1ZXHA

G311 mutant protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'MYYLVVNKGQNAFYETLTKAVDAETARNAFIQSLKDDGVQGVWTYDDATKTFTVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title Solution NMR structures of IgG binding domains with artificially evolved high levels of sequence identity but different folds.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system/protein binding
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1zxhA00
1D4BA 1Q10A 2RMMA 5HI1A 1GB1A 1MI0A 1K52A 1P7EA 4WH4A 1XF5L 3GB1A 1IBXA 1XCQL 2ON8A 1MVKA 2JU6X 2PLPA 4IKGA 2IGGA 1PGXA 5HFYA 4OZAA 4HJGE 1K50A 2GB1A 2N7JA 5JXVA 2JWUA 4IOIE 3UI3A 2KACA 3FILA 2KDMA 3V3XA 2LGIA 2J53A 3MP9A 4HKZE 1HEZE 1GB4A 2LHDA 1MHHE 1IBXB 2KN4A 1HZ6A 1ZXHA 2IGDA 1YNTE 1K51A 2QSDA 2RPVA 4D2KA 5BMHA 2J52A 5BMIA 2I2YA 2QMTA 2PW9A 3FILB 4KGTA 1PGBA 1KH0A 1XCTL 4KGRA 1HZ5A 2PTLA 4OZBA 4OZCA 1YMHE 2JZPA 2KQ4X 4MACA 2OEDA 1JMLA 5HG2A 4GLSC 1EM7A 4KGSA 1FCLA 5HHDG 2JSVX 1P7FA 2N9LA 1C9FA 2ZW0A 1UWXA 2ONQA 1FCCC 1F2RI 2GI9A 2LHEA 1IGCA 2JXTA 2NMQA 1IGDA 1PGAA 1QKZA 1MPEA 2K0PA 1K53A 2IGHA 5BMGA 2N9KA 2LUMA 2EELA 1F2RC 2KWDA 2I38A 2ZW1A 1MHXA 1FD6A
chains in the Genus database with same CATH superfamily
2K25A 2KDFB 1UGMA 4W9JA 1GB1A 5FR3A 2DHZA 3AN1A 4DHZB 4GDLB 1MVKA 2L76A 5E6JA 2JRIB 2DZMA 3N20C 3GP7A 4TMAB 3VH4B 3A1QA 1J0GA 3LDZE 3FILA 4RGOS 2J53A 3ECIA 2K22A 3PHXB 4HPMB 1P98A 3Q3JA 3H8HA 3URYA 5IO9A 2DZIA 1IBXB 2IGDA 2DBYA 4RFBA 2QSDA 2PJHA 4P1BC 4A3OA 4W9EA 2LUEA 2Z59B 3MJ5A 4XGAB 4IWQA 2DNFA 2V4IB 4KV2A 2ICIA 4G11A 4S17A 1PGBA 2V3SA 4ZRIA 3BVMA 1C79A 2FIFA 2GOWA 2VZKB 4WJQA 2V9HA 2KQ4X 2LVOA 4B95A 5CTRC 1BXTA 1JMLA 4GOCA 3I63C 3HM6X 1QOFA 1UF0A 1Y56A 5DPWA 1SIJA 4TQ1A 3U8ZA 4TV3A 3ML9A 3DBLB 2PVGC 3E56A 2K39A 1SXTA 1BT0A 3AECB 2XK5B 3JVZX 5IN7A 4B0MA 1UELA 1V6EA 4NZLB 2KXJA 2Y5CA 1EWYC 3KUDB 4FJVB 3H7PB 4HKQA 2NS5A 2HDEA 3W5VB 3A9JA 3AE2B 2MRPA 3AE4B 2BS4B 4KSLC 3N1YC 4N58A 4FADA 4IM3A 2HJ8A 1YX5B 1NEKB 2DAFA 1R4NB 2KMAA 4ZYSA 1WR6E 2KHWB 2G45B 3KUZA 2IGGA 1YD8U 2BBCA 4OVVA 4MEMA 4HJGE 2KDBA 4YXDB 1FRRA 4YTMB 5LXHA 5HKHA 3N1ZC 1V2YA 4US8A 3IBEA 3CSFA 3FAHA 4IC7B 2MP2B 5T8IA 4EOYA 5BYRA 2REXA 2LGIA 2IO1B 3RNBC 1Y8RC 2JPHA 1T0SC 2IDYA 1EU3A 4FLHA 5G5GA 3M95A 5CHVC 2PE9A 4RGNA 4C00A 1QZEA 4H2AA 5BMHA 3PRMB 4AWJA 1GUAB 3O13A 3BK2A 4WWNA 1ZW7A 1CK1A 1QOGA 1SB3C 3A1QB 1ROEA 1P0RA 4C4VA 2C9WB 3FILB 2WX1A 5E6NA 1XXGA 1KH0A 3H6NA 1WWTA 4GSWA 3ZXVA 2DYMA 2BT6A 4AP4C 1FMAD 3DBRB 1SJED 1SF0A 1UGJA 4KGSA 3DWGC 3BYTB 3MC8A 5LXIB 3AV8A 1VZ7A 1B1ZA 4DBGA 4EE2A 1EU4A 1CQVA 2AEHA 4IUMB 1WGKA 4KVGB 4DDID 3AB5A 2HE7A 2O6VA 3K9OB 1WXVA 1SIFA 2K6DB 4XX5A 2ACZB 4C80A 1YJ1A 1E9MA 2GBRA 3ZGZA 3VRBB 1L4DB 1FRDA 3I5JC 4MELA 2MBHA 2KTRA 5H8YE 1TKEA 1GG3A 3DHGC 2WDRB 1XF5L 2D3GA 2KLGA 3R2IA 5C1ZA 1KFYB 1JWBD 2BYTA 3T8MA 3A9JB 4XWTA 2FIDA 3WA0A 1M4VA 2GLSA 1V80A 2G4DB 3WAOA 3M62B 2LZ6A 1V86A 2I1JA 2LHDA 1R4MB 1WX9A 3NS1A 3DBSA 4LJOB 1V49A 1V97A 3OAWA 4WQOB 1MG8A 3Q8AA 2KLCA 1V1OA 2K3UA 1RRBA 1OEYA 4WURA 4B0EA 1XCTL 1E0ZA 1E6EB 5C23A 1YN5A 2GRIA 4DXFA 1KM7A 4RMAA 3HRDD 3VAWA 3T9LA 3WANA 4GLSC 3KYDD 2DWQA 4P6VF 4WWPA 3P1MA 4K1RB 4C4VB 3TEWA 4IW0A 1L0XB 5I4DA 2DZKA 1YX6B 4EFOA 5BYQA 2N1VA 2MBEA 2LUMA 2WGSA 4R3DA 3U4EG 4HRSA 1BMLC 2M8SA 4II3B 2JYTA 3NZ3A 3N9YC 2D10A 2KWVB 4MT5A 5AEKB 2R61A 1NENB 3DVGY 2O6VB 1TKGA 3NS8A 2KFJA 2FUHB 3KWVA 2MX2A 3RNEC 3L10B 1CZPA 1TYGB 1N61A 2JY6A 2JF5A 3RCZA 4G50A 3V6EB 4HPLB 3QX1A 1OQYA 1C76A 1ZGUB 1N60A 2MJDA 5IOIA 5AZFA 3V60A 2D11A 2BWES 2KTRB 3V62A 4I6NB 3W9CB 3APDA 4BKTA 4C7YA 1YOVB 5FKAC 1FFVA 1SSNA 1UNSA 3KUCB 2D07B 4I6PA 2RPVA 3TJPA 1UBQA 4LNOA 3IHPC 2XN9C 2I1KA 1I35A 2WX0A 3VTUA 3RNAC 3MFGA 1D5XC 1GC6A 2KQ7A 5MPOA 1XLQA 3JW0X 3CF6E 3ENEA 3M63B 1E8ZA 1TGZB 2LI5A 2MHJA 4ICVA 5TR5A 4MGYE 4BVUC 5AUKA 4LCDE 4YWGG 3WALA 1WZ3A 2D2QA 4URKA 3PZ8A 4EUTA 3AE1B 4XDDA 3RN9C 3QCAA 4E3CA 2JWZA 4ARCA 3ML8A 4G3XB 3ZLZA 5EE1A 2IGHA 3ZIMA 1YQBA 4HROA 3VQIA 3U2SC 2WXKA 2XNAC 4XDCA 4W9LA 1L6UA 2KK8A 4RCOA 2KFKA 3ALBA 1YQ3B 2WQYB 3KW5B 3AEGB 1SE2A 1SE3A 1XLOA 1RFAA 2N7DA 2AQ2B 3IVFA 3NZUA 2PIAA 3APFA 1Z5SB 2YVCA 3SDLC 1F9JA 3B08A 4WIPA 1KRHA 3BINA 2QCZA 4US9A 3TSSA 4M00A 1I42A 1YJIA 4OVZA 2MBQA 1KJTA 2UWQA 1YNTE 2L52A 3ZTDA 3VUXA 5FR6A 1HE8A 1GC7A 4II2B 3D32A 4IG7B 4ACFA 1WY8A 2YEPF 4J3OD 3TEXA 2L00B 4KGRA 3VR8B 3AXCA 2YEPB 2LGSA 1V1PA 1LFDA 5E6PA 3QA8A 2JUOA 3W5UB 4BOSC 1XLNA 2OEDA 3DVNU 1D6EC 1I4GA 3LYYA 5J17A 2ZVOA 5DPSA 4DHJB 3W2DA 5TSSA 3R3MA 2KC1A 4HJKA 3TUOA 3PZ7A 2WYQA 4A6QA 1WX7A 5JZEB 2W3RA 1XQQA 1ZDVA 1Q1OA 2BW2A 2YLMA 4ASWC 2Z0EB 1QKZA 2QEJC 4PK1A 4GXBA 1TZOA 3GZNB 1FNVA 2ZNVC 2H89B 5LLIA 3PS6A 3OLMD 1WGGA 2VZKD 2WXPA 2IO0B 3HVDA 1NI2A 4PS3A 4A55A 4ZDVA 4FHKA 1PQSA 2PVOD 1YN4A 1D5ZC 5EE0A 1JWUD 1WM2A 3E9SA 2D5GA 1ZDXA 3AE5B 3WAPA 1XD3B 4A90A 3RFZB 3VTWA 2GB1A 2E6XA 2JWUA 1QOAA 2BTEA 2KFKB 2JYEA 1WXAA 2LWPA 3ZXRA 4EZKA 5C3JB 3IAM1 3TBLD 1N62A 3AE6B 3MP9A 1LXDA 4HLEA 3NZSA 2MBOA 1WGHA 1J7BA 4A8XC 4NJ6A 2NR2A 3EFUA 2J52A 4RF1A 1YIWA 1VZ6A 2WDQB 3J9CA 1WX8A 3EECA 2L32A 5AZGA 4LK0M 2KNBA 1WFYA 1HZ5A 1PDXA 4NQKE 2KZRA 2NTTA 1V81A 2KOXA 2R2OA 5D3IB 3ONSA 3B2GA 4AS1A 4BFRA 4CQNA 1C1YB 4MGIE 1EM7A 5EDSA 1FCLA 1P7FA 4FN2A 4GIVA 4ZRQA 2AX5A 2GBKA 1V1PB 2WXNA 1HQRD 1Q0WB 2ZCBA 2KAJA 2LXAA 2L1AA 1OGWA 4BZAA 3L17A 2WU2B 2WXJA 3NY5A 3PGEA 1F2RC 3GE8C 3Q6BA 5DCNA 2IY1B 5IA7A 3SFEB 1D4BA 3DOWA 2IO2B 3MJWA 4DHZE 4WJPA 1T0YA 1N63A 1JCKB 4C7ZA 1I7HA 4NAWA 1ESFA 2Y5PA 2LJ5A 4YTPB 2M56B 3TMPB 1GNUA 2BS2B 2EMSA 4YSYB 3L4PA 4EKUA 1LQBA 1ZE3D 2FCNA 2IY0B 4HKZE 1GPXA 3PZDA 4REZA 4NJ7A 1GB4A 3IXSA 3P4RB 3Q14C 1WXQA 1VJKA 2V3PA 1L4ZB 1FM0D 2M1MA 2MH7A 3IAS1 2JQRB 1STEA 4IDIA 3BK1A 3WIMA 2G3QB 2MJ3A 1J7AA 4OZBA 2MQJA 4RNAA 3RULA 2ZPNA 2BGFA 4MACA 3KWLA 1QF6A 2NCNA 3B0AA 3SD5A 3T3OA 3QJZA 3SFDB 1L0YB 1RWSA 3P4SB 3C8YA 1LGRA 1SBBB 3OWEB 4MGKE 1AN8A 1R7SA 3MHZA 3VXWA 4JGHB 2GI9A 2KD0A 4JPSA 4W9HA 3U52E 3ZTCA 4JE3B 2NBVB 2EELA 5DPRA 1FEHA 4N9F4 1DOIA 3PTFC 1R4MI 2LFIA 3AEBB 2K8CA 1H8CA 4XWWA 2KO3A 3BZDB 4MDKE 2Z0DB 5JHAA 2L3ZA 5J2RA 3Q8CA 3AMZA 2FCMA 3PLUA 2JU6X 4NPNA 3AM9A 1BUIC 4K7WA 5KHOA 3UQBA 1V5TA 1T3QA 4W9CA 2ZPYA 2JVCA 1FFUA 5JH5C 1WGRA 2BB5A 4FHJA 1K51A 4WJNA 2WS3B 1N5WA 1Q5WB 4NAWB 1CMXB 2KTFA 3LXFA 1NYRA 2FAZA 2Y3AA 3M3JA 2KJHB 2SEBD 3A4RA 1FPYA 3L16A 2ZZPB 1FO4A 4ZYNA 3QARA 4WWMA 4TQ0A 2XBBC 4HPPA 1E8YA 1IYFA 4RH6A 3TEYA 1WXSA 2BQQA 1B9RA 1KTKA 5HG2A 4TKNA 1WF9A 4M01A 2LASA 2MCNB 5AZHA 2QILA 3UIOB 2D3BA 3WCQA 2O2VA 3Q8BA 4RM9A 3C19A 1FNWA 3P4PB 1NI3A 3DVGX 2IYDB 4WJOA 5LNK1 1TS4A 1UZXB 1GJZA 3PPAA 2LHEA 2KDIA 4KKIA 3PREA 3X23A 1PGAA 1MPEA 3TCAA 4IM2A 1TS3A 4WWOA 2W82A 2KANA 3CSTA 3R66C 2RMMA 3SEBA 3HUIA 4BKSD 4E74A 4CHKA 2KJ6A 4Q2JA 3BY4B 1NYQA 2KDEB 3GB1A 2LGYA 3DQVA 4PT5A 5E6OA 1NBFC 4FJYA 2B3AA 1VR9A 2MW5A 2ZNVB 1UUPA 1ZPSA 3H9DA 3RPFC 4OW0A 1D5MC 2QHOA 2AQ3B 1PYWD 1T0RC 2FBWB 3MC0B 4BBNF 1HTQA 4FJZA 3V3XA 5FK9C 4K81A 1L7YA 3VH3B 2MJEA 3IT6B 2PE6B 2GBMA 1WH3A 4A20A 4MH8A 3KLSX 4ZHPA 4IWOA 1PUTA 1FXTB 3DVNV 2WXGA 3NVVA 4W9IA 2WDVB 3ABVB 4X57B 2W54A 1ZP0B 2INPE 2PEAA 2GBNA 3A33B 4GMVA 1M94A 4DXAB 3HHMA 2KX0A 2K6QA 3DBHB 2KMMA 4KZ0A 2X38A 3AE3B 2JZ3B 3SU8X 1OFFA 4BKGA 2OHFA 4P7IA 3RZFA 4M02A 2MBBB 1QILA 3LJ3A 2ONQA 4RGTA 5C2TB 4LTUA 1LO5D 3Q3FA 2WXQA 1E8WA 2L8JA 3KYCD 4MM3A 4YL8A 3IFWB 3H7SA 2JXTA 3BYYB 3BWUD 2K0PA 1DYQA 1OQQA 4JLCA 2XEWA 1XO3A 2WXFA 1J19A 4RM8A 2I38A 1P3QU 5GMVA 2O2VB 1JRPA 4MSMB 4ICUA 4M8MA 3PRPB 2J4XA 1MFWA 4KSKC 2PLPA 1TKYA 1FIQA 1WJUA 4M0WA 2J42A 2L0FA 1XEEA 1I4HA 2PPHA 2V0GA 3ZQ4A 3CWIA 1AYFA 2KKCA 5L95C 2CJNA 2DENB 1KOTA 5EE3A 2ZEQA 2BYVE 1LM8B 1OQRA 2M0AA 1QT9A 4D2KA 2EMTA 3ZJVA 3L13A 2H88B 2NBUA 1HA5A 1UH6A 4IM0A 4AOFA 1SE9A 3N3KB 4PS7A 2IZVB 3WAMA 3NRZA 2VRRB 2IJ0A 5CHFA 4F7ZA 3BVZA 1ET6A 5D2MB 3GZNI 4LNKA 2ZJDA 4OZCA 1EF5A 2OJWA 3QAQA 2INDC 3Q3NC 1QOBA 2M0XA 3VFKA 2JXXA 4AJWA 3X0WA 1WR1A 4JWSC 2K8HA 3PT2B 1WE6A 3UINB 1TS2A 1WYWB 1N6ZA 2WXHA 3CIRB 4HCNB 1VCBA 1EO6A 2G4SA 3EUB2 3BVGA 4EZLA 2NBWB 3QIJA 4RF0A 4DQOC 3B9JA 1V9JA 1FD6A 2KWUB 4WAFA 3JYUA 5H92C 2NTSA 4PYZA 4YT0B 4CO7A 2A4ZA 4MM3B 1JWSD 2VH1A 3AI5A 3NJTA 1ENFA 3MHSD 1E7UA 3VRAB 1J8CA 1C78A 4TSSA 1I4PA 4LDTB 4K3CA 2RDHA 2J7QB 2WXIA 4XE0A 4XZ4A 5JXVA 1UD7A 4ITKA 4A3PA 2MEKA 3KH0A 3PRZA 1HEZE 1DGJA 3RMKC 2WXLA 5AUIA 3S2AA 4S0RA 3VHTC 3L08A 5KHQA 3T3NA 4M0WB 1WMHA 2LXCA 3I3TB 1QLBB 5BMIA 2PMVA 4FXCA 1WRDB 2EKEC 3VTVA 2MSED 3OG5A 3R8BA 3ZNID 1ZOYB 2FCSA 2FNJB 4WQMA 4I6LB 2QC8A 2L0TA 4FA6A 3P4QB 4AQ7A 4L1BA 4EZJA 3DBLI 1E90A 3ZYYX 2N9LA 1UWXA 3UGBB 3RNCC 1AARA 2DYBA 2CHXA 2G9HD 4DWFA 3FKYA 3AEDB 2K8BA 1JRUA 1QQRA 1VDVA 1YQ4B 2N0SB 1TBEA 1WXMA 3FC4A 1R4NI 1EWCA 1GAQB 2FCQA 2KVRA 5IAAC 3RNFC 2QDFA 4ZHOA 3EA6A 5D6JB 3DHHC 4W9FA 1XLPA 3Q3MC 2CU3A 5D7GA 2ON8A 2RGFA 4LNIA 2OJRA 5J18A 3AE7B 3DWMA 4AUQC 3C0RB 3SHQA 4GB9A 2K1FA 2BF8B 3DPDA 3AH7A 1U4AA 3R7RA 3Q2AC 2PKOA 3AU4A 1OTRB 1J7CA 1MHHE 3ZNHB 3ZRFA 2IO3B 2KN4A 1HZ6A 1ZXHA 1GOZA 4KZCA 3RD2A 4GDKA 1CJEA 3W1SC 2LMCA 2I2YA 1XT9B 3RT3B 2QMTA 1Z2MA 4W9DA 3PSEB 1JALA 4NY0A 2J0JA 2Z8LA 2J0MA 2KWCA 3AULA 4DK5A 4KDLB 3DBRI 1SGHA 3NVYA 1YJJA 5JHBA 2L05A 4PS8A 1WMHB 3QC8B 3QWZB 2JSVX 2AQ1B 5BO4B 1RLFA 2LEKA 2BYEA 5GXGB 3RI7C 4AJYB 3DDCB 1NDDA 3GS2A 1KLVA 1ET9A 1IGDA 4TUUA 5BMGA 3IG3A 1JWMD 2N9KA 3V6CB 1ZXIA 4JQWC 2C7HA 3U30A 1EF1A 2MA9B 1FNUA 1WJNA 4K7SA 3VUWA 3I57A 4LNFA 3ZO5B 4YTNB 1Q10A 1A5RA 3GOEA 1WM3A 3ZVVA 3KQ4A 4WH4A 1UWMA 1K8RB 1XCQL 4OVUA 4MSQB 4HCPB 1PGXA 4FBJB 2Q5WD 3ZJTA 1T0QC 2N7JA 2M17A 5IKCM 4C56C 4G0NB 2KDMA 3R2TA 2LD9A 2N7EA 3QHTA 3MTNB 3PVLA 2FUG1 3ZRCA 4MJSA 3HM3A 1VLBA 3RYTA 2AYOB 4HWIB 2QIEB 4USAA 1ZUD2 3EC8A 4ZRKA 2PW9A 5CX3A 1C4AA 2V3NA 2KC2A 2N9PC 1RAXA 1RM6C 1RFKA 3UF8A 4KKJA 3AE8B 3AEFB 3AEAB 1A70A 1KLGD 3JSVA 1F0ZA 2C7MB 3Q69A 4GDKB 4NAMA 3EFCA 4K7UA 1E8XA 3HVZA 4LJPB 2ZW0A 4N6EB 2RDBC 1C77A 3B1LX 2O6VD 1WI0A 2LRUA 2RSUA 4ANWA 4EEWA 2K5PA 5L83A 1L2NA 1IP9A 1K53A 2V1YA 2WU5B 1E7PB 2MWSB 4L23A 2CHZA 2KWDA 2JX5A 2IPKD 1S3SG 4YSZB 1V8CA 4W9KA 1G6JA 2RPQA 3PLVA 1SEBD 4K3BA 1RYJA 2IBIB 3K9PB 2QJLA 2WNMA 3EHVA 2VH2A 3L0WB 4ANXA 2WWZA 5HFYA 2UU7A 3O65B 1D3ZA 1JWAD 4OZAA 4BKSA 2WHIA 1HTOA 4XC2A 2W9NA 3R7QA 2KYWA 5EE9A 4GN1A 3TIXA 4OHJA 3DBHI 3APCA 4F1SA 3P63A 2BWFA 2N9EB 3A9KA 3NVZA 5G5HA 2KX3A 1E5WA 2INCC 4DXGA 1C4CA 1KLUD 2W3SA 3DCGA 3W1SA 4ANVA 2RD0A 1L6VA 3NG0A 2DZJA 1FXAA 2JRHA 5D94A 2HJ1A 2N9XA 2KQSA 2KMCA 4WAAA 1TIFA 3N30A 2LRWA 3HIZA 4MJSB 2B76B 4BOZB 3CMMB 2C60A 2JZPA 4ANUA 2Y5BB 2C7NB 3Q3OC 3SR6A 1FXIA 1AW7A 3EGRA 2WXOA 1C9FA 2R2QA 3NOBA 4F8CB 4ZRJA 3VUYA 1F2RI 4JX1C 3V05A 2LGDA 4IWPA 1TJEA 4L2YA 1TS5A 3JSVB 1WGYA 3N1XC 3DHIC 4HK2A 4JIOU 4ARIA 5BYSA 2DYOA 3L54A 4GU2A 3NVWA 1TT5B 2ZW1A 1MHXA 2BKFA 1I4XA 1P9DU 1JROA 2WDTB 4B9KA 2INNE 3IT4B 1WE7A 4P1CC 4HVBA 5HI1A 2FE8A 1MI0A 2LGXA 1K52A 2CJOA 1WSPA 1P7EA 1PFDA 3RUIB 4J6IA 2AL6A 4GGQA 2N4FA 2NPTA 1T6BX 2DX5B 4NQLB 2LVPA 3AEEB 2GMIC 3KVFB 4IOIE 1F52A 3UI3A 3BIID 1MJDA 3QQ8B 2KACA 4NJCA 4BAXA 5IP4D 2W55A 2V4LA 4KX6B 3GE3C 4PYUA 4ZRPA 4E71A 1V5OA 4KIKA 3MC9A 1WIAA 4DHJD 4HDQA 1C4PA 2BPSA 3ZUNA 1F77A 3TL5A 1N5XA 2BKRB 2J0KA 4MGZE 2KVZA 2X8XX 2G1EA 1T5XD 3W1YA 4KDIC 3U7DA 2K9XA 1E7VA 5G2NA 2HTHA 2LJIA 2UYZB 2OOBB 3B2FA 4KGTA 3A9KB 1JQ4A 1WRIA 1X1MA 4LDTD 4RGMA 2NVUI 3PV1A 1WYGA 1F1HA 1TY0A 2WP9B 3ZDMC 1C3TA 2GBJA 3VVWB 4MH0E 3Q8EA 3PHWB 1ACCA 2HD5B 4UDUC 4DDGD 2DLBA 2D3AA 5D3DA 1I4RA 2C5LC 1L0VB 1H4RA 1SJHD 4P16A 1TTNA 4FULA 1WJ6A 2AL3A 3NHEB 3ZNZB 1FCCC 4O1NA 1IPGA 3ZDTA 3ETRA 1IGCA 2A5UA 2NMQA 3RZWC 4GDLA 4A9AA 2N1WA 2AWTA 4HDOA 3ZKJC 1I4QA 1HXYD 2KN5A 1SE4A 1DOXA 1ISNA 3UQAA 3Q8FA 1KF6B 1S1QB 1P1AA 2CHWA 2BB6A 2KT7A 2CU1A 3OJ4B 4W9GA 1ZKHA 3V61A 2BVCA 3U7ZA 3ZNGC 4QAYA 1IBXA 3PO0A 2L83A 4IKGA 4HEA1 4LNNA 4M8NA 1DOYA 4JWUC 1K50A 2TSSA 3I9V1 3VDZA 2ASQA 1TY2A 2CKHB 1E10A 1NVID 2RDGA 5G55A 1WJ4A 3TEZA 2CR5A 1EUVB 1VZ8A 2ZCCA 2BS3B 5DPTA 2WXMA 2ZVNA 1YN3A 4YSXB 4XYCA 2RR9A 2CS4A 1OEYJ 2NPTB 3NUHB 3UIPB 1WGDA 3AE9B 3RNGC 3HK0A 4NNJB 2HTME 1TZ1A 3LB8C 3H1UA 3QK0A 3VR9B 2PTLA 4KIKB 3ZW3A 1YMHE 2XK5A 4HXDA 3AU5A 1AWDA 2JT4B 5CHWA 2SAKA 2LVQA 2M19A 3H7PA 2DAJA 1L5PA 3OJ3A 3N32A 3P42A 1IUEA 5HHDG 4B6WA 2MLBA 2JZZA 3P2BA 4BBNC 4JL9A 2E3TA 2WLBA 4LLGM 1VRAB 3A4SC 2EKIA 4N59A 4ZOHC 2D3CA 2L7RA 2WXRA 2M4NA 3ZJUA 2BYFA 1UBIA 1MG4A 1JW9D 1WZ0A 2MP2A 4CYEA 2KJRA 1VD2A
chains in the Genus database with same CATH topology
4YTNB 1Q10A 2RMMA 2WQYB 3SEBA 3AEGB 1SE2A 3HUIA 1SE3A 1GB1A 1XLOA 5FR3A 4Q2JA 3KQ4A 2AQ2B 1NYQA 4WH4A 1UWMA 3AN1A 3GB1A 2PIAA 1XCQL 1MVKA 4GDLB 4PT5A 1PGXA 5E6JA 1VR9A 1UUPA 1ZPSA 2Q5WD 3RPFC 3ZJTA 4OW0A 1D5MC 2N7JA 3GP7A 4TMAB 4WIPA 2AQ3B 1PYWD 1KRHA 2FBWB 3MC0B 4C56C 3FILA 2KDMA 4US9A 3R2TA 4RGOS 3TSSA 3V3XA 5FK9C 2J53A 2K22A 1YJIA 2MJEA 4OVZA 2FUG1 3H8HA 3URYA 3IT6B 1IBXB 2IGDA 1YNTE 1VLBA 2L52A 2DBYA 4MH8A 4RFBA 2QSDA 3KLSX 4ZHPA 1PUTA 2QIEB 4USAA 2WXGA 3NVVA 1ZUD2 2WDVB 3ABVB 3MJ5A 2PW9A 2YEPF 2V4IB 2W54A 1ZP0B 2ICIA 2INPE 1C4AA 2V3NA 1PGBA 4J3OD 3TEXA 1RM6C 1RFKA 4KGRA 4KKJA 3VR8B 3BVMA 1C79A 3AE8B 2YEPB 1V1PA 2VZKB 3AEFB 3AEAB 1A70A 1KLGD 2KQ4X 1F0ZA 2KMMA 3W5UB 1BXTA 3Q69A 1XLNA 1JMLA 2OEDA 4GDKB 1D6EC 1I4GA 4NAMA 2X38A 3AE3B 1QOFA 3LYYA 1Y56A 1SIJA 1OFFA 3HVZA 4TQ1A 2OHFA 3W2DA 5TSSA 2ZW0A 1QILA 4N6EB 1C77A 3TUOA 3PZ7A 2ONQA 4RGTA 4A6QA 5C2TB 2PVGC 4LTUA 1LO5D 3E56A 1SXTA 2K5PA 2W3RA 2WXQA 3AECB 1ZDVA 2BW2A 2JXTA 3BYYB 4B0MA 1QKZA 2QEJC 3BWUD 2K0PA 1K53A 1DYQA 1OQQA 4NZLB 2WU5B 2Y5CA 1EWYC 1E7PB 4HKQA 1TZOA 1FNVA 4L23A 1XO3A 2WXFA 2KWDA 2H89B 2HDEA 2JX5A 2I38A 3W5VB 2VZKD 2WXPA 3HVDA 2IPKD 3AE2B 1JRPA 4A55A 1V8CA 4YSZB 3AE4B 2BS4B 4N58A 2PVOD 1SEBD 1YN4A 1D5ZC 1NEKB 5EE0A 1JWUD 4ZYSA 2J4XA 1RYJA 2QJLA 2WNMA 2PLPA 1TKYA 1FIQA 3E9SA 2D5GA 1ZDXA 2IGGA 3AE5B 5HFYA 1JWAD 2BBCA 4OZAA 4HJGE 4M0WA 4A90A 3RFZB 4YXDB 2J42A 2GB1A 2E6XA 1FRRA 4YTMB 2JWUA 1QOAA 1XEEA 5EE9A 1I4HA 4US8A 2BTEA 4OHJA 3FAHA 2V0GA 3P63A 5T8IA 2JYEA 3ZQ4A 5C3JB 3CWIA 5BYRA 1AYFA 3IAM1 1N62A 2LGIA 3NVZA 3AE6B 5G5HA 3MP9A 2CJNA 2IDYA 4DXGA 1C4CA 1J7BA 1EU3A 5G5GA 5EE3A 4A8XC 1KLUD 1OQRA 2M0AA 2W3SA 1QT9A 4RGNA 3W1SA 4D2KA 4H2AA 1L6VA 5BMHA 2J52A 3ZJVA 2H88B 3BK2A 3O13A 1HA5A 1CK1A 1FXAA 1QOGA 1SB3C 4RF1A 1ROEA 1VZ6A 2WDQB 3FILB 3J9CA 2L32A 1XXGA 3NRZA 1KH0A 2IJ0A 3BVZA 1ET6A 4LK0M 1HZ5A 1WWTA 2B76B 1PDXA 4OZCA 2JZPA 2DYMA 2NTTA 5D3IB 1QOBA 3B2GA 2BT6A 4AS1A 4CQNA 3SR6A 1FXIA 1FMAD 1AW7A 1EM7A 3EGRA 1SJED 2WXOA 1SF0A 1UGJA 4KGSA 1FCLA 3DWGC 3BYTB 1P7FA 1C9FA 4JWSC 4ZRQA 2AX5A 3AV8A 1VZ7A 1F2RI 1B1ZA 4JX1C 4EE2A 1EU4A 1CQVA 3V05A 1TJEA 1TS2A 1V1PB 1HQRD 1WGKA 2WXNA 4L2YA 2WXHA 1TS5A 2KAJA 3CIRB 2L1AA 3AB5A 2WU2B 2WXJA 3EUB2 3BVGA 4RF0A 4DQOC 1F2RC 4ARIA 5BYSA 2DYOA 2ACZB 3NVWA 4C80A 2ZW1A 1MHXA 1E9MA 3B9JA 3SFEB 3ZGZA 3VRBB 1I4XA 1FD6A 1L4DB 1FRDA 1JROA 1D4BA 4WAFA 5H92C 2INNE 3IT4B 2NTSA 5H8YE 5HI1A 1TKEA 1MI0A 2FE8A 1K52A 4YT0B 2CJOA 4MM3B 1JWSD 1WSPA 1P7EA 1PFDA 2WDRB 1ENFA 1XF5L 3VRAB 1N63A 1C78A 3R2IA 1JCKB 4C7ZA 1I7HA 1I4PA 4TSSA 1T6BX 2RDHA 1ESFA 2Y5PA 4YTPB 2WXIA 1KFYB 1JWBD 2BYTA 3AEEB 2M56B 4XE0A 5JXVA 4IOIE 2BS2B 3UI3A 3BIID 4XWTA 2KACA 4NJCA 4ITKA 4YSYB 2MEKA 3L4PA 2W55A 1M4VA 1ZE3D 4KX6B 4HKZE 1GPXA 4REZA 4ZRPA 1HEZE 1DGJA 1GB4A 2LHDA 2WXLA 3IXSA 3P4RB 5AUIA 3NS1A 1WXQA 1VJKA 2V3PA 1C4PA 1L4ZB 1V97A 1F77A 3T3NA 1N5XA 1FM0D 3Q8AA 1QLBB 5BMIA 1V1OA 1T5XD 2G1EA 2MH7A 2PMVA 2K3UA 4FXCA 3IAS1 2K9XA 4WURA 2JQRB 2LJIA 1STEA 3B2FA 4KGTA 1JQ4A 4B0EA 4IDIA 1WRIA 4RGMA 1XCTL 3BK1A 1E0ZA 1E6EB 3R8BA 1ZOYB 1WYGA 1YN5A 2GRIA 2MJ3A 4WQMA 4DXFA 1J7AA 1TY0A 4OZBA 2WP9B 4RNAA 3P4QB 3HRDD 4MACA 3KWLA 4AQ7A 1QF6A 3Q8EA 4L1BA 1ACCA 3T3OA 3SFDB 1L0YB 4UDUC 4GLSC 1RWSA 2DWQA 4P6VF 3P4SB 2DLBA 3ZYYX 3C8YA 3P1MA 5D3DA 1I4RA 2N9LA 1L0VB 1SJHD 1UWXA 4P16A 3TEWA 1SBBB 3OWEB 1L0XB 1FCCC 4O1NA 1AN8A 1R7SA 5I4DA 3MHZA 2G9HD 3ETRA 2GI9A 1IGCA 2NMQA 3AEDB 4JPSA 4A9AA 1QQRA 5BYQA 3U52E 1I4QA 1VDVA 1HXYD 4JE3B 1SE4A 2LUMA 1DOXA 2EELA 1YQ4B 1FEHA 2N0SB 3FC4A 4R3DA 3Q8FA 1EWCA 1DOIA 1GAQB 4HRSA 2LFIA 3AEBB 3U4EG 1KF6B 1BMLC 2JYTA 3NZ3A 4XWWA 2BB6A 4ZHOA 3EA6A 3N9YC 3BZDB 1XLPA 4MT5A 2CU3A 3Q8CA 3U7ZA 2R61A 1NENB 3AMZA 1IBXA 5D7GA 3PO0A 2ON8A 2JU6X 2L83A 1TKGA 4IKGA 3AM9A 1BUIC 4HEA1 3KWVA 3AE7B 3DWMA 1DOYA 1CZPA 1TYGB 1K50A 4JWUC 1N61A 2TSSA 3I9V1 1T3QA 1TY2A 1C76A 1E10A 1NVID 1N60A 2RDGA 2MJDA 3TEZA 3AH7A 1VZ8A 3W9CB 1FFUA 2BS3B 2WXMA 1YN3A 2PKOA 1J7CA 2BB5A 1MHHE 4C7YA 4YSXB 2KN4A 1HZ6A 1ZXHA 1GOZA 5FKAC 1FFVA 1SSNA 1K51A 1UNSA 2WS3B 1N5WA 4NAWB 2RPVA 1CJEA 3NUHB 3LXFA 1NYRA 2LMCA 2Y3AA 2I2YA 2QMTA 2XN9C 2SEBD 1JALA 3AE9B 1FO4A 2HTME 2Z8LA 4WWMA 4TQ0A 3LB8C 3MFGA 1D5XC 5MPOA 1XLQA 3VR9B 2PTLA 4RH6A 3TEYA 1YMHE 3NVYA 1AWDA 1B9RA 1YJJA 1KTKA 2SAKA 5HG2A 5AUKA 2M19A 4YWGG 2QILA 1L5PA 3P42A 3PZ8A 3AE1B 1IUEA 3WCQA 5HHDG 2JSVX 2AQ1B 4XDDA 3Q8BA 2LEKA 1FNWA 3P4PB 1NI3A 5LNK1 1TS4A 5GXGB 4ARCA 3GS2A 2LHEA 4KKIA 1ET9A 2E3TA 1IGDA 1PGAA 5EE1A 1MPEA 2WLBA 2IGHA 4LLGM 5BMGA 4HROA 1JWMD 1VRAB 2N9KA 2EKIA 1ZXIA 4N59A 1TS3A 4ZOHC 3U2SC 3VQIA 2WXKA 2XNAC 2WXRA 4XDCA 3ZJUA 1FNUA 1L6UA 1JW9D 3I57A 2W82A 4RCOA 1YQ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4B A;  1Q10 A;  2RMM A;  5HI1 A;  1GB1 A;  1MI0 A;  1K52 A;  1P7E A;  4WH4 A;  1XF5 L;  3GB1 A;  1IBX A;  1XCQ L;  2ON8 A;  1MVK A;  2JU6 X;  2PLP A;  4IKG A;  2IGG A;  1PGX A;  5HFY A;  4OZA A;  4HJG E;  1K50 A;  2GB1 A;  2N7J A;  5JXV A;  2JWU A;  4IOI E;  3UI3 A;  2KAC A;  3FIL A;  2KDM A;  3V3X A;  2LGI A;  2J53 A;  3MP9 A;  4HKZ E;  1HEZ E;  1GB4 A;  2LHD A;  1MHH E;  1IBX B;  2KN4 A;  1HZ6 A;  1ZXH A;  2IGD A;  1YNT E;  1K51 A;  2QSD A;  2RPV A;  4D2K A;  5BMH A;  2J52 A;  5BMI A;  2I2Y A;  2QMT A;  2PW9 A;  3FIL B;  4KGT A;  1PGB A;  1KH0 A;  1XCT L;  4KGR A;  1HZ5 A;  2PTL A;  4OZB A;  4OZC A;  1YMH E;  2JZP A;  2KQ4 X;  4MAC A;  2OED A;  1JML A;  5HG2 A;  4GLS C;  1EM7 A;  4KGS A;  1FCL A;  5HHD G;  2JSV X;  1P7F A;  2N9L A;  1C9F A;  2ZW0 A;  1UWX A;  2ONQ A;  1FCC C;  1F2R I;  2GI9 A;  2LHE A;  1IGC A;  2JXT A;  2NMQ A;  1IGD A;  1PGA A;  1QKZ A;  1MPE A;  2K0P A;  1K53 A;  2IGH A;  5BMG A;  2N9K A;  2LUM A;  2EEL A;  1F2R C;  2KWD A;  2I38 A;  2ZW1 A;  1MHX A;  1FD6 A; 
#chains in the Genus database with same CATH topology
 2K25 A;  2KDF B;  1UGM A;  4W9J A;  1GB1 A;  5FR3 A;  2DHZ A;  3AN1 A;  4DHZ B;  4GDL B;  1MVK A;  2L76 A;  5E6J A;  2JRI B;  2DZM A;  3N20 C;  3GP7 A;  4TMA B;  3VH4 B;  3A1Q A;  1J0G A;  3LDZ E;  3FIL A;  4RGO S;  2J53 A;  3ECI A;  2K22 A;  3PHX B;  4HPM B;  1P98 A;  3Q3J A;  3H8H A;  3URY A;  5IO9 A;  2DZI A;  1IBX B;  2IGD A;  2DBY A;  4RFB A;  2QSD A;  2PJH A;  4P1B C;  4A3O A;  4W9E A;  2LUE A;  2Z59 B;  3MJ5 A;  4XGA B;  4IWQ A;  2DNF A;  2V4I B;  4KV2 A;  2ICI A;  4G11 A;  4S17 A;  1PGB A;  2V3S A;  4ZRI A;  3BVM A;  1C79 A;  2FIF A;  2GOW A;  2VZK B;  4WJQ A;  2V9H A;  2KQ4 X;  2LVO A;  4B95 A;  5CTR C;  1BXT A;  1JML A;  4GOC A;  3I63 C;  3HM6 X;  1QOF A;  1UF0 A;  1Y56 A;  5DPW A;  1SIJ A;  4TQ1 A;  3U8Z A;  4TV3 A;  3ML9 A;  3DBL B;  2PVG C;  3E56 A;  2K39 A;  1SXT A;  1BT0 A;  3AEC B;  2XK5 B;  3JVZ X;  5IN7 A;  4B0M A;  1UEL A;  1V6E A;  4NZL B;  2KXJ A;  2Y5C A;  1EWY C;  3KUD B;  4FJV B;  3H7P B;  4HKQ A;  2NS5 A;  2HDE A;  3W5V B;  3A9J A;  3AE2 B;  2MRP A;  3AE4 B;  2BS4 B;  4KSL C;  3N1Y C;  4N58 A;  4FAD A;  4IM3 A;  2HJ8 A;  1YX5 B;  1NEK B;  2DAF A;  1R4N B;  2KMA A;  4ZYS A;  1WR6 E;  2KHW B;  2G45 B;  3KUZ A;  2IGG A;  1YD8 U;  2BBC A;  4OVV A;  4MEM A;  4HJG E;  2KDB A;  4YXD B;  1FRR A;  4YTM B;  5LXH A;  5HKH A;  3N1Z C;  1V2Y A;  4US8 A;  3IBE A;  3CSF A;  3FAH A;  4IC7 B;  2MP2 B;  5T8I A;  4EOY A;  5BYR A;  2REX A;  2LGI A;  2IO1 B;  3RNB C;  1Y8R C;  2JPH A;  1T0S C;  2IDY A;  1EU3 A;  4FLH A;  5G5G A;  3M95 A;  5CHV C;  2PE9 A;  4RGN A;  4C00 A;  1QZE A;  4H2A A;  5BMH A;  3PRM B;  4AWJ A;  1GUA B;  3O13 A;  3BK2 A;  4WWN A;  1ZW7 A;  1CK1 A;  1QOG A;  1SB3 C;  3A1Q B;  1ROE A;  1P0R A;  4C4V A;  2C9W B;  3FIL B;  2WX1 A;  5E6N A;  1XXG A;  1KH0 A;  3H6N A;  1WWT A;  4GSW A;  3ZXV A;  2DYM A;  2BT6 A;  4AP4 C;  1FMA D;  3DBR B;  1SJE D;  1SF0 A;  1UGJ A;  4KGS A;  3DWG C;  3BYT B;  3MC8 A;  5LXI B;  3AV8 A;  1VZ7 A;  1B1Z A;  4DBG A;  4EE2 A;  1EU4 A;  1CQV A;  2AEH A;  4IUM B;  1WGK A;  4KVG B;  4DDI D;  3AB5 A;  2HE7 A;  2O6V A;  3K9O B;  1WXV A;  1SIF A;  2K6D B;  4XX5 A;  2ACZ B;  4C80 A;  1YJ1 A;  1E9M A;  2GBR A;  3ZGZ A;  3VRB B;  1L4D B;  1FRD A;  3I5J C;  4MEL A;  2MBH A;  2KTR A;  5H8Y E;  1TKE A;  1GG3 A;  3DHG C;  2WDR B;  1XF5 L;  2D3G A;  2KLG A;  3R2I A;  5C1Z A;  1KFY B;  1JWB D;  2BYT A;  3T8M A;  3A9J B;  4XWT A;  2FID A;  3WA0 A;  1M4V A;  2GLS A;  1V80 A;  2G4D B;  3WAO A;  3M62 B;  2LZ6 A;  1V86 A;  2I1J A;  2LHD A;  1R4M B;  1WX9 A;  3NS1 A;  3DBS A;  4LJO B;  1V49 A;  1V97 A;  3OAW A;  4WQO B;  1MG8 A;  3Q8A A;  2KLC A;  1V1O A;  2K3U A;  1RRB A;  1OEY A;  4WUR A;  4B0E A;  1XCT L;  1E0Z A;  1E6E B;  5C23 A;  1YN5 A;  2GRI A;  4DXF A;  1KM7 A;  4RMA A;  3HRD D;  3VAW A;  3T9L A;  3WAN A;  4GLS C;  3KYD D;  2DWQ A;  4P6V F;  4WWP A;  3P1M A;  4K1R B;  4C4V B;  3TEW A;  4IW0 A;  1L0X B;  5I4D A;  2DZK A;  1YX6 B;  4EFO A;  5BYQ A;  2N1V A;  2MBE A;  2LUM A;  2WGS A;  4R3D A;  3U4E G;  4HRS A;  1BML C;  2M8S A;  4II3 B;  2JYT A;  3NZ3 A;  3N9Y C;  2D10 A;  2KWV B;  4MT5 A;  5AEK B;  2R61 A;  1NEN B;  3DVG Y;  2O6V B;  1TKG A;  3NS8 A;  2KFJ A;  2FUH B;  3KWV A;  2MX2 A;  3RNE C;  3L10 B;  1CZP A;  1TYG B;  1N61 A;  2JY6 A;  2JF5 A;  3RCZ A;  4G50 A;  3V6E B;  4HPL B;  3QX1 A;  1OQY A;  1C76 A;  1ZGU B;  1N60 A;  2MJD A;  5IOI A;  5AZF A;  3V60 A;  2D11 A;  2BWE S;  2KTR B;  3V62 A;  4I6N B;  3W9C B;  3APD A;  4BKT A;  4C7Y A;  1YOV B;  5FKA C;  1FFV A;  1SSN A;  1UNS A;  3KUC B;  2D07 B;  4I6P A;  2RPV A;  3TJP A;  1UBQ A;  4LNO A;  3IHP C;  2XN9 C;  2I1K A;  1I35 A;  2WX0 A;  3VTU A;  3RNA C;  3MFG A;  1D5X C;  1GC6 A;  2KQ7 A;  5MPO A;  1XLQ A;  3JW0 X;  3CF6 E;  3ENE A;  3M63 B;  1E8Z A;  1TGZ B;  2LI5 A;  2MHJ A;  4ICV A;  5TR5 A;  4MGY E;  4BVU C;  5AUK A;  4LCD E;  4YWG G;  3WAL A;  1WZ3 A;  2D2Q A;  4URK A;  3PZ8 A;  4EUT A;  3AE1 B;  4XDD A;  3RN9 C;  3QCA A;  4E3C A;  2JWZ A;  4ARC A;  3ML8 A;  4G3X B;  3ZLZ A;  5EE1 A;  2IGH A;  3ZIM A;  1YQB A;  4HRO A;  3VQI A;  3U2S C;  2WXK A;  2XNA C;  4XDC A;  4W9L A;  1L6U A;  2KK8 A;  4RCO A;  2KFK A;  3ALB A;  1YQ3 B;  2WQY B;  3KW5 B;  3AEG B;  1SE2 A;  1SE3 A;  1XLO A;  1RFA A;  2N7D A;  2AQ2 B;  3IVF A;  3NZU A;  2PIA A;  3APF A;  1Z5S B;  2YVC A;  3SDL C;  1F9J A;  3B08 A;  4WIP A;  1KRH A;  3BIN A;  2QCZ A;  4US9 A;  3TSS A;  4M00 A;  1I42 A;  1YJI A;  4OVZ A;  2MBQ A;  1KJT A;  2UWQ A;  1YNT E;  2L52 A;  3ZTD A;  3VUX A;  5FR6 A;  1HE8 A;  1GC7 A;  4II2 B;  3D32 A;  4IG7 B;  4ACF A;  1WY8 A;  2YEP F;  4J3O D;  3TEX A;  2L00 B;  4KGR A;  3VR8 B;  3AXC A;  2YEP B;  2LGS A;  1V1P A;  1LFD A;  5E6P A;  3QA8 A;  2JUO A;  3W5U B;  4BOS C;  1XLN A;  2OED A;  3DVN U;  1D6E C;  1I4G A;  3LYY A;  5J17 A;  2ZVO A;  5DPS A;  4DHJ B;  3W2D A;  5TSS A;  3R3M A;  2KC1 A;  4HJK A;  3TUO A;  3PZ7 A;  2WYQ A;  4A6Q A;  1WX7 A;  5JZE B;  2W3R A;  1XQQ A;  1ZDV A;  1Q1O A;  2BW2 A;  2YLM A;  4ASW C;  2Z0E B;  1QKZ A;  2QEJ C;  4PK1 A;  4GXB A;  1TZO A;  3GZN B;  1FNV A;  2ZNV C;  2H89 B;  5LLI A;  3PS6 A;  3OLM D;  1WGG A;  2VZK D;  2WXP A;  2IO0 B;  3HVD A;  1NI2 A;  4PS3 A;  4A55 A;  4ZDV A;  4FHK A;  1PQS A;  2PVO D;  1YN4 A;  1D5Z C;  5EE0 A;  1JWU D;  1WM2 A;  3E9S A;  2D5G A;  1ZDX A;  3AE5 B;  3WAP A;  1XD3 B;  4A90 A;  3RFZ B;  3VTW A;  2GB1 A;  2E6X A;  2JWU A;  1QOA A;  2BTE A;  2KFK B;  2JYE A;  1WXA A;  2LWP A;  3ZXR A;  4EZK A;  5C3J B;  3IAM 1;  3TBL D;  1N62 A;  3AE6 B;  3MP9 A;  1LXD A;  4HLE A;  3NZS A;  2MBO A;  1WGH A;  1J7B A;  4A8X C;  4NJ6 A;  2NR2 A;  3EFU A;  2J52 A;  4RF1 A;  1YIW A;  1VZ6 A;  2WDQ B;  3J9C A;  1WX8 A;  3EEC A;  2L32 A;  5AZG A;  4LK0 M;  2KNB A;  1WFY A;  1HZ5 A;  1PDX A;  4NQK E;  2KZR A;  2NTT A;  1V81 A;  2KOX A;  2R2O A;  5D3I B;  3ONS A;  3B2G A;  4AS1 A;  4BFR A;  4CQN A;  1C1Y B;  4MGI E;  1EM7 A;  5EDS A;  1FCL A;  1P7F A;  4FN2 A;  4GIV A;  4ZRQ A;  2AX5 A;  2GBK A;  1V1P B;  2WXN A;  1HQR D;  1Q0W B;  2ZCB A;  2KAJ A;  2LXA A;  2L1A A;  1OGW A;  4BZA A;  3L17 A;  2WU2 B;  2WXJ A;  3NY5 A;  3PGE A;  1F2R C;  3GE8 C;  3Q6B A;  5DCN A;  2IY1 B;  5IA7 A;  3SFE B;  1D4B A;  3DOW A;  2IO2 B;  3MJW A;  4DHZ E;  4WJP A;  1T0Y A;  1N63 A;  1JCK B;  4C7Z A;  1I7H A;  4NAW A;  1ESF A;  2Y5P A;  2LJ5 A;  4YTP B;  2M56 B;  3TMP B;  1GNU A;  2BS2 B;  2EMS A;  4YSY B;  3L4P A;  4EKU A;  1LQB A;  1ZE3 D;  2FCN A;  2IY0 B;  4HKZ E;  1GPX A;  3PZD A;  4REZ A;  4NJ7 A;  1GB4 A;  3IXS A;  3P4R B;  3Q14 C;  1WXQ A;  1VJK A;  2V3P A;  1L4Z B;  1FM0 D;  2M1M A;  2MH7 A;  3IAS 1;  2JQR B;  1STE A;  4IDI A;  3BK1 A;  3WIM A;  2G3Q B;  2MJ3 A;  1J7A A;  4OZB A;  2MQJ A;  4RNA A;  3RUL A;  2ZPN A;  2BGF A;  4MAC A;  3KWL A;  1QF6 A;  2NCN A;  3B0A A;  3SD5 A;  3T3O A;  3QJZ A;  3SFD B;  1L0Y B;  1RWS A;  3P4S B;  3C8Y A;  1LGR A;  1SBB B;  3OWE B;  4MGK E;  1AN8 A;  1R7S A;  3MHZ A;  3VXW A;  4JGH B;  2GI9 A;  2KD0 A;  4JPS A;  4W9H A;  3U52 E;  3ZTC A;  4JE3 B;  2NBV B;  2EEL A;  5DPR A;  1FEH A;  4N9F 4;  1DOI A;  3PTF C;  1R4M I;  2LFI A;  3AEB B;  2K8C A;  1H8C A;  4XWW A;  2KO3 A;  3BZD B;  4MDK E;  2Z0D B;  5JHA A;  2L3Z A;  5J2R A;  3Q8C A;  3AMZ A;  2FCM A;  3PLU A;  2JU6 X;  4NPN A;  3AM9 A;  1BUI C;  4K7W A;  5KHO A;  3UQB A;  1V5T A;  1T3Q A;  4W9C A;  2ZPY A;  2JVC A;  1FFU A;  5JH5 C;  1WGR A;  2BB5 A;  4FHJ A;  1K51 A;  4WJN A;  2WS3 B;  1N5W A;  1Q5W B;  4NAW B;  1CMX B;  2KTF A;  3LXF A;  1NYR A;  2FAZ A;  2Y3A A;  3M3J A;  2KJH B;  2SEB D;  3A4R A;  1FPY A;  3L16 A;  2ZZP B;  1FO4 A;  4ZYN A;  3QAR A;  4WWM A;  4TQ0 A;  2XBB C;  4HPP A;  1E8Y A;  1IYF A;  4RH6 A;  3TEY A;  1WXS A;  2BQQ A;  1B9R A;  1KTK A;  5HG2 A;  4TKN A;  1WF9 A;  4M01 A;  2LAS A;  2MCN B;  5AZH A;  2QIL A;  3UIO B;  2D3B A;  3WCQ A;  2O2V A;  3Q8B A;  4RM9 A;  3C19 A;  1FNW A;  3P4P B;  1NI3 A;  3DVG X;  2IYD B;  4WJO A;  5LNK 1;  1TS4 A;  1UZX B;  1GJZ A;  3PPA A;  2LHE A;  2KDI A;  4KKI A;  3PRE A;  3X23 A;  1PGA A;  1MPE A;  3TCA A;  4IM2 A;  1TS3 A;  4WWO A;  2W82 A;  2KAN A;  3CST A;  3R66 C;  2RMM A;  3SEB A;  3HUI A;  4BKS D;  4E74 A;  4CHK A;  2KJ6 A;  4Q2J A;  3BY4 B;  1NYQ A;  2KDE B;  3GB1 A;  2LGY A;  3DQV A;  4PT5 A;  5E6O A;  1NBF C;  4FJY A;  2B3A A;  1VR9 A;  2MW5 A;  2ZNV B;  1UUP A;  1ZPS A;  3H9D A;  3RPF C;  4OW0 A;  1D5M C;  2QHO A;  2AQ3 B;  1PYW D;  1T0R C;  2FBW B;  3MC0 B;  4BBN F;  1HTQ A;  4FJZ A;  3V3X A;  5FK9 C;  4K81 A;  1L7Y A;  3VH3 B;  2MJE A;  3IT6 B;  2PE6 B;  2GBM A;  1WH3 A;  4A20 A;  4MH8 A;  3KLS X;  4ZHP A;  4IWO A;  1PUT A;  1FXT B;  3DVN V;  2WXG A;  3NVV A;  4W9I A;  2WDV B;  3ABV B;  4X57 B;  2W54 A;  1ZP0 B;  2INP E;  2PEA A;  2GBN A;  3A33 B;  4GMV A;  1M94 A;  4DXA B;  3HHM A;  2KX0 A;  2K6Q A;  3DBH B;  2KMM A;  4KZ0 A;  2X38 A;  3AE3 B;  2JZ3 B;  3SU8 X;  1OFF A;  4BKG A;  2OHF A;  4P7I A;  3RZF A;  4M02 A;  2MBB B;  1QIL A;  3LJ3 A;  2ONQ A;  4RGT A;  5C2T B;  4LTU A;  1LO5 D;  3Q3F A;  2WXQ A;  1E8W A;  2L8J A;  3KYC D;  4MM3 A;  4YL8 A;  3IFW B;  3H7S A;  2JXT A;  3BYY B;  3BWU D;  2K0P A;  1DYQ A;  1OQQ A;  4JLC A;  2XEW A;  1XO3 A;  2WXF A;  1J19 A;  4RM8 A;  2I38 A;  1P3Q U;  5GMV A;  2O2V B;  1JRP A;  4MSM B;  4ICU A;  4M8M A;  3PRP B;  2J4X A;  1MFW A;  4KSK C;  2PLP A;  1TKY A;  1FIQ A;  1WJU A;  4M0W A;  2J42 A;  2L0F A;  1XEE A;  1I4H A;  2PPH A;  2V0G A;  3ZQ4 A;  3CWI A;  1AYF A;  2KKC A;  5L95 C;  2CJN A;  2DEN B;  1KOT A;  5EE3 A;  2ZEQ A;  2BYV E;  1LM8 B;  1OQR A;  2M0A A;  1QT9 A;  4D2K A;  2EMT A;  3ZJV A;  3L13 A;  2H88 B;  2NBU A;  1HA5 A;  1UH6 A;  4IM0 A;  4AOF A;  1SE9 A;  3N3K B;  4PS7 A;  2IZV B;  3WAM A;  3NRZ A;  2VRR B;  2IJ0 A;  5CHF A;  4F7Z A;  3BVZ A;  1ET6 A;  5D2M B;  3GZN I;  4LNK A;  2ZJD A;  4OZC A;  1EF5 A;  2OJW A;  3QAQ A;  2IND C;  3Q3N C;  1QOB A;  2M0X A;  3VFK A;  2JXX A;  4AJW A;  3X0W A;  1WR1 A;  4JWS C;  2K8H A;  3PT2 B;  1WE6 A;  3UIN B;  1TS2 A;  1WYW B;  1N6Z A;  2WXH A;  3CIR B;  4HCN B;  1VCB A;  1EO6 A;  2G4S A;  3EUB 2;  3BVG A;  4EZL A;  2NBW B;  3QIJ A;  4RF0 A;  4DQO C;  3B9J A;  1V9J A;  1FD6 A;  2KWU B;  4WAF A;  3JYU A;  5H92 C;  2NTS A;  4PYZ A;  4YT0 B;  4CO7 A;  2A4Z A;  4MM3 B;  1JWS D;  2VH1 A;  3AI5 A;  3NJT A;  1ENF A;  3MHS D;  1E7U A;  3VRA B;  1J8C A;  1C78 A;  4TSS A;  1I4P A;  4LDT B;  4K3C A;  2RDH A;  2J7Q B;  2WXI A;  4XE0 A;  4XZ4 A;  5JXV A;  1UD7 A;  4ITK A;  4A3P A;  2MEK A;  3KH0 A;  3PRZ A;  1HEZ E;  1DGJ A;  3RMK C;  2WXL A;  5AUI A;  3S2A A;  4S0R A;  3VHT C;  3L08 A;  5KHQ A;  3T3N A;  4M0W B;  1WMH A;  2LXC A;  3I3T B;  1QLB B;  5BMI A;  2PMV A;  4FXC A;  1WRD B;  2EKE C;  3VTV A;  2MSE D;  3OG5 A;  3R8B A;  3ZNI D;  1ZOY B;  2FCS A;  2FNJ B;  4WQM A;  4I6L B;  2QC8 A;  2L0T A;  4FA6 A;  3P4Q B;  4AQ7 A;  4L1B A;  4EZJ A;  3DBL I;  1E90 A;  3ZYY X;  2N9L A;  1UWX A;  3UGB B;  3RNC C;  1AAR A;  2DYB A;  2CHX A;  2G9H D;  4DWF A;  3FKY A;  3AED B;  2K8B A;  1JRU A;  1QQR A;  1VDV A;  1YQ4 B;  2N0S B;  1TBE A;  1WXM A;  3FC4 A;  1R4N I;  1EWC A;  1GAQ B;  2FCQ A;  2KVR A;  5IAA C;  3RNF C;  2QDF A;  4ZHO A;  3EA6 A;  5D6J B;  3DHH C;  4W9F A;  1XLP A;  3Q3M C;  2CU3 A;  5D7G A;  2ON8 A;  2RGF A;  4LNI A;  2OJR A;  5J18 A;  3AE7 B;  3DWM A;  4AUQ C;  3C0R B;  3SHQ A;  4GB9 A;  2K1F A;  2BF8 B;  3DPD A;  3AH7 A;  1U4A A;  3R7R A;  3Q2A C;  2PKO A;  3AU4 A;  1OTR B;  1J7C A;  1MHH E;  3ZNH B;  3ZRF A;  2IO3 B;  2KN4 A;  1HZ6 A;  1ZXH A;  1GOZ A;  4KZC A;  3RD2 A;  4GDK A;  1CJE A;  3W1S C;  2LMC A;  2I2Y A;  1XT9 B;  3RT3 B;  2QMT A;  1Z2M A;  4W9D A;  3PSE B;  1JAL A;  4NY0 A;  2J0J A;  2Z8L A;  2J0M A;  2KWC A;  3AUL A;  4DK5 A;  4KDL B;  3DBR I;  1SGH A;  3NVY A;  1YJJ A;  5JHB A;  2L05 A;  4PS8 A;  1WMH B;  3QC8 B;  3QWZ B;  2JSV X;  2AQ1 B;  5BO4 B;  1RLF A;  2LEK A;  2BYE A;  5GXG B;  3RI7 C;  4AJY B;  3DDC B;  1NDD A;  3GS2 A;  1KLV A;  1ET9 A;  1IGD A;  4TUU A;  5BMG A;  3IG3 A;  1JWM D;  2N9K A;  3V6C B;  1ZXI A;  4JQW C;  2C7H A;  3U30 A;  1EF1 A;  2MA9 B;  1FNU A;  1WJN A;  4K7S A;  3VUW A;  3I57 A;  4LNF A;  3ZO5 B;  4YTN B;  1Q10 A;  1A5R A;  3GOE A;  1WM3 A;  3ZVV A;  3KQ4 A;  4WH4 A;  1UWM A;  1K8R B;  1XCQ L;  4OVU A;  4MSQ B;  4HCP B;  1PGX A;  4FBJ B;  2Q5W D;  3ZJT A;  1T0Q C;  2N7J A;  2M17 A;  5IKC M;  4C56 C;  4G0N B;  2KDM A;  3R2T A;  2LD9 A;  2N7E A;  3QHT A;  3MTN B;  3PVL A;  2FUG 1;  3ZRC A;  4MJS A;  3HM3 A;  1VLB A;  3RYT A;  2AYO B;  4HWI B;  2QIE B;  4USA A;  1ZUD 2;  3EC8 A;  4ZRK A;  2PW9 A;  5CX3 A;  1C4A A;  2V3N A;  2KC2 A;  2N9P C;  1RAX A;  1RM6 C;  1RFK A;  3UF8 A;  4KKJ A;  3AE8 B;  3AEF B;  3AEA B;  1A70 A;  1KLG D;  3JSV A;  1F0Z A;  2C7M B;  3Q69 A;  4GDK B;  4NAM A;  3EFC A;  4K7U A;  1E8X A;  3HVZ A;  4LJP B;  2ZW0 A;  4N6E B;  2RDB C;  1C77 A;  3B1L X;  2O6V D;  1WI0 A;  2LRU A;  2RSU A;  4ANW A;  4EEW A;  2K5P A;  5L83 A;  1L2N A;  1IP9 A;  1K53 A;  2V1Y A;  2WU5 B;  1E7P B;  2MWS B;  4L23 A;  2CHZ A;  2KWD A;  2JX5 A;  2IPK D;  1S3S G;  4YSZ B;  1V8C A;  4W9K A;  1G6J A;  2RPQ A;  3PLV A;  1SEB D;  4K3B A;  1RYJ A;  2IBI B;  3K9P B;  2QJL A;  2WNM A;  3EHV A;  2VH2 A;  3L0W B;  4ANX A;  2WWZ A;  5HFY A;  2UU7 A;  3O65 B;  1D3Z A;  1JWA D;  4OZA A;  4BKS A;  2WHI A;  1HTO A;  4XC2 A;  2W9N A;  3R7Q A;  2KYW A;  5EE9 A;  4GN1 A;  3TIX A;  4OHJ A;  3DBH I;  3APC A;  4F1S A;  3P63 A;  2BWF A;  2N9E B;  3A9K A;  3NVZ A;  5G5H A;  2KX3 A;  1E5W A;  2INC C;  4DXG A;  1C4C A;  1KLU D;  2W3S A;  3DCG A;  3W1S A;  4ANV A;  2RD0 A;  1L6V A;  3NG0 A;  2DZJ A;  1FXA A;  2JRH A;  5D94 A;  2HJ1 A;  2N9X A;  2KQS A;  2KMC A;  4WAA A;  1TIF A;  3N30 A;  2LRW A;  3HIZ A;  4MJS B;  2B76 B;  4BOZ B;  3CMM B;  2C60 A;  2JZP A;  4ANU A;  2Y5B B;  2C7N B;  3Q3O C;  3SR6 A;  1FXI A;  1AW7 A;  3EGR A;  2WXO A;  1C9F A;  2R2Q A;  3NOB A;  4F8C B;  4ZRJ A;  3VUY A;  1F2R I;  4JX1 C;  3V05 A;  2LGD A;  4IWP A;  1TJE A;  4L2Y A;  1TS5 A;  3JSV B;  1WGY A;  3N1X C;  3DHI C;  4HK2 A;  4JIO U;  4ARI A;  5BYS A;  2DYO A;  3L54 A;  4GU2 A;  3NVW A;  1TT5 B;  2ZW1 A;  1MHX A;  2BKF A;  1I4X A;  1P9D U;  1JRO A;  2WDT B;  4B9K A;  2INN E;  3IT4 B;  1WE7 A;  4P1C C;  4HVB A;  5HI1 A;  2FE8 A;  1MI0 A;  2LGX A;  1K52 A;  2CJO A;  1WSP A;  1P7E A;  1PFD A;  3RUI B;  4J6I A;  2AL6 A;  4GGQ A;  2N4F A;  2NPT A;  1T6B X;  2DX5 B;  4NQL B;  2LVP A;  3AEE B;  2GMI C;  3KVF B;  4IOI E;  1F52 A;  3UI3 A;  3BII D;  1MJD A;  3QQ8 B;  2KAC A;  4NJC A;  4BAX A;  5IP4 D;  2W55 A;  2V4L A;  4KX6 B;  3GE3 C;  4PYU A;  4ZRP A;  4E71 A;  1V5O A;  4KIK A;  3MC9 A;  1WIA A;  4DHJ D;  4HDQ A;  1C4P A;  2BPS A;  3ZUN A;  1F77 A;  3TL5 A;  1N5X A;  2BKR B;  2J0K A;  4MGZ E;  2KVZ A;  2X8X X;  2G1E A;  1T5X D;  3W1Y A;  4KDI C;  3U7D A;  2K9X A;  1E7V A;  5G2N A;  2HTH A;  2LJI A;  2UYZ B;  2OOB B;  3B2F A;  4KGT A;  3A9K B;  1JQ4 A;  1WRI A;  1X1M A;  4LDT D;  4RGM A;  2NVU I;  3PV1 A;  1WYG A;  1F1H A;  1TY0 A;  2WP9 B;  3ZDM C;  1C3T A;  2GBJ A;  3VVW B;  4MH0 E;  3Q8E A;  3PHW B;  1ACC A;  2HD5 B;  4UDU C;  4DDG D;  2DLB A;  2D3A A;  5D3D A;  1I4R A;  2C5L C;  1L0V B;  1H4R A;  1SJH D;  4P16 A;  1TTN A;  4FUL A;  1WJ6 A;  2AL3 A;  3NHE B;  3ZNZ B;  1FCC C;  4O1N A;  1IPG A;  3ZDT A;  3ETR A;  1IGC A;  2A5U A;  2NMQ A;  3RZW C;  4GDL A;  4A9A A;  2N1W A;  2AWT A;  4HDO A;  3ZKJ C;  1I4Q A;  1HXY D;  2KN5 A;  1SE4 A;  1DOX A;  1ISN A;  3UQA A;  3Q8F A;  1KF6 B;  1S1Q B;  1P1A A;  2CHW A;  2BB6 A;  2KT7 A;  2CU1 A;  3OJ4 B;  4W9G A;  1ZKH A;  3V61 A;  2BVC A;  3U7Z A;  3ZNG C;  4QAY A;  1IBX A;  3PO0 A;  2L83 A;  4IKG A;  4HEA 1;  4LNN A;  4M8N A;  1DOY A;  4JWU C;  1K50 A;  2TSS A;  3I9V 1;  3VDZ A;  2ASQ A;  1TY2 A;  2CKH B;  1E10 A;  1NVI D;  2RDG A;  5G55 A;  1WJ4 A;  3TEZ A;  2CR5 A;  1EUV B;  1VZ8 A;  2ZCC A;  2BS3 B;  5DPT A;  2WXM A;  2ZVN A;  1YN3 A;  4YSX B;  4XYC A;  2RR9 A;  2CS4 A;  1OEY J;  2NPT B;  3NUH B;  3UIP B;  1WGD A;  3AE9 B;  3RNG C;  3HK0 A;  4NNJ B;  2HTM E;  1TZ1 A;  3LB8 C;  3H1U A;  3QK0 A;  3VR9 B;  2PTL A;  4KIK B;  3ZW3 A;  1YMH E;  2XK5 A;  4HXD A;  3AU5 A;  1AWD A;  2JT4 B;  5CHW A;  2SAK A;  2LVQ A;  2M19 A;  3H7P A;  2DAJ A;  1L5P A;  3OJ3 A;  3N32 A;  3P42 A;  1IUE A;  5HHD G;  4B6W A;  2MLB A;  2JZZ A;  3P2B A;  4BBN C;  4JL9 A;  2E3T A;  2WLB A;  4LLG M;  1VRA B;  3A4S C;  2EKI A;  4N59 A;  4ZOH C;  2D3C A;  2L7R A;  2WXR A;  2M4N A;  3ZJU A;  2BYF A;  1UBI A;  1MG4 A;  1JW9 D;  1WZ0 A;  2MP2 A;  4CYE A;  2KJR A;  1VD2 A; 
#chains in the Genus database with same CATH homology
 4YTN B;  1Q10 A;  2RMM A;  2WQY B;  3SEB A;  3AEG B;  1SE2 A;  3HUI A;  1SE3 A;  1GB1 A;  1XLO A;  5FR3 A;  4Q2J A;  3KQ4 A;  2AQ2 B;  1NYQ A;  4WH4 A;  1UWM A;  3AN1 A;  3GB1 A;  2PIA A;  1XCQ L;  1MVK A;  4GDL B;  4PT5 A;  1PGX A;  5E6J A;  1VR9 A;  1UUP A;  1ZPS A;  2Q5W D;  3RPF C;  3ZJT A;  4OW0 A;  1D5M C;  2N7J A;  3GP7 A;  4TMA B;  4WIP A;  2AQ3 B;  1PYW D;  1KRH A;  2FBW B;  3MC0 B;  4C56 C;  3FIL A;  2KDM A;  4US9 A;  3R2T A;  4RGO S;  3TSS A;  3V3X A;  5FK9 C;  2J53 A;  2K22 A;  1YJI A;  2MJE A;  4OVZ A;  2FUG 1;  3H8H A;  3URY A;  3IT6 B;  1IBX B;  2IGD A;  1YNT E;  1VLB A;  2L52 A;  2DBY A;  4MH8 A;  4RFB A;  2QSD A;  3KLS X;  4ZHP A;  1PUT A;  2QIE B;  4USA A;  2WXG A;  3NVV A;  1ZUD 2;  2WDV B;  3ABV B;  3MJ5 A;  2PW9 A;  2YEP F;  2V4I B;  2W54 A;  1ZP0 B;  2ICI A;  2INP E;  1C4A A;  2V3N A;  1PGB A;  4J3O D;  3TEX A;  1RM6 C;  1RFK A;  4KGR A;  4KKJ A;  3VR8 B;  3BVM A;  1C79 A;  3AE8 B;  2YEP B;  1V1P A;  2VZK B;  3AEF B;  3AEA B;  1A70 A;  1KLG D;  2KQ4 X;  1F0Z A;  2KMM A;  3W5U B;  1BXT A;  3Q69 A;  1XLN A;  1JML A;  2OED A;  4GDK B;  1D6E C;  1I4G A;  4NAM A;  2X38 A;  3AE3 B;  1QOF A;  3LYY A;  1Y56 A;  1SIJ A;  1OFF A;  3HVZ A;  4TQ1 A;  2OHF A;  3W2D A;  5TSS A;  2ZW0 A;  1QIL A;  4N6E B;  1C77 A;  3TUO A;  3PZ7 A;  2ONQ A;  4RGT A;  4A6Q A;  5C2T B;  2PVG C;  4LTU A;  1LO5 D;  3E56 A;  1SXT A;  2K5P A;  2W3R A;  2WXQ A;  3AEC B;  1ZDV A;  2BW2 A;  2JXT A;  3BYY B;  4B0M A;  1QKZ A;  2QEJ C;  3BWU D;  2K0P A;  1K53 A;  1DYQ A;  1OQQ A;  4NZL B;  2WU5 B;  2Y5C A;  1EWY C;  1E7P B;  4HKQ A;  1TZO A;  1FNV A;  4L23 A;  1XO3 A;  2WXF A;  2KWD A;  2H89 B;  2HDE A;  2JX5 A;  2I38 A;  3W5V B;  2VZK D;  2WXP A;  3HVD A;  2IPK D;  3AE2 B;  1JRP A;  4A55 A;  1V8C A;  4YSZ B;  3AE4 B;  2BS4 B;  4N58 A;  2PVO D;  1SEB D;  1YN4 A;  1D5Z C;  1NEK B;  5EE0 A;  1JWU D;  4ZYS A;  2J4X A;  1RYJ A;  2QJL A;  2WNM A;  2PLP A;  1TKY A;  1FIQ A;  3E9S A;  2D5G A;  1ZDX A;  2IGG A;  3AE5 B;  5HFY A;  1JWA D;  2BBC A;  4OZA A;  4HJG E;  4M0W A;  4A90 A;  3RFZ B;  4YXD B;  2J42 A;  2GB1 A;  2E6X A;  1FRR A;  4YTM B;  2JWU A;  1QOA A;  1XEE A;  5EE9 A;  1I4H A;  4US8 A;  2BTE A;  4OHJ A;  3FAH A;  2V0G A;  3P63 A;  5T8I A;  2JYE A;  3ZQ4 A;  5C3J B;  3CWI A;  5BYR A;  1AYF A;  3IAM 1;  1N62 A;  2LGI A;  3NVZ A;  3AE6 B;  5G5H A;  3MP9 A;  2CJN A;  2IDY A;  4DXG A;  1C4C A;  1J7B A;  1EU3 A;  5G5G A;  5EE3 A;  4A8X C;  1KLU D;  1OQR A;  2M0A A;  2W3S A;  1QT9 A;  4RGN A;  3W1S A;  4D2K A;  4H2A A;  1L6V A;  5BMH A;  2J52 A;  3ZJV A;  2H88 B;  3BK2 A;  3O13 A;  1HA5 A;  1CK1 A;  1FXA A;  1QOG A;  1SB3 C;  4RF1 A;  1ROE A;  1VZ6 A;  2WDQ B;  3FIL B;  3J9C A;  2L32 A;  1XXG A;  3NRZ A;  1KH0 A;  2IJ0 A;  3BVZ A;  1ET6 A;  4LK0 M;  1HZ5 A;  1WWT A;  2B76 B;  1PDX A;  4OZC A;  2JZP A;  2DYM A;  2NTT A;  5D3I B;  1QOB A;  3B2G A;  2BT6 A;  4AS1 A;  4CQN A;  3SR6 A;  1FXI A;  1FMA D;  1AW7 A;  1EM7 A;  3EGR A;  1SJE D;  2WXO A;  1SF0 A;  1UGJ A;  4KGS A;  1FCL A;  3DWG C;  3BYT B;  1P7F A;  1C9F A;  4JWS C;  4ZRQ A;  2AX5 A;  3AV8 A;  1VZ7 A;  1F2R I;  1B1Z A;  4JX1 C;  4EE2 A;  1EU4 A;  1CQV A;  3V05 A;  1TJE A;  1TS2 A;  1V1P B;  1HQR D;  1WGK A;  2WXN A;  4L2Y A;  2WXH A;  1TS5 A;  2KAJ A;  3CIR B;  2L1A A;  3AB5 A;  2WU2 B;  2WXJ A;  3EUB 2;  3BVG A;  4RF0 A;  4DQO C;  1F2R C;  4ARI A;  5BYS A;  2DYO A;  2ACZ B;  3NVW A;  4C80 A;  2ZW1 A;  1MHX A;  1E9M A;  3B9J A;  3SFE B;  3ZGZ A;  3VRB B;  1I4X A;  1FD6 A;  1L4D B;  1FRD A;  1JRO A;  1D4B A;  4WAF A;  5H92 C;  2INN E;  3IT4 B;  2NTS A;  5H8Y E;  5HI1 A;  1TKE A;  1MI0 A;  2FE8 A;  1K52 A;  4YT0 B;  2CJO A;  4MM3 B;  1JWS D;  1WSP A;  1P7E A;  1PFD A;  2WDR B;  1ENF A;  1XF5 L;  3VRA B;  1N63 A;  1C78 A;  3R2I A;  1JCK B;  4C7Z A;  1I7H A;  1I4P A;  4TSS A;  1T6B X;  2RDH A;  1ESF A;  2Y5P A;  4YTP B;  2WXI A;  1KFY B;  1JWB D;  2BYT A;  3AEE B;  2M56 B;  4XE0 A;  5JXV A;  4IOI E;  2BS2 B;  3UI3 A;  3BII D;  4XWT A;  2KAC A;  4NJC A;  4ITK A;  4YSY B;  2MEK A;  3L4P A;  2W55 A;  1M4V A;  1ZE3 D;  4KX6 B;  4HKZ E;  1GPX A;  4REZ A;  4ZRP A;  1HEZ E;  1DGJ A;  1GB4 A;  2LHD A;  2WXL A;  3IXS A;  3P4R B;  5AUI A;  3NS1 A;  1WXQ A;  1VJK A;  2V3P A;  1C4P A;  1L4Z B;  1V97 A;  1F77 A;  3T3N A;  1N5X A;  1FM0 D;  3Q8A A;  1QLB B;  5BMI A;  1V1O A;  1T5X D;  2G1E A;  2MH7 A;  2PMV A;  2K3U A;  4FXC A;  3IAS 1;  2K9X A;  4WUR A;  2JQR B;  2LJI A;  1STE A;  3B2F A;  4KGT A;  1JQ4 A;  4B0E A;  4IDI A;  1WRI A;  4RGM A;  1XCT L;  3BK1 A;  1E0Z A;  1E6E B;  3R8B A;  1ZOY B;  1WYG A;  1YN5 A;  2GRI A;  2MJ3 A;  4WQM A;  4DXF A;  1J7A A;  1TY0 A;  4OZB A;  2WP9 B;  4RNA A;  3P4Q B;  3HRD D;  4MAC A;  3KWL A;  4AQ7 A;  1QF6 A;  3Q8E A;  4L1B A;  1ACC A;  3T3O A;  3SFD B;  1L0Y B;  4UDU C;  4GLS C;  1RWS A;  2DWQ A;  4P6V F;  3P4S B;  2DLB A;  3ZYY X;  3C8Y A;  3P1M A;  5D3D A;  1I4R A;  2N9L A;  1L0V B;  1SJH D;  1UWX A;  4P16 A;  3TEW A;  1SBB B;  3OWE B;  1L0X B;  1FCC C;  4O1N A;  1AN8 A;  1R7S A;  5I4D A;  3MHZ A;  2G9H D;  3ETR A;  2GI9 A;  1IGC A;  2NMQ A;  3AED B;  4JPS A;  4A9A A;  1QQR A;  5BYQ A;  3U52 E;  1I4Q A;  1VDV A;  1HXY D;  4JE3 B;  1SE4 A;  2LUM A;  1DOX A;  2EEL A;  1YQ4 B;  1FEH A;  2N0S B;  3FC4 A;  4R3D A;  3Q8F A;  1EWC A;  1DOI A;  1GAQ B;  4HRS A;  2LFI A;  3AEB B;  3U4E G;  1KF6 B;  1BML C;  2JYT A;  3NZ3 A;  4XWW A;  2BB6 A;  4ZHO A;  3EA6 A;  3N9Y C;  3BZD B;  1XLP A;  4MT5 A;  2CU3 A;  3Q8C A;  3U7Z A;  2R61 A;  1NEN B;  3AMZ A;  1IBX A;  5D7G A;  3PO0 A;  2ON8 A;  2JU6 X;  2L83 A;  1TKG A;  4IKG A;  3AM9 A;  1BUI C;  4HEA 1;  3KWV A;  3AE7 B;  3DWM A;  1DOY A;  1CZP A;  1TYG B;  1K50 A;  4JWU C;  1N61 A;  2TSS A;  3I9V 1;  1T3Q A;  1TY2 A;  1C76 A;  1E10 A;  1NVI D;  1N60 A;  2RDG A;  2MJD A;  3TEZ A;  3AH7 A;  1VZ8 A;  3W9C B;  1FFU A;  2BS3 B;  2WXM A;  1YN3 A;  2PKO A;  1J7C A;  2BB5 A;  1MHH E;  4C7Y A;  4YSX B;  2KN4 A;  1HZ6 A;  1ZXH A;  1GOZ A;  5FKA C;  1FFV A;  1SSN A;  1K51 A;  1UNS A;  2WS3 B;  1N5W A;  4NAW B;  2RPV A;  1CJE A;  3NUH B;  3LXF A;  1NYR A;  2LMC A;  2Y3A A;  2I2Y A;  2QMT A;  2XN9 C;  2SEB D;  1JAL A;  3AE9 B;  1FO4 A;  2HTM E;  2Z8L A;  4WWM A;  4TQ0 A;  3LB8 C;  3MFG A;  1D5X C;  5MPO A;  1XLQ A;  3VR9 B;  2PTL A;  4RH6 A;  3TEY A;  1YMH E;  3NVY A;  1AWD A;  1B9R A;  1YJJ A;  1KTK A;  2SAK A;  5HG2 A;  5AUK A;  2M19 A;  4YWG G;  2QIL A;  1L5P A;  3P42 A;  3PZ8 A;  3AE1 B;  1IUE A;  3WCQ A;  5HHD G;  2JSV X;  2AQ1 B;  4XDD A;  3Q8B A;  2LEK A;  1FNW A;  3P4P B;  1NI3 A;  5LNK 1;  1TS4 A;  5GXG B;  4ARC A;  3GS2 A;  2LHE A;  4KKI A;  1ET9 A;  2E3T A;  1IGD A;  1PGA A;  5EE1 A;  1MPE A;  2WLB A;  2IGH A;  4LLG M;  5BMG A;  4HRO A;  1JWM D;  1VRA B;  2N9K A;  2EKI A;  1ZXI A;  4N59 A;  1TS3 A;  4ZOH C;  3U2S C;  3VQI A;  2WXK A;  2XNA C;  2WXR A;  4XDC A;  3ZJU A;  1FNU A;  1L6U A;  1JW9 D;  3I57 A;  2W82 A;  4RCO A;  1YQ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...