGGA 3CSFA 2LHEA 3L17A 3SDLC 4HCNB 2GBRA 1WZ3A 1BXTA 3ZLZA 1E7UA 2LGIA 1EU3A 4LLGM 4GDLA 4PS7A 4PK1A 1YX6B 2WLBA 4NAMA 2OEDA 5DPSA 3DBHB 5L83A 1OGWA 2HDEA 1WMHB 2RDGA 4GDKB 5GXGB 4AS1A 2GBKA 4HWIB 2ZCCA 3PV1A 4YSYB 3PSEB 3H7PB 3L0WB 1VJKA 3HUIA 1GNUA 2RGFA 2RMMA 4RF0A 3AEBB 1QOGA 4YSXB 2PW9A 3TJPA 4IM2A 4EOYA 1P1AA 1IUEA 3TUOA 4B6WA 4HCPB 3BZDB 1PUTA 4BKSD 3RFZB 2ICIA 2BB5A 2REXA 2DYBA 1Q10A 5GMVA 2BS2B 1N5WA 1XLQA 4MELA 3J9CA 1GC6A 2JX5A 3AEAB 5LXIB 2L7RA 2LGXA 3VVWB 2JU6X 3RYTA 1FMAD 2O2VB 4MSMB 2K1FA 3BWUD 2H89B 1SF0A 2KFJA 1KLVA 1E8YA 1JCKB 2KC2A 3NS8A 4I6NB 2XNAC 1YJ1A 2DZIA 1J7BA 2L8JA 3SFDB 1SEBD 4DBGA 2L0FA 3JSVA 4FADA 4WIPA 1T3QA 2DNFA 2V0GA 3DVGX 1EO6A 4L2YA 2CJNA 3FILB 4H2AA 3U7ZA 1ET9A 3ML9A 3Q8AA 2HE7A 3NHEB 3LYYA 2KDEB 4KZ0A 2JF5A 3KWLA 2RPVA 1JWUD 2QEJC 3HK0A 1DYQA 2BYTA 3VUXA 1WXSA 2N9KA 1WXVA 3AE9B 2KHWB 1FNWA 3I63C 4KSLC 4W9LA 4XZ4A 3R7RA 4YT0B 3IBEA 3VH4B 2ONQA 2FUG1 4GGQA 4MDKE 2MBEA 3ALBA 1R4NB 3ZW3A 1EM7A 5D3IB 4W9KA 1P0RA 4ARIA 2I38A 3TEWA 3P4PB 2WS3B 2KQ7A 2CKHB 1SXTA 4W9HA 3V60A 3TBLD 2G3QB 4MGZE 2KANA 4RGNA 5D3DA 2D10A 3WCQA 2LEKA 1YQ3B 2NTTA 4TQ0A 3QC8B 4MSQB 5E6OA 2FBWB 3VTVA 4HKQA 1VD2A 4HEA1 4O1NA 1TBEA 2LGSA 3ZXRA 1VR9A 2L32A 3QHTA 1OQRA 2M0AA 4DXGA 1QOAA 1E0ZA 3HVDA 1UGJA 1DGJA 2CHXA 3PREA 5J18A 1T0QC 1LQBA 1V5TA 2X38A 2OJRA 3R66C 3SR6A 1V8CA 4JL9A 1XEEA 2DWQA 3NJTA 1I4HA 4II3B 4F1SA 1TY2A 2J53A 1BUIC 3UI3A 3VH3B 1TS5A 3I3TB 4KVGB 2V4IB 1IBXB 1MPEA 2C9WB 4ITKA 4W9CA 5IOIA 3RNCC 1FPYA 1P3QU 2V3PA 4GXBA 2KQ4X 1YN5A 3NY5A 1WWTA 1YQ4B 2MBQA 1FD6A 5JZEB 3PLUA 4DDGD 4BKTA 4KGSA 1TTNA 5DPWA 3CMMB 1WRIA 3R3MA 2LGDA 1P9DU 5G55A 1C3TA 3RT3B 3NRZA 2NBUA 3BYTB 1EWCA 3SU8X 4LNKA 1ENFA 3V61A 3A9KA 3EUB2 4ZRKA 1KFYB 1N6ZA 2MX2A 3QWZB 2M4NA 3T3NA 2SAKA 4WWPA 2IY1B 3PZ8A 1KLUD 1J0GA 1SB3C 5LLIA 1C4PA 2EELA 4NZLB 2FIFA 1WJ4A 1F1HA 4MM3A 3VR9B 3APCA 4GOCA 4CO7A 2MQJA 2MJEA 4WWNA 5C1ZA 3IT6B 1YJIA 4NJ7A 2WXGA 4FLHA 3I57A 4G3XB 1HA5A 2BQQA 4OVVA 2JXTA 4Q2JA 4BBNC 2WXPA 3ML8A 5JH5C 1B1ZA 2I1KA 2J52A 3CSTA 1HZ6A 2IGDA 1RYJA 1KOTA 5BYSA 3E9SA 1JW9D 3PVLA 1SGHA 4A90A 5AEKB 4AWJA 1J7AA 2J0MA 5TSSA 3DHIC 1Y56A 5DPTA 3VFKA 1D5MC 1JRUA 1WGDA 3D32A 2PLPA 4IC7B 5AUIA 1WI0A 5BO4B 3RI7C 2K22A 2INNE 3C19A 2WU2B 3AB5A 1E10A 4FJYA 4TKNA 2INCC 2LHDA 3ZYYX 2JZPA 1F2RI 2MP2A 3M3JA 3P42A 2A4ZA 2WXQA 4JGHB 1UBQA 2UYZB 1GPXA 3B1LX 3TSSA 1PQSA 5H92C 2E3TA 2Z0DB 3ZQ4A 4M00A 1I35A 1IGDA 3W9CB 2JQRB 3ONSA 2L3ZA 2WX1A 1IYFA 1T0YA 4XX5A 3W5UB 1PDXA 1KH0A 1D5XC 2AYOB 3GB1A 4RF1A 3W2DA 3ENEA 1TJEA 1QILA 1T0SC 1J8CA 1L0VB 1CQVA 5T8IA 2BKFA 3JVZX 2JZZA 1QOBA 4ZDVA 2KDIA 3DQVA 4A3PA 5D2MB 2XK5A 5FR6A 2R2QA 5G5GA 1L2NA 2FUHB 3DBLI 4RNAA 4DXAB 4PYUA 1TZOA 5JHBA 1V1OA 3X0WA 1V1PB 3KLSX 1FCCC 2IO3B 1U4AA 2WDQB 2KJRA 3IT4B 3WALA 4HPPA 3KH0A 5LXHA 3U30A 2G4DB 1MI0A 2PEAA 2NPTA 2PVGC 2ZNVC 4MEMA 2CHZA 2W3RA 3APFA 1TKYA 2DAJA 2X8XX 2MBBB 1MJDA 4RCOA 2ZCBA 2MJ3A 3Q69A 1L7YA 3AI5A 4A9AA 3DVGY 1XO3A 4OVZA 2N1VA 1PGAA 2KD0A 4DHZB 2W82A 1GAQB 3EC8A 4ANUA 2DYMA 1AW7A 3SD5A 1YJJA 4C4VB 5E6NA 3ZO5B 5TR5A 2JYTA 2ZPYA 4KZCA 5J17A 2L76A 1FCLA 3OAWA 4RM8A 1QOFA 3VAWA 1JWAD 4KIKB 4B9KA 1UWMA 3ZNGC 4IOIE 3H1UA 2YEPF 4S0RA 4P16A 5FK9C 4LJOB 4NY0A 1MG4A 2V4LA 1RWSA 3BY4B 4NPNA 3RN9C 2HTHA 4N6EB 3DDCB 4DHZE 4ANVA 2BYEA 1SIJA 3MJWA 1VCBA 1FXAA 3DBHI 1IP9A 1WMHA 1YMHE 3AE3B 4DQOC 1E8ZA 2WWZA 3MP9A 2XEWA 3KUZA 2WDRB 1CZPA 1V2YA 1PGXA 4K3BA 1X1MA 2BPSA 3DBRB 3DVNV 4EZLA 1J7CA 1F0ZA 2WNMA 1C76A 1SIFA 2ZJDA 2WGSA 4J6IA 3HHMA 3SEBA 4WWMA 4RGMA 4BZAA 2NMQA 4IWPA 1F77A 4MJSB 2GRIA 1K53A 2QJLA 4K7UA 1F9JA 1WXMA
chains in the Genus database with same CATH topology
4XDDA 1ZDVA 4RGNA 5D3DA 3WCQA 1DOXA 3URYA 3EGRA 2LEKA 3ZJUA 1YQ3B 3B9JA 2NTTA 4TQ0A 2DYOA 3Q8FA 2QIEB 4MM3B 2PVOD 2FBWB 2Y5CA 1JALA 1ZXHA 2BS3B 3BYYB 2G9HD 1NVID 4GDLB 4HKQA 4HEA1 4O1NA 1UNSA 1VDVA 1FM0D 3KWVA 1SE2A 1VR9A 3U4EG 5C3JB 2KAJA 1ROEA 3NVVA 1WYGA 2L32A 2MEKA 1OQRA 2M0AA 3HRDD 4JWUC 2SEBD 1TS3A 1QOAA 1JWSD 4D2KA 4DXGA 1E0ZA 2IGGA 1RFKA 3HVDA 3N9YC 1UGJA 1ZOYB 1DGJA 1PGBA 1N62A 1NYRA 3P1MA 5HFYA 3PO0A 1ZDXA 2X38A 3ZJTA 4DXFA 4TSSA 4ARCA 3V05A 2W3SA 3SR6A 2NTSA 4YTNB 1V8CA 3IAS1 1XEEA 2DWQA 1I4HA 2K3UA 3VRAB 1E6EB 5FKAC 3FILA 1TY2A 3BVMA 2AQ3B 5C2TB 2J53A 4JE3B 3NZ3A 1YNTE 5G5HA 1BUIC 2RDHA 1TKGA 3UI3A 1TS5A 2JYEA 1XLNA 2V4IB 1N63A 2WXFA 1MPEA 4HROA 4R3DA 1GB1A 4ITKA 3W1SA 1IBXB 4CQNA 2WXMA 2W55A 1KRHA 1SE3A 5EE1A 2V3PA 4IKGA 2KQ4X 5HHDG 1YN5A 1N61A 1WWTA 1YQ4B 2BW2A 3BVZA 1FD6A 2WXLA 1SE4A 4KGSA 4MT5A 1WSPA 1KTKA 3TEXA 1WRIA 1CK1A 4A8XC 1K50A 1QLBB 2WQYB 1TY0A 1T5XD 2JWUA 1NI3A 1HQRD 3ABVB 3NRZA 2WXRA 4KGTA 4RH6A 3BYTB 1EWCA 4XE0A 1ZPSA 1EU4A 5MPOA 4WQMA 2V3NA 1GOZA 1ENFA 1ET6A 4JWSC 1SJED 3EUB2 1MHHE 1KFYB 3NVYA 3R2IA 3B2FA 4YTPB 2AQ1B 3T3NA 2SAKA 1JMLA 4RGOS 2ACZB 3AEDB 4AQ7A 4YWGG 2VZKD 5FR3A 1C4AA 1NYQA 1KLUD 2Z8LA 3AE4B 3AH7A 1XCTL 2ZW0A 3IXSA 3PZ8A 1NEKB 3GS2A 1UUPA 4GLSC 1R7SA 1SB3C 2N0SB 2M19A 3GP7A 1C4PA 1AYFA 4P6VF 2B76B 3U52E 2EELA 4NZLB 5BMGA 3AE7B 4JX1C 1FXIA 1VRAB 2BT6A 3VR8B 1ACCA 3Q8BA 4XDCA 3VR9B 1FIQA 1HXYD 3AE1B 3KQ4A 5BYRA 1OQQA 2N7JA 1KF6B 3NS1A 2MJEA 1L0XB 4N59A 1L6VA 1SJHD 3P4SB 1F2RC 2KMMA 1VLBA 2R61A 1YJIA 3IT6B 3MHZA 1L4ZB 1YN4A 3AE2B 1C78A 2WXGA 1DOIA 1TKEA 2L52A 1HA5A 3I57A 4ZRPA 2MJDA 2IPKD 2JXTA 4C7YA 4NJCA 3P4QB 4Q2JA 2WXPA 2IJ0A 1B1ZA 2J52A 4ZRQA 2KDMA 2ON8A 3SFEB 4WAFA 1I4RA 4TQ1A 1HZ6A 3L4PA 2IGDA 1RYJA 1B9RA 3U2SC 5BYSA 4REZA 3E9SA 1JW9D 3HVZA 4A90A 2MH7A 4B0EA 1TS4A 3NVZA 1N60A 3TEYA 4KX6B 3H8HA 2WXIA 3ZJVA 1N5XA 4M0WA 1J7AA 5TSSA 1IBXA 2DBYA 4XWTA 1JWMD 1Y56A 1E7PB 2WXOA 2BTEA 2AX5A 2QILA 2KN4A 2Q5WD 5E6JA 1FEHA 2GI9A 2DLBA 4YXDB 1D5MC 1I4QA 4L23A 3AV8A 2OHFA 2PLPA 1I4GA 5AUIA 4EE2A 4HKZE 1L4DB 1XXGA 4US9A 1ESFA 1VZ6A 2WP9B 2K22A 2INNE 1C77A 4OZAA 2I2YA 2W54A 1EWYC 2WU2B 2L83A 3AB5A 1E10A 4FXCA 3R8BA 1NENB 1E9MA 1L0YB 1D6EC 5LNK1 2CJOA 2LHDA 4A6QA 3O13A 3ZYYX 3AE8B 4OHJA 2JZPA 2BB6A 1CJEA 3E56A 1F2RI 5EE3A 1K52A 2WXNA 4HJGE 2G1EA 2BBCA 2INPE 1P7EA 4TMAB 3ETRA 5BMHA 3V3XA 3P42A 3IAM1 2WXQA 4C7ZA 2K9XA 3RPFC 1GPXA 4UDUC 3TSSA 1XLPA 2WXHA 5H92C 3BVGA 3AMZA 2E3TA 2VZKB 3ZQ4A 1M4VA 4ZHOA 1IGDA 3AEFB 3W9CB 2JQRB 3LXFA 2H88B 1FRDA 1K51A 3AE5B 5H8YE 1GB4A 4LTUA 2N9LA 3LB8C 4MACA 3EA6A 4OZBA 4YSZB 3W5VB 1QQRA 1PDXA 3W5UB 2XN9C 2J42A 1FO4A 1UWXA 4XWWA 3TEZA 1KH0A 3AM9A 4ZYSA 1D5XC 2HTME 3FC4A 2WXKA 2AQ2B 1FFVA 2E6XA 3GB1A 4RF1A 2J4XA 3W2DA 1TJEA 1QILA 4OZCA 3DWMA 1L0VB 2LHEA 4B0MA 1CQVA 5T8IA 1QT9A 1BMLC 4C56C 1YN3A 1QOBA 1BXTA 1L6UA 2LJIA 3AN1A 2LGIA 4RFBA 1EU3A 4LK0M 1VZ7A 4LLGM 1ZE3D 1C79A 5BMIA 4NAMA 2WLBA 2OEDA 4MH8A 3AECB 4KKJA 2CU3A 2TSSA 2HDEA 4GDKB 2RDGA 2WXJA 1L5PA 5G5GA 5GXGB 3BK2A 4RNAA 4AS1A 4KKIA 5BYQA 4USAA 1TZOA 1V1OA 4OW0A 1QKZA 1V1PB 1D5ZC 1ZUD2 3KLSX 1FCCC 1AN8A 4ZHPA 2WDQB 4YSYB 4ZOHC 3OWEB 4WH4A 2QMTA 1KLGD 1VJKA 1FFUA 3IT4B 3HUIA 3AEEB 2RMMA 4RF0A 2ZW1A 3AEBB 1MI0A 1IGCA 3C8YA 1QOGA 2PVGC 3MC0B 1VZ8A 4YSXB 2W3RA 2Y5PA 2PW9A 1FNVA 1TKYA 2BS4B 3R2TA 1IUEA 1FNUA 3TUOA 1T6BX 3FAHA 3BZDB 3ZGZA 1PUTA 3BK1A 4RCOA 3RFZB 2ICIA 1WXQA 3MFGA 1TYGB 2IGHA 1JRPA 4NAWB 2MJ3A 2BB5A 1SBBB 3Q69A 2PKOA 1Q10A 4A9AA 1XO3A 3NUHB 4HRSA 2BS2B 2PTLA 1N5WA 1RM6C 1XLQA 4OVZA 4C80A 1PGAA 1ZXIA 3J9CA 2L1AA 2JX5A 3AEAB 5AUKA 2W82A 1GAQB 4JPSA 3VRBB 1A70A 3Q8EA 1XLOA 2DYMA 1AW7A 1XF5L 4IDIA 1XCQL 1YJJA 2JU6X 1FMAD 1I7HA 2JYTA 2PIAA 1HEZE 2LUMA 3BWUD 2H89B 1SF0A 1TS2A 1DOYA 4N58A 2KWDA 2LMCA 2FE8A 2JSVX 1D4BA 3Q8CA 1P7FA 1JCKB 1FCLA 2M56B 1QOFA 2XNAC 1JWAD 1J7BA 4J3OD 1UWMA 2GB1A 1QF6A 4A55A 4IOIE 3SFDB 1SEBD 2YEPF 1PYWD 4P16A 5D7GA 4L1BA 2KACA 5FK9C 4WIPA 2PMVA 1T3QA 3NVWA 3AE6B 2V0GA 1RWSA 4L2YA 5HG2A 2Y3AA 3B2GA 1MVKA 1PFDA 2CJNA 4N6EB 3FILB 3BIID 3T3OA 4H2AA 3U7ZA 1JROA 1ET9A 3Q8AA 3CIRB 1SSNA 1SIJA 3I9V1 2EKIA 3LYYA 3P4RB 1JQ4A 1FXAA 3CWIA 2IDYA 1HZ5A 3AEGB 1I4XA 3KWLA 1YMHE 3AE3B 5EE9A 4DQOC 2QSDA 1JWUD 2RPVA 2QEJC 3MP9A 1DYQA 2WDRB 1CZPA 1I4PA 5EE0A 2BYTA 1V1PA 2LFIA 1PGXA 1MHXA 2N9KA 5I4DA 3AE9B 4KGRA 1FNWA 4RGTA 1J7CA 1AWDA 1LO5D 5HI1A 1F0ZA 2WNMA 2K0PA 4YT0B 2ONQA 1FRRA 2FUG1 1C76A 1JWBD 4PT5A 3VQIA 3P63A 2WU5B 5JXVA 4WURA 3SEBA 2D5GA 1EM7A 4WWMA 5D3IB 1ZP0B 4RGMA 4YTMB 1C9FA 4ARIA 2NMQA 1V97A 2I38A 1WGKA 3MJ5A 1C4CA 3TEWA 1F77A 3P4PB 2K5PA 1STEA 1K53A 2GRIA 2QJLA 1OFFA 2WS3B 2WDVB 2YEPB 3DWGC 3PZ7A 4US8A 1SXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGA A;  1XCT L;  2ZW0 A;  4GLS C;  1XF5 L;  1XCQ L;  2EEL A;  2JU6 X;  1IGD A;  5BMG A;  1HEZ E;  2LUM A;  1ZXH A;  2KWD A;  1K51 A;  1GB4 A;  2N9L A;  4MAC A;  2JSV X;  1D4B A;  4OZB A;  1P7F A;  1FCL A;  2N7J A;  1UWX A;  1KH0 A;  4D2K A;  2IGG A;  3GB1 A;  2GB1 A;  1F2R C;  4IOI E;  4OZC A;  2LHE A;  1PGB A;  5HFY A;  2KAC A;  2JXT A;  5HG2 A;  2J52 A;  2KDM A;  1MVK A;  2ON8 A;  2LGI A;  1HZ6 A;  2IGD A;  3FIL B;  3FIL A;  5BMI A;  2J53 A;  2OED A;  1YNT E;  3UI3 A;  1HZ5 A;  1IBX B;  1MPE A;  1GB1 A;  1YMH E;  2QSD A;  2RPV A;  1IBX A;  3MP9 A;  1QKZ A;  4IKG A;  2KQ4 X;  2KN4 A;  1FCC C;  5HHD G;  1PGX A;  2GI9 A;  1MHX A;  2N9K A;  4WH4 A;  4KGR A;  1FD6 A;  2QMT A;  2PLP A;  2RMM A;  4KGS A;  5HI1 A;  2ZW1 A;  4HKZ E;  1MI0 A;  1IGC A;  2K0P A;  2ONQ A;  1K50 A;  4OZA A;  2PW9 A;  2I2Y A;  2JWU A;  5JXV A;  4KGT A;  1EM7 A;  2LHD A;  1C9F A;  2NMQ A;  2JZP A;  2I38 A;  1F2R I;  1K52 A;  2IGH A;  1MHH E;  4HJG E;  1K53 A;  1P7E A;  1Q10 A;  1JML A;  5BMH A;  3V3X A;  2PTL A; 
#chains in the Genus database with same CATH topology
 1ZDV A;  3ZVV A;  3UIO B;  3VHT C;  1Q1O A;  3URY A;  3EGR A;  1C1Y B;  1YQB A;  2NBV B;  3MC8 A;  4IM0 A;  3Q8F A;  2QIE B;  4FA6 A;  2JXX A;  1BT0 A;  1ZXH A;  2BS3 B;  3AUL A;  3VXW A;  3BYY B;  4GDL B;  1VDV A;  2YVC A;  3C0R B;  3OG5 A;  2HJ8 A;  1ZGU B;  3NVV A;  4D2K A;  2O6V D;  2UWQ A;  2IGG A;  1RFK A;  2KN5 A;  4W9I A;  2D3B A;  2KC1 A;  4E71 A;  3Q3N C;  5HFY A;  3PO0 A;  3A33 B;  4BBN F;  1ZDX A;  4DXF A;  2K8H A;  3V05 A;  2N7D A;  5AZH A;  1WH3 A;  2M1M A;  1UGM A;  4NQK E;  4YTN B;  4C00 A;  1G6J A;  3FIL A;  4WAA A;  3TCA A;  3BVM A;  2AQ3 B;  4IWO A;  5G5H A;  4M0W B;  3Q3F A;  5AZF A;  2JYE A;  4WWO A;  1LFD A;  1N63 A;  3PTF C;  2KVR A;  3EHV A;  5CX3 A;  4PYZ A;  2JT4 B;  2IO2 B;  1E7V A;  5CHV C;  2AWT A;  3WAM A;  1UZX B;  1N61 A;  3KUC B;  2KFK A;  4HVB A;  2WXL A;  5DCN A;  3ZNH B;  4G0N B;  1WSP A;  3TEX A;  4JQW C;  1CK1 A;  4AP4 C;  2GBN A;  1QLB B;  4PS3 A;  2RD0 A;  2BKR B;  1T5X D;  2J0J A;  1R4N I;  3ABV B;  4GSW A;  1GUA B;  2WXR A;  4XE0 A;  1ZPS A;  5MPO A;  4WQM A;  2V3N A;  4MGI E;  1GOZ A;  2EMS A;  1NI2 A;  1SJE D;  1MHH E;  3B08 A;  3NVY A;  3R2I A;  2J7Q B;  2AQ1 B;  4GMV A;  3W1Y A;  2ACZ B;  3AED B;  4M8N A;  1C4A A;  1NYQ A;  2WX0 A;  3K9O B;  2N0S B;  3L16 A;  2M19 A;  3GP7 A;  4P6V F;  2B76 B;  1TT5 B;  2LAS A;  5BMG A;  1FXI A;  2BT6 A;  3VR8 B;  1ACC A;  2KT7 A;  4BFR A;  1FIQ A;  3KQ4 A;  2LVP A;  2N7J A;  4NAW A;  3NS1 A;  1L6V A;  2ZVO A;  1SJH D;  2JRI B;  3I5J C;  3RNA C;  4P1B C;  4X57 B;  1F2R C;  3KYD D;  1L4Z B;  2BWF A;  4IM3 A;  1WYW B;  4C7Y A;  5D6J B;  4W9F A;  2IJ0 A;  4ZRQ A;  2KDM A;  3ZUN A;  2MBO A;  5JHA A;  2IBI B;  3L10 B;  3U2S C;  3HVZ A;  3N1X C;  3LJ3 A;  2N9X A;  1N60 A;  2KLC A;  3PT2 B;  4KX6 B;  3UGB B;  2WXI A;  1N5X A;  1WX9 A;  1EF5 A;  2KDB A;  1IBX A;  2DBY A;  1E8W A;  1E7P B;  4JIO U;  2MHJ A;  3DHG C;  3N20 C;  1FEH A;  1SE9 A;  1YX5 B;  4P1C C;  4L23 A;  4ANX A;  4IW0 A;  2OHF A;  3JW0 X;  1I4G A;  4EE2 A;  3L13 A;  1L4D B;  3QIJ A;  1ESF A;  1C77 A;  3DCG A;  2QDF A;  2D3C A;  3R8B A;  1NEN B;  3IFW B;  1HE8 A;  1D6E C;  2C7N B;  4A6Q A;  2KX3 A;  3O13 A;  3AE8 B;  2RDB C;  2BB6 A;  5EE3 A;  4ACF A;  1K52 A;  2WXN A;  4XC2 A;  2INP E;  2LXA A;  3L54 A;  2EMT A;  2K8C A;  2BYV E;  4C7Z A;  2K39 A;  1WM2 A;  1XLP A;  2MSE D;  3QAQ A;  1WE7 A;  4DDI D;  3KW5 B;  4ANW A;  1FRD A;  2CHW A;  1GG3 A;  2N9L A;  3HIZ A;  3W5V B;  1QQR A;  2J42 A;  1FO4 A;  2HTM E;  1Y8R C;  4DHJ B;  1E90 A;  1FFV A;  4BKS A;  4FBJ B;  1S1Q B;  1BML C;  2LZ6 A;  4EEW A;  4AUQ C;  1YN3 A;  2I1J A;  1MFW A;  2KK8 A;  1C79 A;  4M02 A;  4KKJ A;  2TSS A;  2WXJ A;  4IUM B;  2MW5 A;  3Q3M C;  4K7S A;  4MGK E;  2KDF B;  2IYD B;  3PGE A;  3UIN B;  1QKZ A;  1D5Z C;  1WY8 A;  1ZUD 2;  2O6V B;  3A9K B;  4ZHP A;  2KWV B;  3ZNI D;  4ZOH C;  4WH4 A;  1RAX A;  1KLG D;  1FFU A;  3RNB C;  3M95 A;  3Q3J A;  1IGC A;  4EKU A;  3C8Y A;  3MC0 B;  1LM8 B;  2QCZ A;  3TMP B;  2Y5P A;  3H7S A;  1H8C A;  1R4M B;  1AAR A;  2LVO A;  1FNU A;  1T6B X;  2JPH A;  1IPG A;  3ZGZ A;  1V80 A;  3BK1 A;  1WXQ A;  3MFG A;  1TYG B;  3OLM D;  2IGH A;  3A1Q B;  2KZR A;  3GE8 C;  1SBB B;  2LJ5 A;  2JZ3 B;  2PKO A;  4NQL B;  2K6Q A;  5L95 C;  3ZRC A;  4C80 A;  1ZXI A;  2L1A A;  2N7E A;  2LUE A;  5AUK A;  2BF8 B;  4JPS A;  3VRB B;  2EKE C;  3Q8E A;  1XLO A;  2MA9 B;  2C5L C;  2N4F A;  1I7H A;  2PIA A;  1HEZ E;  2LUM A;  5G2N A;  1TS2 A;  1DOY A;  4N58 A;  3MHS D;  2FE8 A;  4CHK A;  1P7F A;  2C7M B;  3A9J B;  4A55 A;  4HJK A;  4II2 B;  2NBW B;  3ZXV A;  2PMV A;  2ZPN A;  1WFY A;  3QAR A;  4WQO B;  5HG2 A;  2Y3A A;  1MVK A;  5IN7 A;  4GIV A;  4BAX A;  4BVU C;  4WJQ A;  4GB9 A;  1HZ5 A;  3AEG B;  2K6D B;  1I4X A;  5EE9 A;  2QSD A;  2KLG A;  2GBM A;  1I4P A;  5CHW A;  5EE0 A;  1V1P A;  1MHX A;  2MP2 B;  4KGR A;  1AWD A;  1LO5 D;  4G11 A;  5HI1 A;  4GU2 A;  4K81 A;  3R7Q A;  2FCN A;  1TIF A;  2OJW A;  3N1Y C;  4ASW C;  4PT5 A;  4XGA B;  3P63 A;  4WUR A;  2LD9 A;  3QK0 A;  2D5G A;  1ZP0 B;  4YTM B;  1C9F A;  1UEL A;  3MJ5 A;  4W9E A;  2K5P A;  2YEP B;  3PZ7 A;  3S2A A;  1TGZ B;  1YIW A;  2KVZ A;  3UQB A;  1ISN A;  1DOX A;  1V49 A;  3B9J A;  1QZE A;  3OJ4 B;  1NDD A;  2FAZ A;  3WAO A;  1OTR B;  1V5O A;  2PVO D;  2Y5C A;  1S3S G;  4M8M A;  3VTW A;  3M63 B;  2D3A A;  3KUD B;  2XK5 B;  1NVI D;  3IHP C;  1WRD B;  1UNS A;  3VDZ A;  1FM0 D;  3KWV A;  1SE2 A;  5C3J B;  2MWS B;  1WYG A;  2KX0 A;  3HRD D;  4WJP A;  2MRP A;  4KIK A;  5IKC M;  1WX7 A;  3DBL B;  3N9Y C;  4EFO A;  3ZTC A;  1N62 A;  1NYR A;  3P1M A;  1V6E A;  2N9P C;  1WF9 A;  4F8C B;  1UD7 A;  3ZJT A;  3JYU A;  2ASQ A;  4IG7 B;  2GBJ A;  2LWP A;  2ZZP B;  2K3U A;  3VRA B;  3AU5 A;  2PE6 B;  1UH6 A;  4I6L B;  5FKA C;  4JE3 B;  3NZ3 A;  2KTR A;  2HD5 B;  2RDH A;  1TKG A;  2CS4 A;  4R3D A;  4HRO A;  3W1S A;  4ICV A;  1WJN A;  3EEC A;  3WA0 A;  1KRH A;  1SE3 A;  4IKG A;  5HHD G;  5IAA C;  2KNB A;  4URK A;  3GOE A;  3DBR I;  1TZ1 A;  1SE4 A;  2FCS A;  4MT5 A;  4KDL B;  3IG3 A;  4AOF A;  4A8X C;  2KO3 A;  2LXC A;  2WQY B;  2JWU A;  1NI3 A;  1HQR D;  4GDK A;  1WGR A;  4KGT A;  4RH6 A;  3MTN B;  2NVU I;  4GN1 A;  3Q6B A;  3B2F A;  1WGY A;  2NS5 A;  4MJS A;  4RGO S;  4AQ7 A;  3H7P A;  5FR3 A;  1WXA A;  2Z8L A;  3AE4 B;  3IXS A;  3AH7 A;  2ZW0 A;  3GZN B;  2JWZ A;  2BYF A;  5AZG A;  3GS2 A;  5HKH A;  1UUP A;  4GLS C;  5J2R A;  4HDO A;  4A3O A;  3AE7 B;  3ZDT A;  2LRU A;  3PRP B;  4JX1 C;  4DHJ D;  3GE3 C;  1J19 A;  4XDC A;  1OQQ A;  2AL3 A;  2V3S A;  1KF6 B;  2L05 A;  2PE9 A;  3UIP B;  3P4S B;  2R61 A;  3U7D A;  1YN4 A;  3NZU A;  2MJD A;  4OVU A;  4HPL B;  1OEY A;  2LVQ A;  4NJC A;  1KJT A;  2O2V A;  3SFE B;  4RM9 A;  2KYW A;  1T0R C;  4REZ A;  1WE6 A;  4HK2 A;  3LDZ E;  3NVZ A;  3TEY A;  3H8H A;  2KJ6 A;  4M0W A;  3DHH C;  2AX5 A;  2KTF A;  2QIL A;  2N9E B;  2GI9 A;  2DLB A;  3H6N A;  2D3G A;  3UF8 A;  3AV8 A;  2M0X A;  1V9J A;  3TIX A;  4HKZ E;  3KYC D;  1XXG A;  4K3C A;  1VZ6 A;  2WP9 B;  2HJ1 A;  4OZA A;  2I2Y A;  2MBH A;  1EWY C;  2L83 A;  4WJN A;  4LNO A;  3QX1 A;  1L0Y B;  2DX5 B;  1WZ0 A;  2PPH A;  2L00 B;  5LNK 1;  2V9H A;  3M62 B;  4W9J A;  1CJE A;  2G1E A;  2DHZ A;  2LI5 A;  5BMH A;  2QHO A;  2RPQ A;  2K9X A;  3RPF C;  4HDQ A;  2WXH A;  4EUT A;  1ZKH A;  3AMZ A;  1WIA A;  1H4R A;  2VZK B;  4LCD E;  1M4V A;  4FHJ A;  2KXJ A;  3APD A;  3AEF B;  4LNN A;  3ZDM C;  3LXF A;  2H88 B;  3AE5 B;  1K51 A;  2KQS A;  1GB4 A;  2WDT B;  4LTU A;  1CMX B;  3LB8 C;  3EA6 A;  4YSZ B;  3PS6 A;  1UWX A;  4XYC A;  3TEZ A;  3FC4 A;  2WXK A;  2AQ2 B;  1HTQ A;  2E6X A;  2J4X A;  3JSV B;  4OZC A;  3DWM A;  4B0M A;  4LNF A;  4PS8 A;  1QT9 A;  2KFK B;  4C56 C;  3B0A A;  2ZNV B;  1YD8 U;  1L6U A;  2XBB C;  2LJI A;  2WHI A;  3AN1 A;  4M01 A;  4RFB A;  4LK0 M;  5CHF A;  1VZ7 A;  1ZE3 D;  3TL5 A;  1WX8 A;  5BMI A;  4MH8 A;  3AEC B;  2CU3 A;  3QCA A;  2VH2 A;  3ECI A;  1L5P A;  3BK2 A;  4KKI A;  5BYQ A;  5DPR A;  3T9L A;  4USA A;  2FNJ B;  4OW0 A;  3KVF B;  2UU7 A;  4IWQ A;  3VUY A;  1AN8 A;  3X23 A;  3HM6 X;  3DPD A;  3NG0 A;  1Z2M A;  2CU1 A;  2RSU A;  3OWE B;  5CTR C;  2QMT A;  4ICU A;  3AEE B;  3DVN U;  3H9D A;  4FUL A;  2ZW1 A;  2IND C;  2KWU B;  4ZRJ A;  1VZ8 A;  2Z59 B;  1FNV A;  2BS4 B;  3R2T A;  2D11 A;  4AJY B;  3PLV A;  3EFU A;  4LDT B;  3FAH A;  2B3A A;  4HXD A;  2AEH A;  1JRP A;  4NAW B;  3RNG C;  1A5R A;  3RUL A;  1M94 A;  3NUH B;  4HRS A;  2PTL A;  1RM6 C;  1HTO A;  4CYE A;  2NCN A;  4I6P A;  4S17 A;  3RNE C;  5D94 A;  2W9N A;  3ZIM A;  1A70 A;  1XF5 L;  2KWC A;  4IDI A;  1XCQ L;  3PZD A;  1WJU A;  2LRW A;  4FHK A;  2KWD A;  2LMC A;  2JSV X;  1D4B A;  3Q8C A;  3PPA A;  1OQY A;  2M56 B;  3WAP A;  4J3O D;  2KMC A;  5IP4 D;  3V6E B;  2GB1 A;  4QAY A;  2FID A;  1QF6 A;  3IVF A;  1PYW D;  5IA7 A;  5D7G A;  2CR5 A;  4L1B A;  2KAC A;  2K8B A;  3NVW A;  3PHX B;  3AE6 B;  3AXC A;  2QC8 A;  3B2G A;  4W9D A;  2J0K A;  1PFD A;  2BVC A;  5E6P A;  3BII D;  3T3O A;  3CF6 E;  1JRO A;  3CIR B;  1Z5S B;  1SSN A;  4WJO A;  3V6C B;  3I9V 1;  2EKI A;  3P4R B;  1JQ4 A;  3CWI A;  2IDY A;  1EF1 A;  4FN2 A;  2RR9 A;  1I42 A;  1RLF A;  4LJP B;  3N32 A;  2LFI A;  4BOZ B;  4BOS C;  2O6V A;  2M8S A;  5I4D A;  4RGT A;  2GOW A;  2FCM A;  2V1Y A;  2MCN B;  3BIN A;  2K0P A;  1FRR A;  2IO0 B;  3OJ3 A;  1RFA A;  2C7H A;  1R4M I;  1JWB D;  3VQI A;  1D3Z A;  4G50 A;  2WU5 B;  3Q14 C;  5JXV A;  4TUU A;  3V62 A;  2MLB A;  4KSK C;  4MGY E;  1V97 A;  1WGK A;  3W1S C;  1E8X A;  1C4C A;  1RRB A;  2IY0 B;  3ZRF A;  3PHW B;  3DWG C;  1STE A;  2IO1 B;  3A1Q A;  1OFF A;  2WDV B;  2LGY A;  1E5W A;  5KHO A;  2NR2 A;  5C23 A;  4XDD A;  3RD2 A;  2ZEQ A;  2VH1 A;  3UQA A;  4DK5 A;  1OEY J;  3Q3O C;  1Q0W B;  2KMA A;  3ZJU A;  1WR6 E;  4W9G A;  2DYO A;  3RZW C;  4AJW A;  4MM3 B;  4A20 A;  4EZJ A;  3NOB A;  1JAL A;  1EUV B;  2GMI C;  2G9H D;  4E3C A;  3A4S C;  2KKC A;  3U4E G;  4ZYN A;  2KAJ A;  1ROE A;  1GJZ A;  2MEK A;  2M17 A;  4JWU C;  2SEB D;  1TS3 A;  1JWS D;  2G45 B;  2N1W A;  3A9J A;  3WAN A;  1ZOY B;  1MG8 A;  1PGB A;  1NBF C;  2VRR B;  1K8R B;  4FJV B;  4TSS A;  4ARC A;  4HPM B;  2W3S A;  1P98 A;  2NTS A;  3IAS 1;  4NNJ B;  5KHQ A;  1E6E B;  2DAF A;  3DBS A;  5C2T B;  1F52 A;  1YNT E;  1XLN A;  2WXF A;  1GB1 A;  2FCQ A;  3QA8 A;  3WIM A;  1ZW7 A;  4CQN A;  2Y5B B;  2WXM A;  2W55 A;  2D07 B;  5EE1 A;  1XD3 B;  1WM3 A;  5EDS A;  4MH0 E;  2BW2 A;  3A4R A;  3BVZ A;  4ZRI A;  2GLS A;  1KTK A;  2KJH B;  1K50 A;  2ZVN A;  1TY0 A;  2PJH A;  4F7Z A;  1EU4 A;  1ET6 A;  4JWS C;  4DWF A;  3N30 A;  4YTP B;  4N9F 4;  3RNF C;  4US8 A;  3FKY A;  1JML A;  4YWG G;  2VZK D;  3AU4 A;  1XCT L;  2L0T A;  3MC9 A;  1NEK B;  2K25 A;  1R7S A;  4YL8 A;  1AYF A;  3U52 E;  3U8Z A;  2D2Q A;  1VRA B;  3K9P B;  3Q8B A;  1HXY D;  3AE1 B;  3ZTD A;  5BYR A;  1L0X B;  4N59 A;  5IO9 A;  2G4S A;  3VTU A;  2KMM A;  1VLB A;  3MHZ A;  3AE2 B;  1C78 A;  3N3K B;  3PRM B;  1LGR A;  1DOI A;  1TKE A;  2L52 A;  4ZRP A;  4HLE A;  4EZK A;  2IPK D;  2R2O A;  3P4Q B;  4C4V A;  2DZK A;  2ON8 A;  4WAF A;  1I4R A;  4TQ1 A;  3L4P A;  1B9R A;  4B0E A;  1WR1 A;  2MH7 A;  3L08 A;  1TS4 A;  3RZF A;  1Q5W B;  2AL6 A;  3ZJV A;  2JVC A;  3PRZ A;  2DZM A;  2KOX A;  4XWT A;  1JWM D;  2WXO A;  2BTE A;  3RUI B;  2YLM A;  2DEN B;  4K7W A;  2KN4 A;  2DZJ A;  2Q5W D;  5E6J A;  3DOW A;  4YXD B;  3NZS A;  3O65 B;  3ZKJ C;  4NJ6 A;  1KM7 A;  1I4Q A;  4P7I A;  2C60 A;  2NPT B;  4KDI C;  3N1Z C;  2A5U A;  4US9 A;  4LDT D;  3T8M A;  2WYQ A;  3RCZ A;  3HM3 A;  2W54 A;  3SHQ A;  4B95 A;  4BKG A;  4JLC A;  4FXC A;  3QJZ A;  1E9M A;  4KV2 A;  3QQ8 B;  1V81 A;  2CJO A;  2JY6 A;  2OOB B;  4OHJ A;  3E56 A;  1XT9 B;  3Q2A C;  4HJG E;  2BBC A;  3P2B A;  1GC7 A;  1P7E A;  3VUW A;  4TMA B;  3ETR A;  3V3X A;  2BWE S;  3IAM 1;  1LXD A;  1WJ6 A;  2JRH A;  1YOV B;  2JUO A;  3GZN I;  1UF0 A;  4FJZ A;  4LNI A;  4UDU C;  4E74 A;  3BVG A;  1FXT B;  1WGH A;  1XQQ A;  4ZHO A;  2IZV B;  3EFC A;  3ZNZ B;  1UBI A;  4RMA A;  5H8Y E;  2BGF A;  4MAC A;  2Z0E B;  4OZB A;  2XN9 C;  4TV3 A;  4XWW A;  2KTR B;  3AM9 A;  4ZYS A;  4K1R B;  1V86 A;  3RMK C;  1WGG A;  3CSF A;  2LHE A;  3L17 A;  3SDL C;  4HCN B;  2GBR A;  1WZ3 A;  1BXT A;  3ZLZ A;  1E7U A;  2LGI A;  1EU3 A;  4LLG M;  4GDL A;  4PS7 A;  4PK1 A;  1YX6 B;  2WLB A;  4NAM A;  2OED A;  5DPS A;  3DBH B;  5L83 A;  1OGW A;  2HDE A;  1WMH B;  2RDG A;  4GDK B;  5GXG B;  4AS1 A;  2GBK A;  4HWI B;  2ZCC A;  3PV1 A;  4YSY B;  3PSE B;  3H7P B;  3L0W B;  1VJK A;  3HUI A;  1GNU A;  2RGF A;  2RMM A;  4RF0 A;  3AEB B;  1QOG A;  4YSX B;  2PW9 A;  3TJP A;  4IM2 A;  4EOY A;  1P1A A;  1IUE A;  3TUO A;  4B6W A;  4HCP B;  3BZD B;  1PUT A;  4BKS D;  3RFZ B;  2ICI A;  2BB5 A;  2REX A;  2DYB A;  1Q10 A;  5GMV A;  2BS2 B;  1N5W A;  1XLQ A;  4MEL A;  3J9C A;  1GC6 A;  2JX5 A;  3AEA B;  5LXI B;  2L7R A;  2LGX A;  3VVW B;  2JU6 X;  3RYT A;  1FMA D;  2O2V B;  4MSM B;  2K1F A;  3BWU D;  2H89 B;  1SF0 A;  2KFJ A;  1KLV A;  1E8Y A;  1JCK B;  2KC2 A;  3NS8 A;  4I6N B;  2XNA C;  1YJ1 A;  2DZI A;  1J7B A;  2L8J A;  3SFD B;  1SEB D;  4DBG A;  2L0F A;  3JSV A;  4FAD A;  4WIP A;  1T3Q A;  2DNF A;  2V0G A;  3DVG X;  1EO6 A;  4L2Y A;  2CJN A;  3FIL B;  4H2A A;  3U7Z A;  1ET9 A;  3ML9 A;  3Q8A A;  2HE7 A;  3NHE B;  3LYY A;  2KDE B;  4KZ0 A;  2JF5 A;  3KWL A;  2RPV A;  1JWU D;  2QEJ C;  3HK0 A;  1DYQ A;  2BYT A;  3VUX A;  1WXS A;  2N9K A;  1WXV A;  3AE9 B;  2KHW B;  1FNW A;  3I63 C;  4KSL C;  4W9L A;  4XZ4 A;  3R7R A;  4YT0 B;  3IBE A;  3VH4 B;  2ONQ A;  2FUG 1;  4GGQ A;  4MDK E;  2MBE A;  3ALB A;  1R4N B;  3ZW3 A;  1EM7 A;  5D3I B;  4W9K A;  1P0R A;  4ARI A;  2I38 A;  3TEW A;  3P4P B;  2WS3 B;  2KQ7 A;  2CKH B;  1SXT A;  4W9H A;  3V60 A;  3TBL D;  2G3Q B;  4MGZ E;  2KAN A;  4RGN A;  5D3D A;  2D10 A;  3WCQ A;  2LEK A;  1YQ3 B;  2NTT A;  4TQ0 A;  3QC8 B;  4MSQ B;  5E6O A;  2FBW B;  3VTV A;  4HKQ A;  1VD2 A;  4HEA 1;  4O1N A;  1TBE A;  2LGS A;  3ZXR A;  1VR9 A;  2L32 A;  3QHT A;  1OQR A;  2M0A A;  4DXG A;  1QOA A;  1E0Z A;  3HVD A;  1UGJ A;  1DGJ A;  2CHX A;  3PRE A;  5J18 A;  1T0Q C;  1LQB A;  1V5T A;  2X38 A;  2OJR A;  3R66 C;  3SR6 A;  1V8C A;  4JL9 A;  1XEE A;  2DWQ A;  3NJT A;  1I4H A;  4II3 B;  4F1S A;  1TY2 A;  2J53 A;  1BUI C;  3UI3 A;  3VH3 B;  1TS5 A;  3I3T B;  4KVG B;  2V4I B;  1IBX B;  1MPE A;  2C9W B;  4ITK A;  4W9C A;  5IOI A;  3RNC C;  1FPY A;  1P3Q U;  2V3P A;  4GXB A;  2KQ4 X;  1YN5 A;  3NY5 A;  1WWT A;  1YQ4 B;  2MBQ A;  1FD6 A;  5JZE B;  3PLU A;  4DDG D;  4BKT A;  4KGS A;  1TTN A;  5DPW A;  3CMM B;  1WRI A;  3R3M A;  2LGD A;  1P9D U;  5G55 A;  1C3T A;  3RT3 B;  3NRZ A;  2NBU A;  3BYT B;  1EWC A;  3SU8 X;  4LNK A;  1ENF A;  3V61 A;  3A9K A;  3EUB 2;  4ZRK A;  1KFY B;  1N6Z A;  2MX2 A;  3QWZ B;  2M4N A;  3T3N A;  2SAK A;  4WWP A;  2IY1 B;  3PZ8 A;  1KLU D;  1J0G A;  1SB3 C;  5LLI A;  1C4P A;  2EEL A;  4NZL B;  2FIF A;  1WJ4 A;  1F1H A;  4MM3 A;  3VR9 B;  3APC A;  4GOC A;  4CO7 A;  2MQJ A;  2MJE A;  4WWN A;  5C1Z A;  3IT6 B;  1YJI A;  4NJ7 A;  2WXG A;  4FLH A;  3I57 A;  4G3X B;  1HA5 A;  2BQQ A;  4OVV A;  2JXT A;  4Q2J A;  4BBN C;  2WXP A;  3ML8 A;  5JH5 C;  1B1Z A;  2I1K A;  2J52 A;  3CST A;  1HZ6 A;  2IGD A;  1RYJ A;  1KOT A;  5BYS A;  3E9S A;  1JW9 D;  3PVL A;  1SGH A;  4A90 A;  5AEK B;  4AWJ A;  1J7A A;  2J0M A;  5TSS A;  3DHI C;  1Y56 A;  5DPT A;  3VFK A;  1D5M C;  1JRU A;  1WGD A;  3D32 A;  2PLP A;  4IC7 B;  5AUI A;  1WI0 A;  5BO4 B;  3RI7 C;  2K22 A;  2INN E;  3C19 A;  2WU2 B;  3AB5 A;  1E10 A;  4FJY A;  4TKN A;  2INC C;  2LHD A;  3ZYY X;  2JZP A;  1F2R I;  2MP2 A;  3M3J A;  3P42 A;  2A4Z A;  2WXQ A;  4JGH B;  1UBQ A;  2UYZ B;  1GPX A;  3B1L X;  3TSS A;  1PQS A;  5H92 C;  2E3T A;  2Z0D B;  3ZQ4 A;  4M00 A;  1I35 A;  1IGD A;  3W9C B;  2JQR B;  3ONS A;  2L3Z A;  2WX1 A;  1IYF A;  1T0Y A;  4XX5 A;  3W5U B;  1PDX A;  1KH0 A;  1D5X C;  2AYO B;  3GB1 A;  4RF1 A;  3W2D A;  3ENE A;  1TJE A;  1QIL A;  1T0S C;  1J8C A;  1L0V B;  1CQV A;  5T8I A;  2BKF A;  3JVZ X;  2JZZ A;  1QOB A;  4ZDV A;  2KDI A;  3DQV A;  4A3P A;  5D2M B;  2XK5 A;  5FR6 A;  2R2Q A;  5G5G A;  1L2N A;  2FUH B;  3DBL I;  4RNA A;  4DXA B;  4PYU A;  1TZO A;  5JHB A;  1V1O A;  3X0W A;  1V1P B;  3KLS X;  1FCC C;  2IO3 B;  1U4A A;  2WDQ B;  2KJR A;  3IT4 B;  3WAL A;  4HPP A;  3KH0 A;  5LXH A;  3U30 A;  2G4D B;  1MI0 A;  2PEA A;  2NPT A;  2PVG C;  2ZNV C;  4MEM A;  2CHZ A;  2W3R A;  3APF A;  1TKY A;  2DAJ A;  2X8X X;  2MBB B;  1MJD A;  4RCO A;  2ZCB A;  2MJ3 A;  3Q69 A;  1L7Y A;  3AI5 A;  4A9A A;  3DVG Y;  1XO3 A;  4OVZ A;  2N1V A;  1PGA A;  2KD0 A;  4DHZ B;  2W82 A;  1GAQ B;  3EC8 A;  4ANU A;  2DYM A;  1AW7 A;  3SD5 A;  1YJJ A;  4C4V B;  5E6N A;  3ZO5 B;  5TR5 A;  2JYT A;  2ZPY A;  4KZC A;  5J17 A;  2L76 A;  1FCL A;  3OAW A;  4RM8 A;  1QOF A;  3VAW A;  1JWA D;  4KIK B;  4B9K A;  1UWM A;  3ZNG C;  4IOI E;  3H1U A;  2YEP F;  4S0R A;  4P16 A;  5FK9 C;  4LJO B;  4NY0 A;  1MG4 A;  2V4L A;  1RWS A;  3BY4 B;  4NPN A;  3RN9 C;  2HTH A;  4N6E B;  3DDC B;  4DHZ E;  4ANV A;  2BYE A;  1SIJ A;  3MJW A;  1VCB A;  1FXA A;  3DBH I;  1IP9 A;  1WMH A;  1YMH E;  3AE3 B;  4DQO C;  1E8Z A;  2WWZ A;  3MP9 A;  2XEW A;  3KUZ A;  2WDR B;  1CZP A;  1V2Y A;  1PGX A;  4K3B A;  1X1M A;  2BPS A;  3DBR B;  3DVN V;  4EZL A;  1J7C A;  1F0Z A;  2WNM A;  1C76 A;  1SIF A;  2ZJD A;  2WGS A;  4J6I A;  3HHM A;  3SEB A;  4WWM A;  4RGM A;  4BZA A;  2NMQ A;  4IWP A;  1F77 A;  4MJS B;  2GRI A;  1K53 A;  2QJL A;  4K7U A;  1F9J A;  1WXM A; 
#chains in the Genus database with same CATH homology
 4XDD A;  1ZDV A;  4RGN A;  5D3D A;  3WCQ A;  1DOX A;  3URY A;  3EGR A;  2LEK A;  3ZJU A;  1YQ3 B;  3B9J A;  2NTT A;  4TQ0 A;  2DYO A;  3Q8F A;  2QIE B;  4MM3 B;  2PVO D;  2FBW B;  2Y5C A;  1JAL A;  1ZXH A;  2BS3 B;  3BYY B;  2G9H D;  1NVI D;  4GDL B;  4HKQ A;  4HEA 1;  4O1N A;  1UNS A;  1VDV A;  1FM0 D;  3KWV A;  1SE2 A;  1VR9 A;  3U4E G;  5C3J B;  2KAJ A;  1ROE A;  3NVV A;  1WYG A;  2L32 A;  2MEK A;  1OQR A;  2M0A A;  3HRD D;  4JWU C;  2SEB D;  1TS3 A;  1QOA A;  1JWS D;  4D2K A;  4DXG A;  1E0Z A;  2IGG A;  1RFK A;  3HVD A;  3N9Y C;  1UGJ A;  1ZOY B;  1DGJ A;  1PGB A;  1N62 A;  1NYR A;  3P1M A;  5HFY A;  3PO0 A;  1ZDX A;  2X38 A;  3ZJT A;  4DXF A;  4TSS A;  4ARC A;  3V05 A;  2W3S A;  3SR6 A;  2NTS A;  4YTN B;  1V8C A;  3IAS 1;  1XEE A;  2DWQ A;  1I4H A;  2K3U A;  3VRA B;  1E6E B;  5FKA C;  3FIL A;  1TY2 A;  3BVM A;  2AQ3 B;  5C2T B;  2J53 A;  4JE3 B;  3NZ3 A;  1YNT E;  5G5H A;  1BUI C;  2RDH A;  1TKG A;  3UI3 A;  1TS5 A;  2JYE A;  1XLN A;  2V4I B;  1N63 A;  2WXF A;  1MPE A;  4HRO A;  4R3D A;  1GB1 A;  4ITK A;  3W1S A;  1IBX B;  4CQN A;  2WXM A;  2W55 A;  1KRH A;  1SE3 A;  5EE1 A;  2V3P A;  4IKG A;  2KQ4 X;  5HHD G;  1YN5 A;  1N61 A;  1WWT A;  1YQ4 B;  2BW2 A;  3BVZ A;  1FD6 A;  2WXL A;  1SE4 A;  4KGS A;  4MT5 A;  1WSP A;  1KTK A;  3TEX A;  1WRI A;  1CK1 A;  4A8X C;  1K50 A;  1QLB B;  2WQY B;  1TY0 A;  1T5X D;  2JWU A;  1NI3 A;  1HQR D;  3ABV B;  3NRZ A;  2WXR A;  4KGT A;  4RH6 A;  3BYT B;  1EWC A;  4XE0 A;  1ZPS A;  1EU4 A;  5MPO A;  4WQM A;  2V3N A;  1GOZ A;  1ENF A;  1ET6 A;  4JWS C;  1SJE D;  3EUB 2;  1MHH E;  1KFY B;  3NVY A;  3R2I A;  3B2F A;  4YTP B;  2AQ1 B;  3T3N A;  2SAK A;  1JML A;  4RGO S;  2ACZ B;  3AED B;  4AQ7 A;  4YWG G;  2VZK D;  5FR3 A;  1C4A A;  1NYQ A;  1KLU D;  2Z8L A;  3AE4 B;  3AH7 A;  1XCT L;  2ZW0 A;  3IXS A;  3PZ8 A;  1NEK B;  3GS2 A;  1UUP A;  4GLS C;  1R7S A;  1SB3 C;  2N0S B;  2M19 A;  3GP7 A;  1C4P A;  1AYF A;  4P6V F;  2B76 B;  3U52 E;  2EEL A;  4NZL B;  5BMG A;  3AE7 B;  4JX1 C;  1FXI A;  1VRA B;  2BT6 A;  3VR8 B;  1ACC A;  3Q8B A;  4XDC A;  3VR9 B;  1FIQ A;  1HXY D;  3AE1 B;  3KQ4 A;  5BYR A;  1OQQ A;  2N7J A;  1KF6 B;  3NS1 A;  2MJE A;  1L0X B;  4N59 A;  1L6V A;  1SJH D;  3P4S B;  1F2R C;  2KMM A;  1VLB A;  2R61 A;  1YJI A;  3IT6 B;  3MHZ A;  1L4Z B;  1YN4 A;  3AE2 B;  1C78 A;  2WXG A;  1DOI A;  1TKE A;  2L52 A;  1HA5 A;  3I57 A;  4ZRP A;  2MJD A;  2IPK D;  2JXT A;  4C7Y A;  4NJC A;  3P4Q B;  4Q2J A;  2WXP A;  2IJ0 A;  1B1Z A;  2J52 A;  4ZRQ A;  2KDM A;  2ON8 A;  3SFE B;  4WAF A;  1I4R A;  4TQ1 A;  1HZ6 A;  3L4P A;  2IGD A;  1RYJ A;  1B9R A;  3U2S C;  5BYS A;  4REZ A;  3E9S A;  1JW9 D;  3HVZ A;  4A90 A;  2MH7 A;  4B0E A;  1TS4 A;  3NVZ A;  1N60 A;  3TEY A;  4KX6 B;  3H8H A;  2WXI A;  3ZJV A;  1N5X A;  4M0W A;  1J7A A;  5TSS A;  1IBX A;  2DBY A;  4XWT A;  1JWM D;  1Y56 A;  1E7P B;  2WXO A;  2BTE A;  2AX5 A;  2QIL A;  2KN4 A;  2Q5W D;  5E6J A;  1FEH A;  2GI9 A;  2DLB A;  4YXD B;  1D5M C;  1I4Q A;  4L23 A;  3AV8 A;  2OHF A;  2PLP A;  1I4G A;  5AUI A;  4EE2 A;  4HKZ E;  1L4D B;  1XXG A;  4US9 A;  1ESF A;  1VZ6 A;  2WP9 B;  2K22 A;  2INN E;  1C77 A;  4OZA A;  2I2Y A;  2W54 A;  1EWY C;  2WU2 B;  2L83 A;  3AB5 A;  1E10 A;  4FXC A;  3R8B A;  1NEN B;  1E9M A;  1L0Y B;  1D6E C;  5LNK 1;  2CJO A;  2LHD A;  4A6Q A;  3O13 A;  3ZYY X;  3AE8 B;  4OHJ A;  2JZP A;  2BB6 A;  1CJE A;  3E56 A;  1F2R I;  5EE3 A;  1K52 A;  2WXN A;  4HJG E;  2G1E A;  2BBC A;  2INP E;  1P7E A;  4TMA B;  3ETR A;  5BMH A;  3V3X A;  3P42 A;  3IAM 1;  2WXQ A;  4C7Z A;  2K9X A;  3RPF C;  1GPX A;  4UDU C;  3TSS A;  1XLP A;  2WXH A;  5H92 C;  3BVG A;  3AMZ A;  2E3T A;  2VZK B;  3ZQ4 A;  1M4V A;  4ZHO A;  1IGD A;  3AEF B;  3W9C B;  2JQR B;  3LXF A;  2H88 B;  1FRD A;  1K51 A;  3AE5 B;  5H8Y E;  1GB4 A;  4LTU A;  2N9L A;  3LB8 C;  4MAC A;  3EA6 A;  4OZB A;  4YSZ B;  3W5V B;  1QQR A;  1PDX A;  3W5U B;  2XN9 C;  2J42 A;  1FO4 A;  1UWX A;  4XWW A;  3TEZ A;  1KH0 A;  3AM9 A;  4ZYS A;  1D5X C;  2HTM E;  3FC4 A;  2WXK A;  2AQ2 B;  1FFV A;  2E6X A;  3GB1 A;  4RF1 A;  2J4X A;  3W2D A;  1TJE A;  1QIL A;  4OZC A;  3DWM A;  1L0V B;  2LHE A;  4B0M A;  1CQV A;  5T8I A;  1QT9 A;  1BML C;  4C56 C;  1YN3 A;  1QOB A;  1BXT A;  1L6U A;  2LJI A;  3AN1 A;  2LGI A;  4RFB A;  1EU3 A;  4LK0 M;  1VZ7 A;  4LLG M;  1ZE3 D;  1C79 A;  5BMI A;  4NAM A;  2WLB A;  2OED A;  4MH8 A;  3AEC B;  4KKJ A;  2CU3 A;  2TSS A;  2HDE A;  4GDK B;  2RDG A;  2WXJ A;  1L5P A;  5G5G A;  5GXG B;  3BK2 A;  4RNA A;  4AS1 A;  4KKI A;  5BYQ A;  4USA A;  1TZO A;  1V1O A;  4OW0 A;  1QKZ A;  1V1P B;  1D5Z C;  1ZUD 2;  3KLS X;  1FCC C;  1AN8 A;  4ZHP A;  2WDQ B;  4YSY B;  4ZOH C;  3OWE B;  4WH4 A;  2QMT A;  1KLG D;  1VJK A;  1FFU A;  3IT4 B;  3HUI A;  3AEE B;  2RMM A;  4RF0 A;  2ZW1 A;  3AEB B;  1MI0 A;  1IGC A;  3C8Y A;  1QOG A;  2PVG C;  3MC0 B;  1VZ8 A;  4YSX B;  2W3R A;  2Y5P A;  2PW9 A;  1FNV A;  1TKY A;  2BS4 B;  3R2T A;  1IUE A;  1FNU A;  3TUO A;  1T6B X;  3FAH A;  3BZD B;  3ZGZ A;  1PUT A;  3BK1 A;  4RCO A;  3RFZ B;  2ICI A;  1WXQ A;  3MFG A;  1TYG B;  2IGH A;  1JRP A;  4NAW B;  2MJ3 A;  2BB5 A;  1SBB B;  3Q69 A;  2PKO A;  1Q10 A;  4A9A A;  1XO3 A;  3NUH B;  4HRS A;  2BS2 B;  2PTL A;  1N5W A;  1RM6 C;  1XLQ A;  4OVZ A;  4C80 A;  1PGA A;  1ZXI A;  3J9C A;  2L1A A;  2JX5 A;  3AEA B;  5AUK A;  2W82 A;  1GAQ B;  4JPS A;  3VRB B;  1A70 A;  3Q8E A;  1XLO A;  2DYM A;  1AW7 A;  1XF5 L;  4IDI A;  1XCQ L;  1YJJ A;  2JU6 X;  1FMA D;  1I7H A;  2JYT A;  2PIA A;  1HEZ E;  2LUM A;  3BWU D;  2H89 B;  1SF0 A;  1TS2 A;  1DOY A;  4N58 A;  2KWD A;  2LMC A;  2FE8 A;  2JSV X;  1D4B A;  3Q8C A;  1P7F A;  1JCK B;  1FCL A;  2M56 B;  1QOF A;  2XNA C;  1JWA D;  1J7B A;  4J3O D;  1UWM A;  2GB1 A;  1QF6 A;  4A55 A;  4IOI E;  3SFD B;  1SEB D;  2YEP F;  1PYW D;  4P16 A;  5D7G A;  4L1B A;  2KAC A;  5FK9 C;  4WIP A;  2PMV A;  1T3Q A;  3NVW A;  3AE6 B;  2V0G A;  1RWS A;  4L2Y A;  5HG2 A;  2Y3A A;  3B2G A;  1MVK A;  1PFD A;  2CJN A;  4N6E B;  3FIL B;  3BII D;  3T3O A;  4H2A A;  3U7Z A;  1JRO A;  1ET9 A;  3Q8A A;  3CIR B;  1SSN A;  1SIJ A;  3I9V 1;  2EKI A;  3LYY A;  3P4R B;  1JQ4 A;  1FXA A;  3CWI A;  2IDY A;  1HZ5 A;  3AEG B;  1I4X A;  3KWL A;  1YMH E;  3AE3 B;  5EE9 A;  4DQO C;  2QSD A;  1JWU D;  2RPV A;  2QEJ C;  3MP9 A;  1DYQ A;  2WDR B;  1CZP A;  1I4P A;  5EE0 A;  2BYT A;  1V1P A;  2LFI A;  1PGX A;  1MHX A;  2N9K A;  5I4D A;  3AE9 B;  4KGR A;  1FNW A;  4RGT A;  1J7C A;  1AWD A;  1LO5 D;  5HI1 A;  1F0Z A;  2WNM A;  2K0P A;  4YT0 B;  2ONQ A;  1FRR A;  2FUG 1;  1C76 A;  1JWB D;  4PT5 A;  3VQI A;  3P63 A;  2WU5 B;  5JXV A;  4WUR A;  3SEB A;  2D5G A;  1EM7 A;  4WWM A;  5D3I B;  1ZP0 B;  4RGM A;  4YTM B;  1C9F A;  4ARI A;  2NMQ A;  1V97 A;  2I38 A;  1WGK A;  3MJ5 A;  1C4C A;  3TEW A;  1F77 A;  3P4P B;  2K5P A;  1STE A;  1K53 A;  2GRI A;  2QJL A;  1OFF A;  2WS3 B;  2WDV B;  2YEP B;  3DWG C;  3PZ7 A;  4US8 A;  1SXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...