1ZY2A

Crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
139
Chain Sequence
MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLLLLPDVNGLEILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRKLRKENELLRREKDLKEKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator NtrC1
publication title Negative regulation of AAA + ATPase assembly by two component receiver domains: a transcription activation mechanism that is conserved in mesophilic and extremely hyperthermophilic bacteria
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 41
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zy2A00
5FBHA 3EULA 3HSYA 3C97A 4KK3A 2E4YA 3E61A 3LOPA 3M6MD 4N0QA 5EWJA 2PUGA 4B09A 2VUHB 2OENG 3N0XA 3N8IA 4ZPJA 2RJOA 1SXIA 1Y1LA 3H5LA 4RK4A 1KRWA 4L4UA 2FN8A 4W5OA 4JOQA 2QV0A 4RDCA 5ABPA 1XHEA 3LUHA 4DN6A 3SQNA 4D6YA 4MS3B 3IP5A 4UHKA 1ISRA 3UKJA 3OQNA 4WXEA 3JPWA 5B3JA 1WETA 1HEYA 4NICA 1QO0A 4WUTA 3RVRA 2J48A 3VNBA 1U2PA 1RZRD 2OQRA 2A9QA 3CZCA 2WJAA 4YWHA 3HZHA 1I3CA 2FLWA 1Z17A 3E3MA 4P1ZA 5F64A 5IUNC 2IKSA 4G0XA 3F6PA 2NT4A 1DG9A 1M2FA 9ABPA 3CFYA 3RVKA 5BQ3A 3RVSA 1FSPA 3GWGA 3TB6A 3QX9A 2CHEA 3I09A 1TVMA 1LJLA 2NT3A 1FFSA 3O2SB 5DLEA 2JCGA 3RVQA 2E4WA 1ZVVA 3RH0A 4O5AA 2F8TA 3Q7TA 3SG0A 4KQCA 1U04A 4TLMB 3OLZA 2QU7A 2PJUA 2WB4A 3NBMA 4WT7A 3L49A 5FBKA 3MMNA 1QP0A 1TMYA 1Z26A 4RY8A 5HM6A 3CZ5A 1ZGGA 2FQXA 1E6KA 4HNSA 3LUKA 2PUAA 1DCFA 4MS3A 3KG2A 4YLEA 3LUGA 3EODA 3H1GA 1CHNA 1GCGA 4FB4A 4P98A 2M1ZA 2GX6A 3A3KA 2HJ9A 4TN5A 1BAPA 3RVJA 1P8AA 5KC9A 1JWLA 3I45A 3JTEA 4G0MA 3H5WA 5CNIA 2QR3A 4G86A 1DP4A 1ABEA 4RU1A 4LZLA 2FEWB 2FVYA 1ZDMA 3TMYA 3GYBA 2YHBA 4S05A 1EWTA 4OTZA 3O2JA 1MB0A 5KQLA 1T34A 3QX8A 3FFWA 1CYEA 3Q9SA 1DRKA 2PL1A 4YS6A 5EWMA 5FWXB 3MF4A 1JF8A 4EYGA 4FE4A 2O20A 1SXGA 2XDYA 1LJUA 3LUCA 4MR9B 4EGSA 2GI4A 3MA0A 5JNSA 2PMCA 1NATA 1ZGZA 4W5NA 1QQBA 4PICA 3CS3A 5JNVA 1Z12A 1JHZA 3RVMA 1JL3A 2FN9A 2I6FA 4KFCA 1TJYA 4KQ9A 1TLFA 1VKRA 4MRMA 4NQRA 2NZUG 4OBBA 2F8SA 3QEMA 3F6CA 2MYUA 3HUUA 4RKRA 3TD9A 1MVOA 3Q7SA 4MQFA 3HK2A 1KRXA 4Y9TA 3OM1A 3RVNA 2PL9A 2AYZA 3LFTA 4M88A 4MR9A 1JFTA 2MSLA 2PUCA 3ILYA 3JS5A 3HJFA 1R8JA 3A10A 3NNSA 5TQ0A 1NY5A 2FLKA 3D8UA 4MQEB 3GV0A 3QK7A 5GOTA 1E6MA 1BA2A 3O21A 1W9HA 1M2EA 3QELA 2KYRA 3CG0A 4ETMA 4W5QA 2DRIA 4LE0A 2FMHA 2MYPA 3SNKA 5BR1A 1JH9A 1JDPA 1H9CA 3GRCA 5C5EA 1AB5A 5FWXA 1APBA 4Z4GA 4LE1A 3A0RB 3BRSA 1ZN2A 1A2OA 4MS1A 2GWRA 1XHFA 2FSPA 2ZAYA 2FEPA 3BBLA 3GL9A 3KHTA 5KC8A 3RQIA 4N03A 1DCMA 2QVCA 4N76A 5C5CA 4G0OA 4WXMA 2JVJA 1GUDA 1JDNA 1D1QA 1YK0A 3UK0A 4MLDA 1P6QA 2L17A 3CLKA 3BRQA 3C3WA 4F3TA 3Q41A 3DBIA 2BGGA 2H3HA 3OLYA 4QYMA 3I42A 4KPYA 2MSWA 3HS3A 1A0OA 2CWDA 3HVRA 1QKKA 4MGEA 2N9UA 4YP9A 2IPNA 3M9WA 4HNQA 4Z4FA 4PE5B 3OQMA 2A9RA 3OO0A 3OM0A 1NXWA 2MYNA 2E4VA 4RK7A 4RS3A 3OLVA 1JYFA 4MQEA 5TQ2B 3H5TA 4ML3A 4TLLB 1RXEA 2FTKE 5JNWA 4IF4A 1BVHA 2GBPA 3KCNA 2M98A 4YCSA 3IP6A 3HM9A 2RJNA 1FFWA 2HQBA 1Z15A 4WZZA 4JA2A 2ZWMA 3EJWA 4E7PA 5IULC 3N0RA 2PLNA 3VNAA 1JX6A 1VRVA 4KK4A 2B1JA 3IDOA 3IP7A 1YK1A 2HQOA 4MR7A 1NXTA 3KYJB 5EWMB 1D4ZA 5BRJA 1DC8A 2WRZA 4S04A 1EFAA 3O1IC 4Z4EA 3KLOA 3NNDA 1ZAYA 2QW1A 4XASA 2WJWA 3N6VA 4XFKA 4H3HB 3O74A 3UUGA 1QNLA 4OLAA 4ZMSA 1Z18A 3O2QB 5TPZD 3DGFC 4L85A 4MRMB 4G0ZA 1ZH4A 2ID9A 3QEMB 5DKFA 4MQFB 1SXHA 1U2QA 2L18A 3T8YA 1DZ3A 2FMKA 3OLWA 5PNTA 1NXSA 1ZH2A 1L5ZA 3GT7A 5TQ2A 4XLTA 4CBVA 3HV2A 4EVSA 1FQWA 5KQGA 3KS9A 3MM4A 5TQ0B 4Z99A 3DZDA 1PEAA 2NUBA 1EWKA 1EHCA 3EDCA 3KJXA 3F73A 4MAAA 4IGAA 4RZSA 2A9PA 3QELB 4IMJB 1GUBA 1EAYA 3W9SA 3ROFA 3T38A 4RY9A 3NHMA 1ISSA 1VLZA 1W25A 4IMIB 2HQRA 3A0UA 1RPJA 2R48A 4H3KB 2FEKA 4RSMA 1PNTA 4YV7A 4MS1B 3QLTA 3T6KA 4LE2A 2RDMA 4WWHA 3GBVA 1K68A 3K4HA 4MLCA 4EYOA 5GQSA 1NTRA 3CHYA 1YTUA 4EY3A 3H1EA 1P6UA 3CNBA 3OMWA 3O1HB 1RZRA 4G0QA 4F8JA 1CEYA 3CKMA 2E4ZA 6CHYA 3C6QA 4RXMA 1YS7A 1QP4A 1ZHHA 2R4QA 3QLUC 3FGZA 4FE7A 6ABPA 4KREA 3EQZA 4MS4A 1BDHA 2MSKA 4OG2A 3T95A 5KI6A 4N41A 2JBAA 1QO0D 1YMVA 5E3JA 1DBWA 3IP9A 1U8TA 5IUKC 1LBHA 2W42A 4G0YA 1VPWA 1PUXA 3KKEA 5T3YA 3BREA 4Z4CA 1JLKA 3N0WA 3LUFA 2VK2A 7ABPA 3L6UA 2PUDA 1DJMA 1KGSA 5T7BA 4LDAA 5DCLA 3CU5A 2PE5A 2RGYA 5IX8A 4Z4HA 1RXIA 2H0AA 1Z2EA 3JVDA 1E2BA 5DTEA 1LBIA 2MYTA 3IPAA 3LUDA 5JNUA 1J56A 3KLNA 3JVIA 4QPJC 1BDJA 4O1HA 4RY0A 4EVQA 3R0JA 4F11A 3LKBA 1FFGA 5KQMA 3N53A 1D2AA 4GNRA 4KV7A 4IRXA 2IPLA 3KTOA 4XAQA 2FQYA 4D74A 4MR7B 5JNTA 3FFXA 5HQJA 5DGCA 3KYIB 1PHRA 4MR8B 1M5TA 2LBPA 2WMYA 4Q6WA 4HNRA 4G97A 4XXHA 3CRNA 4W5RA 2FXIA 1JFSA 3QLUA 1F51E 3CTPA 4GPAA 2FQWA 3C3KA 2HSGA 3HDVA 2PUFA 4RXTA 5JNRA 2JVKA 2LPMA 3GA5A 1Z25A 1QMPA 3P9YA 3ROTA 4D6XA 2IOYA 5HKOA 5IUJC 3H75A 3HO1A 1DCKA 1NXVA 1Z2DA 4Q7EA 1ZY2A 2Q5CA 5IEBA 4JB2A 3C3MA 1D5WA 3MYYA 1M5UA 3QLVC 5I4CA 1S8NA 3H5IA 5TQJA 2QSJA 3TO5A 3HDGA 4IILA 1B00A 4E7OA 1L5YA 3F7NA 5FWYA 1NXXA 3KSMA 3BILA 1QP7A 5KWSA 3DLHA 2B4AA 2JK1A 1U0SY 4JP1A 4N47A 5IEJA 1PEYA 3IPCA 5CHYA 2FW0A 2VUIB 3H6GA 4O1IA 1GCAA 4RK1A 3D02A 4JB0A 4RKQA 5IC5A 4ZMRA 2IDMA 1URPA 2NZVG 3LUJA 4EYQA 2P4UA 1C4WA 4LX8A 5BRAA 1GLGA 2FMFA 4MR8A 1IIBA 1MIHA 4KMRA 1MAVA 2FMIA 3DLBA 3O1JC 1JFVA 2V0NA 4RK0A 3EAFA 1RNLA 4QYWA 3HCWA 4TMYA 1YMUA 2GKGA 3B2NA 3HEBA 1NXPA 3I5AA 1YIOA 5ED4A 1DBQA 4ZJPA 1ABFA 2WWVD 2HPHA 3G1WA 1BDIA 3NHZA 4MS4B 3FMVA 4KVFA 4YO7A 2JBAB 1DC7A 2JB9A 2PAFA 3QLVA 3MIZA 1OXBB 1Z13A 4RV5A 3LTEA 3RVOA 3S99A 5TE9A 1SRRA 2QVGA 5EWLB 1TM2A 2IPAB 4RK5A 3H6HA 3Q7RA 4Z0NA 2YHAA 3QEKA 4F06A 3FDFA 4PEVA 3RVPA 3CG4A 4ETNA 2L2QA 2R25B 5JS2A 4YGXB 3H5OA 5CNJA 4W5TA 3OLXA 3N75A 3ILHA 1Z16A 1SD5A 2LIVA 5KQPA 3SM9A 1F4VA 2IPMA 1USKA 3LKVA 4JAVC 1LK0A 1MB3A 3FFTA 4PYRA 4MPTA 5TPWB 2CHFA 2R47A 3SY8A 3OQOA 3HXMA 4NCBA 4Z9AA 4PZ0A 3DGEC 1A04A 2QXYA 5JS1A 4OLBA 2E4UA 4RK6A 4QICA 1E6LA 1EWVA 8ABPA 2L19A 4MYRA 1C0EA 2WY2D 1PNRA 4HYEA 1DRJA 3NNNA 2CD7A 4YR7A 5CNMA 4OATA 2FKAA 4DADA 1AB6A 2P9HA 5EWLA 4DQDA 4JASB 1QPZA 4Z4IA 3O75A 4Z9BA 5EWJB 5IBQA 2VYCA 1USIA 1YVUA 3LMKA 4H60A 2LUOA 3EQ2A 3H1FA 4LRQA 3GBPA 3G85A 2JRLA 2PUEA 5FWYB 5D2CA 3RVLA 3EGCA 3JY6A 3OMXA 5HSGA 2LP4Y 4N0PA 4UHJA 2E4XA 4XARA 1D1PA 4NV3A 4KNYA 3MQ4A 2AYXA 1JYEA 2PKXA 5TPZA 2PUBA 1XWWA 3TX6A 4NCAA 1QQAA 5TPWA 1ZITA 2A9OA 5B3JC 3M9XA 1P2FA 1JBEA 2JVIA 4RXUA 1OXKB 1ZESA 3K9CA 3HUTA 2ID7A 3LUAA 4KZKA 1NXOA 1YS6A 4G0PA 3JPYA 4LDZA 3H5VA 1K66A 1KMIY 4YRZA 4RWEA 3URMA 4EYKA 4KRFA 1UDRA 2IYNA 4EUKA 1USGA 4Q6BA 3Q15C 3SAJA 2X7XA 4F12A 1DBPA 4ZYLA 3OO1A 2QZJA 2TMYA 5CNKA 4EVRA 4ETIA
chains in the Genus database with same CATH superfamily
3EULA 5BUSA 2FWJA 5HUJA 3VQTA 2E4YA 4I9HA 4IIVA 2QRUA 1CEQA 1Z7BA 2GBGA 2GTHA 2JIZD 4QYIB 1DKNA 2YRFA 4AJ9A 4ODIA 2VUHB 2VHXA 4IPTA 1E3MA 1A2BA 2WWRA 1CFJA 4N5IX 3DNPA 2UZ0A 1C8KA 3DMTA 3EQ8A 4PO3X 2HPVA 1UC5B 2C4VA 2ZW9A 2O0KA 4PAWA 3K6SA 3AERB 1KSGA 1Z0IA 3MTDA 3DNMA 3P2IA 3BMCB 4GW3A 5F21A 5GMOA 3REFA 1WZNA 5IZCC 2BI4A 4DKJA 5DTQA 1RRGA 4X6YA 3IP5A 4BBPA 1KF0A 4R98A 1OF1A 4TTQA 2HHJA 4DUPA 5CD9A 4KAXA 3UKJA 2XNDD 2YICA 4U1RA 4WXEA 1T2EA 1AK1A 4GXNA 1DV2A 1B2LA 3D54D 3PF8A 1T6BY 1GKLA 4H31A 2C58A 1II8A 2LCFA 1R4NA 5JAPA 2WTBA 5AW3A 1WOYA 1V48A 1DO0A 3BX1A 3CNQS 4P1ZA 2IX3A 4BFWA 2PRYA 9LDTA 3H9JA 3LYLA 5A6SA 5A4MS 3B6JA 2H4JA 2WKSA 3AESB 2Q6VA 3EH2A 2ASVA 4M60A 5B3AA 2ZEJA 1YB7A 1KNQA 1S3IA 2X6QA 3DEKA 2X6TA 5KCZA 1RQLA 2ZB2A 3TB6A 1ZVJA 4MH0R 1K98A 5AKZA 4QTXA 4ILEA 3ZI0A 4E3WA 2X6RA 2H59A 2PUWA 2HFKA 1LJLA 2NT3A 1T9CA 4YGYA 4B3BA 2NSHA 2VDJA 4ARCA 2XHZA 3OCZA 3GVCA 3OICA 3WI7A 4AW9A 1YDWA 2DT5A 3KUCA 4K03A 5A9SB 3LI2A 3RF7A 4KX3A 3GP5A 1BX3A 3MMNA 721PA 5CFRA 1E98A 2GOYA 5LPNA 3DQPA 3C98A 1PJ4A 4GC9A 4R1TA 3LPCA 5LB4A 2RGNC 4KZPA 4YRJA 3J80A 3H1TA 2XGJA 3ABZA 1VL8A 3BWMA 3LUGA 4ZDIA 3W8RA 3PX3A 1AHHA 1LV8A 3DR3A 1QG6A 5FLYA 2A57A 1RVV1 1E9EA 2EYUA 2VHUA 4B32A 1GCGA 3KLBA 3I9V6 2NW6A 5JSUA 4AWBA 4ZIRA 3UJNA 1JWLA 1LU9A 4LA4A 2X22A 1CY0A 4TYPA 1SIOA 4PHFA 4C07A 4EZBA 1TECE 5JAMA 2RBGA 1KZHA 3RFTA 5E0OA 2BUBA 3TNYA 7MDHA 3ADDA 3BHIA 2F3TA 4HQNA 1LFAA 3WWDA 1KH2A 4OSEA 3A26A 3IE0A 4CUJA 5JEEA 1UBUS 1D0SA 1F8GA 1ZGJA 1KYWA 2E87A 3DUFB 4XQ0A 3FFWA 5JW6A 5K6AA 1L7PA 2UZAA 5EFZA 3E3LA 4M98A 4YHBA 1BYIA 2EL9A 2E49A 3M3DA 1RKBA 2YRXA 3AEKA 4FE4A 2VNAA 5FYDA 1KYQA 2KBEA 3IEMA 5PNTA 2OOKA 4EA9A 3SZ3A 1CUSA 3IERA 3QYJA 4G8DA 4TKZA 5JJCA 2IEZA 5BRNA 2XTAA 1QRUA 4PICA 2PR7A 4NAVA 3RVMA 5AP9A 2W8BB 2FEAA 2C99A 3N6RA 1MZVA 5KPDA 1FU7A 3K1AB 1U8XX 5JBQA 2Q3EA 1QH0A 1LLCA 2V9PA 3MC1A 1Q91A 3NTUA 1EFDN 3ESBA 2MYUA 2YQZA 2DAPA 3PFGA 3E8SA 2OVBA 2AVDA 3C5CA 1NLFA 2E18A 2ZQYA 4HI0E 7ADHA 1I6KA 3OM1A 5ALRA 3P94A 1NI4B 4BFVA 2QSYA 3G1UA 4WW0A 5J2UB 2PUCA 1KI1A 2ZK7A 1XNHA 4U9HS 4DYDA 1JSCA 3U37A 2FN4A 4ESOA 4G9GA 2A58A 3CIOA 5EGSA 3RIHA 1JSZA 2VWGA 5HIIA 1SULA 3RODA 1FP4A 3K30A 2H8GA 5HRAA 3R3SA 3KQUA 1IZZA 1V4BA 3IVMA 5H59A 1C4OA 3UXMA 1D6SA 1RS0A 1DFHA 3RS8A 4EITA 1I94B 2XX3A 1O94D 1MEOA 2C4NA 2HLHA 3NT2A 4KQJA 3RUDA 1OYWA 3IJRA 1SM4A 2ZBVA 1P9RA 3EDYA 2C8VA 5IFKA 1YL6A 3KYBA 4B7AA 4FS3A 2VJPA 2H2WA 1W30A 1JDZA 2P5YA 2R6AA 1RHJA 2HADA 3KT6A 2VSNA 4I14A 4J76A 4LBWA 1FOEB 1LI4A 4FKBA 3BD8A 1AKUA 4G0OA 2PYZA 3HCNA 1E1MA 1JR3E 1Y5IA 1T2NA 1JMKC 1GZSA 1P9LA 3KKKA 3LQYA 4WLNA 3IR6A 2YZMA 1S6YA 1DOZA 4QAQA 3ZWYA 4BQOA 4REQB 1Y82A 3KL4A 1AG9A 4QNNA 1QKKA 3P9KA 4HAZA 1Z63A 5BW4A 1G20E 1PHPA 3EOBI 2ZBPA 4TKVB 3HACA 3RHZA 4CKZA 3EMBA 1NXWA 2IQ5A 1FP6A 1L9KA 3KUUA 3PNBA 4D42A 3Q3CA 4HQKA 3F8TA 5CTAA 1A7KA 4TGLA 1Z6ZA 1OLSA 5EYPA 3DEYX 3K2IA 3F9RA 3AR8A 4AKSA 1CY6A 1WMSA 4PGMA 1UMCB 2II6A 3VX4A 1SCAA 1OBOA 4D8UA 3P97A 2EJCA 2FPWA 4MKZA 4BY9E 1VE1A 3TEJA 4MB2A 3QMWA 1KIAA 1IVNA 2GYYA 3U7EB 2G0AA 1JX6A 3U56A 1Z68A 3EGXA 1TO1E 1BIFA 4QNRA 1ZUIA 3R0QA 3ZCUA 1NXTA 3G5AA 1A98A 3LC2O 3R09A 2GNAA 5A04A 1YMQA 5LXTB 3HCBA 1Q0SA 1G63A 4E5DA 1LBEA 2DTXA 2LVBA 4JUCA 4BZQA 2GYWA 4CL3A 3NNDA 5BW8A 1E79A 2P9YA 4OOFA 3Q9NA 3ZHQA 1FJ2A 2CXTA 4IXWA 4Y2QA 1TDJA 4GBED 4IJVA 4M6WB 4G8CA 4LYDA 2BJVA 1KI2A 1RPTA 2CHQA 2EHDA 2ISSD 3A4VA 4IGKA 3ADBA 3ITEA 4TRJA 4MIKA 1CS0B 1XJQA 4I9UA 2IYSA 1EGAA 1NI5A 1ZH4A 4DIBA 4LN1A 4GX1A 2HWKA 3MZ0A 4MMZB 3RSLA 3UGQA 4TM7A 1ZM7A 5DTRA 1QFSA 4Z86A 4QXRA 3KKLA 3GT7A 4HS9A 2I2BA 4GQAA 1ZKDA 4HB0A 4L72A 2PZAA 5FV7A 5G3YA 1E7SA 1OR8A 4TQGA 2G6BA 3TW0A 1Q3KA 3BZBA 3IMCA 3JW8A 4EUNA 5BVHB 3NFRA 2CNNA 4R68A 4NHOA 4BZXA 4QGBA 5L3QB 4JD5A 3BCHA 3HKDA 3EIHA 3QPUA 4MUYA 2AFIE 3GGDA 2PLRA 1WDMA 5EZ5A 1KY4A 2BI8A 1GT6A 3AVYA 4Q1AA 3CUUA 2OOSA 1DDGA 3CQ9A 5LBUA 3VU9B 3AQ4A 4IMIB 3PVZA 4CCYA 4UOEA 1H2BA 521PA 1FX1A 1W85B 2XZTA 1UPXA 1B43A 2FU5C 5DLPA 2GETA 1WDLA 2GN9A 2R1ZA 1N8SA 4D9NA 2MIIA 3LT5A 3QU7A 1E62A 2EFYA 1SEVA 3H2GA 4F4FA 5AW5A 3B1WA 3RK0A 4CKCA 2O23A 5E1BA 1NQVA 3G9UA 2QRQA 4QDXA 1UXOA 2W70A 2QHXA 1AKNA 2QENA 1X87A 2X9GA 3R3JA 5DLQC 4AKTA 4F8JA 6CHYA 3GLGB 1XTBA 1RKQA 5DHAA 4AJ4A 4A10A 3NANA 1UP4A 1BQ4A 3NHUA 2VHJA 5KWIA 1E69A 1QP4A 3KVVA 1OUMA 1UMBA 2I3BA 2BGJA 3KSDO 3T95A 1GN8A 3CPHA 1QLWA 3WGIA 1XPRA 4IW3B 2AHOA 1C1XB 4X60A 4N7BA 1KK0A 4EI9A 4N12A 3ABSB 2YVQA 1D1TA 1CY4A 3CN7A 3JQ8B 3KKEA 3JVUA 3D6TB 1LB1B 3LT1A 2HA0A 3U0BA 4C20A 4JDPA 4WN9B 4G84A 2R5NA 3P0FA 2JJ2A 8GPBA 2GEKA 3JQAD 3I4FA 1QC5A 4IIJA 4BP3A 4EHDA 5I7RA 1SPBS 2ZYIA 3NC0C 2DOKA 5GIOE 3VYUB 2PE5A 2RGYA 2QTVB 4R05A 3I61A 2ZIXA 2VP4A 1M2WA 1PEKE 4JJ8A 5TARA 3NPMA 2JCSA 4H6WA 4QQRA 3SF8A 4EB3A 2O4CA 3KKNA 4RD3A 5D5QA 4UFOA 4Y1FA 2PUHA 5KQMA 1QE5A 2QVYX 3N53A 4CUKA 4MQ5A 5IXSA 4GXTA 3RBXA 1JG3A 4FEGA 2PZEA 3S7TA 3KPUA 5CEJA 4MQUA 1AKEA 5L7YA 3KYIB 3ZCRA 1EVZA 1QOZA 4IDCA 3MOSA 1WP4A 2JKZA 2BGNA 4Q24A 5K0EA 5A4AA 4K46A 2HH9A 2NOAA 4W5RA 4X95A 2R8BA 3EGIA 2XMCA 5C32A 4KVGA 1C7ZA 3V7UA 5CDTA 3P9CA 4EGCB 1RRFA 4EK9A 1OVMA 1X7XA 1G6OA 2GDJA 5ALFA 4ZAZA 3F8SA 3NORA 4E1VA 5B3KA 3KWLA 1G8HA 2H2HA 3KQPA 4JT2A 3L92A 2NMVA 1VGVA 2I0FA 1NXVA 4NBUA 4JIGA 1DG3A 2SECE 4QYXA 1XB2A 3HNOA 4U2KA 2NQ2C 4E2FA 1XDBA 2EC5A 2WLSA 3OPYB 1M5UA 5F3RA 2C84A 2WM9B 4RIHA 1SC4A 4YJHA 2AVNA 4ZYXA 4IILA 1C9KA 1YCHA 4GECA 2BGRA 5IKOA 3ZY5A 1L8OA 3Q10A 2WJVA 5G0VA 1QP7A 3GRAA 1D8TA 3L7DA 2PCJA 1R0ZA 4F60A 2NAPA 3EE6A 1MPTA 4GOMD 5JEDA 3ZVKA 5EJEA 1GQYA 3N2YA 2NUPB 3BTSA 1RIIA 3D02A 1N5DA 3RIEA 3KDPA 4LOHA 4Q9JA 4F2DA 2D3TA 4ZOLF 3HPQA 5H83A 4EARA 1TCVA 2IYQA 2WWTA 5BRAA 3O8CA 3U44A 2R00C 3OIWA 2FP3A 2WTUA 4JEMA 3HY4A 2C2HA 4ON9A 3ZCVA 1JQ5A 3M89A 1YS1X 3P2EA 1Y4DE 5KEIA 4R9VA 2DMRA 4MZXA 1QVRA 2ZTUA 1KERA 1GPH1 3WC4A 1S2OA 3OCXA 5ILGA 2AOUA 3Q1KA 2QM8A 2HK7A 2Q0HA 1YB4A 2GAAA 3CXUA 2ILVA 5H3LA 1XC7A 2HPHA 4LFAB 1J2TA 2YY6A 5JWRA 1SUFA 4Y0AA 1PG5A 2I76A 1P0QA 3CRQA 4WI1A 4P81A 1TRKA 5CYOA 2HSZA 3FWPA 2WYWA 3CX3A 3N2IA 4OL0A 4P2BA 2UZ1A 4TKUA 4XVQA 1WD5A 3TLKA 1IVYA 2ANCA 3NW9A 2JFNA 3PSAA 4JITA 2OXEA 1YBHA 3H6HA 4N5MA 2C7BA 1F38A 3Q7RA 3WK9A 1TM3E 1R0SA 4G9BA 4D92A 1AQNA 2B8JA 4UVHA 2N3ZA 4IJQA 3OCWA 1UWLA 4MIEA 4NP6A 5EC8A 2Y2VA 4B5KA 2HN9A 5EZQA 2ON6A 1ADJA 2QA5A 4JVMA 2D8AA 1H9BA 4K5QA 5IBRA 1M34E 4N3BA 4UC0A 2C8KA 4WBNA 3VR0A 3N75A 4MUEA 3AKZA 1N0HA 3BXXA 4ZI7B 3RW9A 1WP9A 1ZD8A 4YAEA 2HGSA 1ZMBA 2IVFA 3EOAI 1Z08A 2JFHA 4FD3A 2I8LA 5D85A 4HUQA 1QBGA 1MB3A 3A3YA 5FBLB 4HDRA 1EI9A 3B13B 2JJQA 3ZWPA 1LQUA 4K2AA 4C2BA 1FDUA 1IJEA 3T7JA 1A5BB 3DBLA 1I6MA 1SG6A 3EBLA 3F6SA 3LCVB 3OFJA 4FN4A 1XP8A 1DKRA 1TYBE 3H2JA 5CDFA 3UJHA 4CI9A 1LW6E 3OKPA 4P8RA 2XR1A 4ZVRA 2VK8A 3K3PA 4YRNA 1CZHA 4RK6A 5LQKA 2C7OA 4NXMB 4KOEC 3VNRA 5IG2A 1CJVC 1N7HA 2EW2A 2XLBA 2XNCA 4JP3A 4CNQA 4TVSA 8ABPA 2QAGB 5BNZA 1Z6GA 1C0EA 1JQBA 1LPPA 1M8FA 2XRFA 2RCNA 3QZUA 3RU7A 3X43A 4B6OA 4HYEA 4EQ6A 5CVTA 3P2OA 1W49A 1Y5MA 1NW8A 5U1PA 3NHSA 1SOMA 1DKQA 2QM7A 5FKJA 2MJLA 4JASB 4KE8A 4Q1EA 3WIDA 3L02A 4FFPA 5DB4A 4PWZA 3HCAA 4UVEA 4B7CA 5LLDA 1W76A 3ELDA 3EJ6A 3LMKA 5U4XA 1H2RS 2PY6A 2VWPA 4PRZA 3AM3A 2Z2ZA 3ND8A 3IAFA 1PX0A 2JFVA 1CE8A 1TT7A 1LZKA 3KOZA 5MGBA 2GUWA 2DF8A 3B9RA 2J0QA 3EGEA 4MUKA 2Q7XA 2WIAA 3DEHA 5FRDA 2O2JA 2DXIA 3MJDA 1E5DA 1HDCA 1W2WB 2HIAA 4HLUA 1XCLA 2QNBA 1BMQA 1Q1EA 1OWNA 1SVKA 3LUAA 3OZFA 1KZ9A 4KFSA 4BUCA 1KL7A 1ODJA 2XF2A 4PAMA 5A4DA 2OCAA 3JPYA 1TAQA 5H0IA 5L3SB 1KE2A 1ECCA 3F6YA 3TDMA 2IZ0A 1NIJA 3PDHA 3WADA 1Q20A 1NUQA 1QVZA 3P9SA 5DU2A 1STOA 3DOFA 4A0SA 4ZYLA 2Q8NA 2JGDA 4JBYA 1JTEA 2B82A 1YZVA 1UK6A 2B0CA 5CA0A 4WLVA 1VHLA 1D2NA 2FI1A 4R41A 3AGPA 1IBSA 1PQUA 3GH1A 1SBHA 3M3HA 3NKVA 1L3CA 4GPTA 1R0RE 4EELA 1UBCA 1ST3A 2NU7B 2EIHA 4U5QA 1ULAA 1Y63A 2XDAA 4GC5A 2FV8A 5KNCD 1FS5A 1SU4A 4KVAA 3BCUA 4W5OA 2AWOA 3QM1A 1UK8A 1MHTA 1DTEA 2G63A 3RC1A 3ENWA 3ORFA 4NIMA 1VA4A 3IULA 1EE9A 2ZJ5A 3LBAA 3VPDA 3CGWA 3V3TA 5KYKA 4CMBA 3K9FC 1D1SA 4BQFA 4CXMA 2QGFA 3LW7A 1JKJA 2Z4SA 4ZOQI 1PSWA 3UMRA 4O63O 4LHWA 4BV3A 5DTMA 4IQGA 1RKXA 2Q2NA 2QJWA 4GOOD 2FLWA 3ORRA 2F3SA 3WRXA 4WBNF 1KZ1A 2DCUA 2BM0A 3PGLA 1DG9A 5CFMA 1C9DB 3DA8A 2KS6A 5AK3A 4G25A 3EQ7A 4JT4A 5K6RA 4QXPA 3SSNA 3IESA 5CXXA 2B6HA 5BN4A 3TRIA 3T5PA 3OESA 3D6AA 1VLJA 3IPYA 3UJCA 4I4IA 3ADKA 2UYHA 5G40A 2NSJA 3I09A 1OB5A 1XZQA 5E8RA 4H7KA 3KX2A 5C18A 3JQPA 4H17A 4OJTA 4YH1A 1K6IA 1OBHA 1UDAA 4KN5A 1JFFA 4N5LA 2O2CA 3FVRA 1KKMA 3H5AA 4IIBA 5KWSA 2F8TA 2G8NA 4TLMB 2ZM5A 3AX6A 4RFVA 1R9NA 2J3HA 4PG6A 3TNJA 1XRNA 3NBMA 2OORC 4WXHA 3L41A 3TZKA 5K0TA 3PLNA 4D9GA 2I4OA 4CQLA 5HOEA 4PS1A 2AJ8A 4RDIA 4HNSA 3GNQA 1WHTB 3BIXA 5EHZA 1SOWA 4KXLA 4DG9A 3QY0A 2WYHA 2AOVA 2NVWA 4EG7A 1F4LA 8LDHA 4ZCTA 4GLOA 5CT4A 3HPRA 1HYQA 2BELA 2ZRAA 2M2IA 1NI3A 3VC7A 1ITZA 5EXXA 2DHQA 3W2HA 4URHA 2QR3A 2I3DA 3DAHA 4JK3A 2QQEA 1VL5A 1ABEA 4IHKA 5LQUA 4LZLA 1P31A 4JY7A 4QXOA 1AUVA 5KYUA 4E08A 2XWSA 1LA2A 2YY5A 3MWDA 2QI9C 2YHBA 3EVAA 4NCIA 3WJ1A 3U40A 3E81A 5JSQA 4B3GA 2AF3C 2WILA 2XKJE 4PRYA 1SUSA 3MTQA 2ZWVA 4QFCA 4BLVA 4O4IB 3KZVA 3PQ8A 4PV7A 1OI7A 2C0PA 3L7MA 4QHTA 1RJWA 1YFZA 2BGTA 3GRKA 4NMWA 4D0LB 3ZHRA 1VBNA 3ZHSA 4MW4A 1PN3A 3ANSA 5FWXB 3SBOA 5FL3A 3WNDA 2HXSA 4IZIA 4QYTA 5DM2A 4BASA 4D99A 3MA0A 5HZKA 1ZYUA 3NB0A 1D2GA 4INAA 3BGWA 3OQ1A 4Q1VA 3PEYA 1ZGZA 3O4HA 4I9FA 4P93A 2QT1A 4I46A 3FUWA 5HG0A 1ZI6A 5KHLB 4D56A 4AKHA 1EYZA 4NY1A 2IEDA 5DRYA 5CA0F 1KTIA 4GIBA 4ARVA 4MRMA 5K0FA 2F8SA 2C1XA 2J3IA 3R6TA 2ZPAA 1WBDA 3C48A 4MQFA 4B2YA 1KRXA 1H42A 1H4TA 2Y66A 3KR0A 2B1IA 1Q95A 3M6FA 1CIJA 1O97D 3SICE 4HVCA 5E4YA 1U0FA 2NUAB 3RHSA 5DW3A 5CW2A 3DMRA 2AXEA 1T36B 2Q1WA 3H8WA 4O4HA 1ZRHA 3LL4A 3O21A 4MWTA 3ZDAA 1FU8A 1O57A 1Z29A 4LXIA 4GQIA 4KN9S 5EQFA 4NJEA 3SDZA 1DQSA 4LE0A 1OA1A 4TWZA 4W5QA 2REOA 1U1FA 3NR2A 1FYXA 4YI3A 3VJLA 5IBPA 3OQHA 2HNKA 1JSXA 1KJZA 2VHVA 2X3YA 1Z35A 4BNMA 2JLVA 3EWNA 3QA3E 1PGPA 2PD4A 4MWEA 3MMZA 5E1OA 3PDUA 1NBME 4BMYA 4Y18A 5J4VA 5DLDA 4D43A 3GRPA 1RYBA 1LQ2A 4YMGA 1WB6A 4G1FA 1BFKA 4WXMA 4B6QA 4OIFA 4WJLA 4EFDA 1YK0A 5JSZB 1HZZC 1MQ9A 4OOEA 3WYGA 2H3HA 4CDRA 3I39X 5M7EA 4RIGA 5B2ZA 4D57A 5AQ1A 2OTCA 2QROA 4GP9A 4LDPA 4RIIA 2G9NA 4EP1A 4E3ZA 1KOLA 2O8EB 4JYCA 3G2IA 4O3MA 2NUTA 5EXEA 3OTQA 1WZCA 2VJLA 2QMZA 5L95A 3UHJA 5LZ2A 1CUVA 1NM5A 1P18A 3V97A 4RZHA 2KWIA 3NWEA 3MWYW 4C2TA 2GXUA 4QU8A 2BPOA 2Q6LA 2Y0BA 4GEKA 4X63A 1FRZA 2VP5A 2K87A 3A31A 2NU8B 1ZSNA 2ET6A 3IP6A 4X45A 4CNBA 1QIMA 3IC5A 5LYJF 4DXHA 2V7VA 3L8YA 4JA2A 2AR0A 3N0RA 4HLNA 3G1TA 4OQZA 1ZC4A 2NSDA 2PLNA 2CXRA 4NF2A 1BA3A 2P3LA 1Z6QA 3EFEA 3K5HA 4QBFA 1W0KD 5AICA 1EQ2A 3M5WA 1BHQ1 2GNPA 4QSMA 5EAIA 3ROGA 2OD9A 4I3HA 2NQTA 2G88A 4WCFA 3DZIA 1L2TA 3I92A 2J0EA 4LRYA 1H1TA 2C29D 3GWZA 2YIDA 2B78A 4AXBA 3IB3A 3IEIA 2NXEA 1LZLA 3N8GA 3OU6A 4CMCA 4EOGA 4RCVA 3DOIA 3S1LA 1C2YA 1OZAA 5ER6A 2R4TA 2Q28A 2XA2A 4HRAA 1JVNA 4M0PA 1XIVA 3N2ZB 1O8BA 4ZMSA 3QE3A 4E5PA 1VB5A 4WA7A 2IBTA 1Y1PA 2O50A 3E22A 2I22A 1LXCA 2OHOA 4YCDA 1CUUA 2DGDA 2IOFK 1YL5A 1UFQA 4XRRA 3D59A 3OPMA 5PGMA 4UQLA 4TYWA 1GAXA 1ZH2A 3A2LA 5DCWA 4RZ3A 2AR9A 4KYUA 3ILSA 4BVHA 3KS9A 3M33A 1DS6A 2WVJA 2IV7A 2CJWB 4HDQB 1RWWA 4U5XA 2C57A 2I1QA 3ZZTA 1C7IA 3ZY2A 1MV5A 1SURA 3FGOA 3N2GB 5H1YA 2WHQA 3R3YA 3BH7A 4GD3Q 3L04A 1TKCA 2QX9A 3MN1A 4IO1A 2JA1A 4KRGA 4UCXA 3WGQA 3N1UA 3F98A 3FCSB 5LP6A 1W25A 3GARA 4Y9UA 3URKA 4WK6A 3GDWA 3UJAA 4CL2A 1DAOA 5HHTA 1VDZA 1P9OA 4O4HF 4ZO6A 4C0HA 3SLGA 1ZOLA 2PANA 1WY5A 1SXJB 1JJIA 3C8MA 3EDRA 3ZWVA 4ZOCA 1B8PA 1CVLA 4CLRB 2C2WA 2YWEA 2G9UA 1D2RA 1VPEA 2CLEB 1M7GA 3HJNA 4RTPA 4EY3A 1EB9A 1LSJA 2KI5A 4YDHB 3ORYA 5CB4A 5DYNA 4ISBA 2CYAA 5JS8A 1LGYA 3O8NA 4IQFA 3HJUA 1E2PA 5KJEA 4R40A 3IL2A 1DXYA 2AIRA 4P7FA 4S24A 5KREA 2QZZA 2Q5QA 4LJSA 3VNVA 4MS4A 1RI3A 3T3IA 3GDGA 1U0GA 2OHVA 1JKFA 3CW2A 2RHCA 2WUGA 2R6GA 4G5XA 2VJKA 3GCDA 3N2LA 4RSGA 5H82A 4GMDA 4EIWA 4KLCA 4NK4A 3SLKA 4ES6A 1KMQA 1DWPA 2HI0A 2XNSA 2GCPA 2HXGA 3PKJA 3WGKA 4DVJA 3IBSA 2H4YA 3ECCA 5IVDA 1YZKA 2JI6A 2NU6A 3MSXA 4AM8A 3T1HB 1VPWA 1YNSA 4LXXA 4AT1A 1Q7CA 1FW6A 2O5CA 2QGNA 3VAZA 1RABA 1VLLA 3TL3A 2OXCA 2ECQA 1PDWA 2GXSA 3IKJA 3UK2A 3CBGA 4I19A 4M0MA 3VNSA 1SZPA 1QFXA 4H1VA 2W4MA 4QT0A 1QQ6A 3RUPA 5AOCA 4M2LA 2AW5A 2C4UA 3EVEA 3RUHA 5I45A 2B1GA 1LPMA 2FZWA 1WEKA 1C9YA 1VTKA 2H1FA 3FTQA 3IEUA 5EJ6A 2PFKA 1RRPA 5F33A 2HREA 2ZJYA 3UWKA 4HNHA 4OHMA 1ZD9A 4H0CA 4DUZB 1X15A 1E79D 3ADOA 4NVRA 4HNTA 5CXSA 2EL7A 2NP7A 3FNHA 4ZA2A 4D3DA 1A96A 1M6NA 3H19A 4PX2A 5TT0A 3NJ8A 2J7PD 1SJ9A 4MI3A 3M1YA 1SIUA 4OHXA 3CZMA 2O8VA 3NS7A 1GL6A 1FMTA 4DR3B 4K6GA 3TRJA 1ZNQO 1SHUX 1T5HX 2DWOA 2GESA 3B3JA 1VRWA 2X9VA 4LXTA 1V5FA 4JB8A 5JNRA 2BM9A 3GA5A 3BAZA 1JEEA 2CGEA 1VQ1A 2ZB8A 3GLGA 5JJLA 1YV9A 1WXHA 2WKPA 1JXAA 3LZDA 2WNSA 4ER5A 1EJBA 5AI9A 2EARA 1TT5A 3W5UA 1O4VA 5IEBA 3WHIA 3EXHC 4M9SA 4CFYA 3EXHB 5B2FA 3MYYA 1RCFA 1XWIA 2PQ0A 3TCKA 3ES9A 4MQBA 1BVHA 4X7MA 4D9KA 4DSUA 3KPVA 3KXPA 1NBOA 3D43A 3G0CA 2RB4A 4M55A 2BGKA 3IOEA 1GQQA 3CEMA 3K9WA 2QP4A 3QWHA 4IG9A 1NXQA 1A9PA 1L5YA 1D04A 3F7NA 4B3MB 2XKKA 1EVQA 5MGNA 1Y9DA 1X80A 4J4TA 1DL5A 2C9BA 2PKWA 2UKDA 2YASA 4UHDA 3L7AA 2PMWB 1ZUNA 4O8ZA 4UHCA 3PHBE 4YACA 1N5KA 2X2EA 4ZT7A 1J2UA 3EY4A 4CM3A 2ZWAA 2VHQA 3BDIA 1XU4A 5F2NA 2JJYA 2VZ0A 1ISHA 3VR3A 1TGYA 4M8LA 2PIDA 3OT5A 1RWXA 1EIZA 3N2KB 4EYQA 1C4WA 4LX8A 4BUJA 1GLGA 2FMFA 3DZFA 5CMLA 4BRZA 4D79A 2REQB 3KU4A 4HXGA 1N2HA 2WYOA 1CUZA 5DNAA 4F5DA 5LP6F 4KXMA 4C7JA 2AQHA 4I6EA 2OGUA 3EXFB 3NBQA 2IQIA 4GYJA 3N5KA 2IYUA 3AZQA 2CXXA 2GNOA 5ETJA 2IV3A 4QYWA 4AF8A 4OGFA 1Q6YA 4OLJA 2XCUA 3D1LA 3D5QA 4AC9A 2JGEA 3VU1A 2HTEA 3IAXA 3U80A 1ML4A 3CNNA 1BD4A 1ZKMA 3K0BA 4CWAA 3QITA 2X4LA 4UTXA 4XQEA 2B99A 4Y1RB 4BJ3A 1QB8A 3G1WA 1X1RA 2I6GA 3DDCA 5CB4F 1SUEA 3LX5A 2WA1A 4KVFA 1BWQA 1YZGA 4BX0A 1ODLA 2DFVA 3NXSA 4XI9A 4DV4B 1P7YA 1K3UB 3FWHA 1KPGA 2IEIA 3I5MA 2BIFA 2V7PA 5CJJA 4G1UC 3V8BA 2BAGA 3I4CA 2EBFX 1BWSA 2PEYA 3C3XA 1UC9A 4HDSB 5LIRA 3PGA1 3QEKA 5CYGA 2X0KA 3PVSA 3C85A 2XIQA 1E2KA 3JQ9A 1AE1A 4GEGA 1IXKA 3W2EA 2C7PA 1VIDA 3NGXA 4YGXB 4TL6A 5EIBD 3E48A 1QJ4A 4BGIA 2OO5A 1QHNA 2IF0A 5FUYA 3TVDA 4E12A 3GEIA 4QDTA 2FOLA 4AFNA 1X94A 4HAIA 3UATA 1TPZA 1XRLA 2HCBA 1SVOA 2G83A 5ANRB 3SM9A 4JH0A 4F96A 2O2YA 4WX2B 1FFYA 5C4GB 1RI4A 4M0DA 1M2VB 1FSFA 5BNFA 3NAQA 4DCMA 2NO6A 3GLRA 3ADPA 5DULA 3KKPA 3UQYS 1DWUA 3VZDA 2VPQA 3TCNA 2R2AA 2JEOA 1L5OA 3OG9A 3ENKA 2XTZA 1A7AA 1BRMA 1NKTA 2JZNA 3I32A 1XZLA 4IYJA 1LRKA 4IIEA 2JHAA 3OT1B 3RASA 1EWVA 4J1TC 1NJGA 5A71A 1O89A 1O1YA 2WM2A 4Q4AA 1YS4A 2J32A 1OVGA 3ZX4A 1CERA 3K0AB 3UWMA 4O2BA 4ZCQA 1K5HA 1RM0A 1CUAA 4RA6B 1P2SA 4GPEA 1WVMA 2P9HA 4FLFA 4PZPA 4RMIA 5DYTA 4AS3A 2NP6A 2EQBA 1LRJA 2JGJA 3K7EA 4ZHSA 2IHZA 4AJEA 2YWCA 4XGIA 2VYCA 1SUIA 3A1TA 3QJGA 5KQSA 2KPOA 1R00A 1E3QA 2IODA 3AW9A 2Z8YM 4AUNA 1HI9A 3IPLA 1QX4A 4NJMB 5DZSA 1F12A 1U7UA 1JTVA 4I7EA 1JPVA 4YJ3F 4AKGA 4GVPA 5AVVA 4BC0A 1BG6A 1GUYA 1J8YF 2AI1A 3E1GA 3OETA 4JEUA 3Q2KA 4B6GA 4F4UA 2JAPA 4DA6A 1A27A 2PKXA 3GMIA 3NRCA 4EGQA 1XWWA 4TZ0A 1ZRMA 4GH5A 1JJBA 4Z6KA 1W36B 1W36C 1PL6A 4BCCA 3BQ9A 1IY2A 2YDYA 2ZRQA 4EBBA 1NAHA 3X3HA 5CG1A 1PNOA 3DZGA 4BZPA 1WCIA 4WVFA 1PWHA 2ID7A 1CRZA 3ZV5A 3ERCA 4HDCA 2ZCVA 4HH1A 4DJJA 2OQVA 1W5FA 2G1AA 3UJBA 1WCYA 1R4MA 3CE6A 3AM5A 3RRFA 4HQOA 4P83A 2QLBA 3H84A 4P5EA 2BFDA 1S9DA 1O2DA 1Z8NA 1DBPA 3F8WA 3LQ1A 2H2IA 5B1HA 1U2DA 5JYCA 2GM4A 4C7OA 4IIUA 3CKLA 4U7WA 3QUSA 4JP2A 5G53C 4MVJM 4WESA 3DMHA 2IYTA 5KSOA 2J4FA 3ZOKA 4WGFA 3N8IA 3GHYA 3QVGB 1B74A 1J23A 3MOGA 5DM0A 5AESA 1VXRA 3FAKA 1IAQA 4TTRA 2DR0A 4RLSA 3X1JA 3ZK9A 3O83A 3IDAA 3P71T 4D0NA 1TD9A 1UJMA 4DLSA 3PGMA 5LJLA 2BONA 3MAJA 3PDWA 2HO5A 3JQFC 3UICA 1N25A 1U6KA 2JAWA 1SU7A 3UXEA 3IKMB 1BO6A 4OXRA 3VPCA 2EKDA 5LOVB 3Q11A 1WUYA 1K9VF 3BRWA 3DZJA 5B3JA 5DX1A 4DBVO 4OQXA 1VCHA 5C7OO 4C7KA 1GITA 1L4UA 1SHZA 3UBMA 4BNLA 4EPXA 2JFFA 1GL9B 3BZWA 2XMGA 3HZHA 3DWFA 4YWHA 3WVNA 4AB1A 4BV8A 3BWVA 4FOOA 3ZVNA 1E0AA 3R5HA 4LC0A 1BXGA 2GM9A 4G5FA 4R0VA 5T4BA 2Q3DA 2CUTA 4HNGA 1NQTA 1L3BA 3ZK7A 3AL0C 5C37A 3B3AA 2BDUA 3LC7O 5ALDA 2X0FA 3GUCA 3PNMA 2RHBA 4UOQA 4I8DA 1LTKA 1VLHA 1TK3A 2IEGA 2QUBA 3B38A 3EAQA 3KUDA 3O0TA 3WO1A 3INGA 1TC2A 2WPDD 1U7OA 3H2IA 3L0PA 3O2SB 2KMLA 3AI7A 4R1UA 3JZFA 2DU8A 3G2MA 3LCJA 1MRSA 5ALXA 3SG0A 1ZH6A 2PJUA 4WT7A 1WKBA 1LUAA 4ND3A 3MMXA 1PTJA 4KIFA 3CNEA 1Z26A 4O4LB 2IIQA 5DGIA 4FZ5A 2JKVA 4O2BF 3TUZC 2C9ZA 3SR3A 5E1DA 4L4SA 1U31A 5EJFA 3AHGA 3IODA 3MTEA 4XEUA 3QQPA 3OTOB 3UT6A 5B30A 3EODA 4RGQA 4HL6A 1TQ2A 4N0MA 4Y9DA 2QTMA 3PUVA 2Y68A 2PSSA 3MNFA 3K5IA 1PG0A 2GX6A 4NABA 1XVVA 4C3ZA 1N2EA 1RLJA 1VIVA 2CNOA 1ADFA 2WD8A 3KB8A 3OQ6A 4P22A 2H7VA 4BKUA 1EK2A 4OXYA 3FKQA 4D0SA 2OXFA 2OFWA 3CVJA 1Q1BA 3RPEA 3RS4A 4ARZA 2Y0PA 2FVYA 4XB2A 4ERXA 1D03A 1I36A 5FTJA 1N36B 3AUUA 2YOHA 3H9CA 4I6JA 3BB4A 4LMRA 4PSAA 2X14A 1NUHA 2OZPA 3JYHA 3O7MA 5KX5B 1CYEA 2J6CA 3OCJA 2EP5A 5BMVA 2PN1A 5FI1B 1Q0HA 2HRZA 2H1IA 2ZRMA 4FCCA 1L6IA 1JF8A 1AQLA 3QWAA 1EA7A 4PBRA 1C8BA 4F5WA 4RCZA 1CRQA 3MCAA 2OLKA 2XOKD 2FGJA 1F60A 1O6BA 1T3TA 3VHQA 4CKEB 4LK2A 4C05A 1G2PA 2JFXA 2BRUC 2OCLA 3AMVA 1T9HA 2VTKA 4PZYA 1CUDA 5JMWA 1U7DA 2POCA 1ODKA 1WS6A 4GWGA 3BH0A 5TJ9A 1UPTA 1UMDA 2GEFA 3V2IA 5AHXA 1YJCA 3SFTA 2XAAA 1VIMA 2X15A 3RVNA 3WMEA 4KO3S 1SUAA 4LOJA 5IW8A 3QI2A 2IYZA 2DTDA 1QO7A 5KWVA 1W4BA 4IVPA 3L3BA 3A10A 3FYCA 1XCJA 5IJXA 3VPXA 3D8UA 3RU9A 3FJYA 5DSZA 4CIAA 2HHHB 1P2VA 1QTNA 5KJ1A 2ZT5A 3QF4A 5F1YA 3IQFA 3LHKA 1ODTC 3QELA 4RELA 2X13A 5JVDF 2FUKA 1JALA 1WMDA 3CG0A 1L5GB 3IVRA 4FMCF 1JJFA 2FMHA 4KJZA 1IUKA 2A9FA 2E48A 3FMPB 4XYMA 1JH9A 2AE2A 4C4ZA 1H9CA 2FDRA 1QRRA 4NYJR 5FUVA 1JDSA 3RI3A 4BP8A 4D9FA 2C2XA 4XVCA 1CJCA 1JU9A 4MS1A 1XHFA 2LKDA 2Q5HA 1S4QA 1GA6A 1TFUA 3R7SA 5MN5A 2ODTX 3BGVA 2R1TB 5C1OA 3KAPA 2Y0EA 4RJJA 1XLUA 4XWKA 4XR4A 1E3WA 5EP1A 5JXIA 1GUDA 3FOCA 4RWZA 4UU8A 1CR6A 3JARA 4MLDA 4DLPA 3BXGA 4DTCA 2WWGA 1KIMA 1PVDA 1S89A 3AVTA 3I30X 3BJIC 1GPDG 3QKRB 1RLOA 1ZK2A 3EA5A 3OA2A 3B53X 4TSRA 2G06A 1ZR4A 2N9UA 2NTJA 4CT0A 2G4LA 4AZSA 1RYZA 1NTOA 2YOFA 1A8IA 5DN6A 1QB7A 2H2FA 5L45A 4LVOA 4WK2B 3QEOA 4GKAA 4WL0A 1C29B 2C9MA 4BO9A 2UDPA 1KEUA 2XWBF 1U0NA 2XGSA 3GIDA 2WUFA 1B6GA 4G1VA 4HH4A 1UDCA 3FYUA 3NM4A 3DVAA 4K81B 1JQ3A 2NV2B 3HCCA 3OFND 3BWYA 3KXLA 4ZMBA 1WJGA 1MGOA 4D9EA 1YVEI 1XP5A 2CF5A 4YRKA 4NULA 1S96A 3ETGA 4YEDA 4YT4A 2P6OA 1U8ZA 4E22A 3QU4A 3WLJA 4AF6A 2QS9A 1QFZA 1S0UA 2ZTSA 2ZWMA 3EASA 4GOJA 2YX1A 2G80A 2IX9A 5B6PA 1WU8A 4ZVLA 3THSA 4MJ3A 5FUQA 1U0JA 1M0WA 2QM3A 4P3KA 2XNJA 3PFBA 4QGHA 3TLCA 1G3MA 1KY2A 1HO3A 4QFBA 1U3UA 1AHPA 3HWRA 4KUEA 2AD5A 2Z57A 1XLVA 4ZDJA 2WJWA 2B8EA 2XB4A 4K9RA 4Y7CA 2WWXA 2XODA 3A1CA 1IMJA 3G2LA 3VR6D 4EB6B 3BMQB 4EHFA 2PSHA 5KYYB 3GFQA 3ZH9B 4BHTA 3O2QB 3VR5D 3GEPA 2XECA 1FFXB 2CY0A 4Y6QA 3EIOA 5DOVA 4ND4A 1I7QB 1A8PA 4C2UA 2FUG1 1GGFA 4XWYA 4EFNA 2ZIEA 1W4CA 2HEIA 5KCMA 1DUIA 2IK8A 1A9TA 5DCUA 5FI0B 1CR2A 2NO4A 2OFPA 1E3DA 3DD1A 2PH5A 1FQWA 3LNTA 4J49A 3SF0A 4AICA 3VKHA 4YT8A 2Q2QA 1WB4A 3B3FA 2VBFA 3NATA 2CL0X 1YBVA 3MM4A 1H2FA 4KQWA 4L6IA 4Q3AA 2LCQA 1I4DD 2MMCA 3H05A 3MPOA 4LZWA 1OJLA 1K08A 1DAGA 4MAAA 2C2YA 4RF4A 1EAYA 2GK4A 5G0UA 2E5LB 1NJ8A 2V5AA 5FUWA 1KOGA 4ZVMA 2QGZA 1WB9A 3V1YA 2H1WA 3DB1A 1SCDA 2C04A 3QVXA 1PT6A 3KSAC 2BSXA 3GI1A 1RI2A 3ZVLA 4MKFA 4BJ5A 3FYSA 1TM1E 3CLHA 4FFSA 2ZT7A 3LAWA 3FMFA 4TWRA 4GRIA 4DT1B 1A3CA 5JQGA 4UDNA 3TSZA 3UT5B 3Q98A 2HOQA 3DOJA 5JCOC 3RSCA 3N70A 2Z1NA 3EVDA 3PIIA 4Q5IA 1O96A 4IKOA 4AJPA 3O8DA 2BE9A 4L8VA 4NLLA 5DHUA 3A1WA 4BVEA 5C52B 4FE7A 3E5MA 3IURA 1IY9A 4UE6A 2HD4A 4DNPA 1F2DA 2JIQA 2P4EA 2PO7A 2YUIA 3SJ7A 5KJCA 2ZSHA 1J97A 2E5WA 3DE7X 3LQKA 1LFDB 1U2GA 2YBEA 1B8VA 3UAWA 4TYYA 2I80A 3U4HA 1J5XA 4XGRA 1KJYA 3B52X 5I7AA 3RV4A 3N0WA 4F4CA 2FRDA 1TEHA 3LUFA 5M04A 2IUFA 2OXIA 2PS0A 1ZGCA 3STUA 5HX7A 2Q6IA 4NFSA 2RH5A 2CNBA 1W5EA 4NS1A 3RBAA 3G7UA 2FUG6 5J2TB 1K63A 3K73O 3H5NA 2OYRA 4WV3A 1CQIA 3R23A 3ZU2A 4HHEA 4GI2A 4MRNA 4L73A 1EBUA 4JROA 3TLGA 5C1BA 2I8CA 1CZUA 1JLLA 1Q17A 5H80A 1CQXA 4WNIA 4HS4A 3FCUB 4CMGA 1RTTA 1UJBA 1XR3A 3QU9A 4TLAA 1MW9X 4UUOA 1PHRA 1BFUA 3F2VA 1PD1A 3MEQA 4V0KA 5A3RA 3ICPA 4X7RA 1H5UA 1DBIA 2BZ1A 2R7MA 2XZPA 4HNUA 3PX7A 4UTPA 5BR7A 3HKEA 2XUOA 3UN1A 2QJRA 4JJGA 1WUTA 2EF0A 4E5KA 3U61B 4QGSA 3V8RA 1GHTA 3GFFA 1MO4A 1PJSA 5IUJC 3H75A 3FIJA 4MMYB 2OBBA 3K6RA 2V4MA 1E2HA 2XUJA 3KAQA 4FDAA 3ZNNA 2FFAA 4RDHA 1RHKA 2HIHA 3PDJA 3KXDA 3PICA 2O3JA 3QXJA 3A6HA 1E20A 3N8HA 3OAAA 1IZ0A 1Q3TA 5HQTA 1JA1A 1L4NA 2HHCA 4K88A 2OV8A 2AZ4A 4JODA 4RV4A 3I9KA 2RKWA 5IAOA 4MAMA 4C4OA 3G0DA 2BTQB 5HE9A 1U0SY 1NUUA 5JY6A 2IH4A 4RHEA 3SMVA 1PEYA 5CEFA 5L51A 1Q57A 3L01A 5F4BA 5B7GA 4HDMA 2PWBA 4O08A 2XMQA 4O1IA 4MKHA 4RK1A 3GEDA 5FOTA 4G37A 2J31A 1W88B 4RKQA 5A3SA 4KXYA 4JLAA 1D5CA 4JI4B 4Y2XA 3UHAA 2XCRB 3AHHA 2H4WA 4R84A 1QF6A 2G4VA 1E2NA 3KXKA 1CZLA 2P0AA 2WZDA 3E2MA 4QRHA 1J8QA 4DAEA 2YXPX 4AS2A 2V0NA 4NS4A 3RYHA 4W1RA 1PK8A 1VDMA 1Z39A 2A1TS 4IG4A 5CAEA 1Q3HA 1TQ4A 3IUNA 2WHXA 1YMUA 2WMDA 3O4GA 4PG4A 2XUGA 5AOAA 4LFBB 4PAOA 5IKMA 2ZXEA 4B31A 3TI7A 1EK0A 3CCBA 3D9QX 5EVCA 3PEEA 5L4NA 2C9OA 2CXHA 2W83A 4LSMA 4HZUB 1U65A 3O31A 4IICA 5DBEX 5CA1B 3ESXA 3M6XA 1RBYA 2IHVA 2FP4A 2VF7A 1CR4A 1Z4LA 1PI3A 1ZN7A 2GCGA 1R0BA 1KI6B 2O3RA 3ETLA 1J2RA 3HXLA 5D3KA 4EFMA 4F3CA 4ZGWA 4ZC1A 4CM4B 4F06A 2F43B 1D7AA 3T5TA 4POAA 2F4VB 2MT9A 1HORA 2EX4A 4P58A 3VNUA 5LZ5A 4PPNA 3DC7A 4Q39A 2XGGA 2NQ8A 2MU1A 2BE7A 4IDDA 4HOYA 1JG7A 4TL8A 3EY9A 3ZDZB 4BLOA 1AKVA 1N2CA 3NZEA 5FNZA 3BMNA 2HYIC 5EP2A 1IOVA 1RWOA 3N7TA 1RHRA 3HBMA 2ZOSA 3L4SO 4NYMQ 5A4FS 3RD5A 4CIBA 1RACA 2XMDA 1XNGA 3O0DA 4ZN6A 5HKLA 1P7VA 3SI7A 1QQ7A 3FOAA 3AIKA 1BFDA 1GTZA 3KKQA 4LZPA 1QGUA 3V80A 1TMOA 4D9MA 5IKXA 4U63A 3VDQA 2YC4C 3C4VA 4NYJQ 3G8AA 5JS1A 4HH0A 1NT4A 2RK3A 2SBTA 4K9KA 3M4JA 3W78A 7AT1A 4K87A 1G8PA 4K3VA 1D4FA 1YI1A 2ASEA 1VG0B 1IPFA 1T1EA 1IEXA 2FPIA 3DXZA 3GH3A 4OU5A 4II7A 4MWSA 4Q7JB 1S2NA 3E15A 5SY9A 3E2PA 5ISMA 1CQWA 1G8MA 1M6EX 3EHEA 4NE2A 2I7VA 1KEEB 2EZUA 3GLHA 3FPBA 4XCXA 3NNNA 3FM9A 3NCHA 3RYIA 5IK2A 1Q7BA 4QJ4A 4YR7A 4I5FA 5AW0A 3MVEA 1CUYA 3NAZA 2YZNA 3UOWA 5L6MB 5AJWA 4J0QA 3O75A 2BCEA 4UBJA 2ERYA 4PC7A 2EJBA 1PL8A 2FMXA 2IXBA 4GQBA 3KOXA 1E3SA 3DMTC 3KKOA 3TRKA 3LO5A 2PUEA 3HYRA 4GKJB 1ZN8A 4KUGA 3S8YA 3GPLA 2H52A 1QH8A 3GEGA 3K6SB 4JI6B 2AC4A 4LNUA 3ANMA 1PQPA 2PKYX 2V65A 2Q1YA 2EKPA 4NV3A 4QOIA 4OI0A 2VYQA 4KQFA 3IRVA 4C76A 4JXJA 1HSOA 3J7AC 1U2TA 1Y33E 3I2GA 3KSZO 4ZAYA 1XTQA 2PCLA 1DEOA 2VPTA 1JBEA 1YL7A 1F7VA 3PGVA 4D0RA 1N6NA 2C2KA 3JQCA 4KXFB 4AUEA 1II8B 2EOAA 2VS1A 8ADHA 1YS6A 1UBOS 1U3FA 4RIFA 1KH3A 2W6ID 1K66A 1KK2A 2BFEA 2TRSB 3W8FA 2VIIA 1KMNA 4WNAA 1CSEE 4C0BA 4B74A 5A6SB 1QORA 2ZFUA 3DLCA 1XI2A 2X5OA 2G72A 2ZRGA 1Q12A 5BW6B 4W6QA 1PQYA 5F1OA 1T8TA 1F1BA 3AR6A 3HSYA 3IMGA 5BYAA 2QWXA 4AZWA 3C97A 2H1LA 4KK3A 4AJLA 5BSHA 4L8LA 4JL8A 5FFMA 1Z0UA 4D3FA 3QTLA 3QJ5A 4PTYA 1LKZA 1YJQA 3BIFA 3D8BA 3EG5A 4HTAA 5FPKA 2IL1A 4DLWA 3EUWA 4B3FX 3GJQA 5BV2P 3HKBA 3JX9A 3EC1A 4D4HA 1VPTA 5IT5A 3SJCA 2IZOA 4P7BA 4UU0A 4E14A 4LJ4A 3AVWA 3SIWA 3PQ6A 3R7NA 3TZEA 2V4UA 3IQEA 2G9VA 4NDZA 1U9YA 4JQZA 5JTTA 3F5FA 5T8KA 3U3RA 2NXJA 4GKVA 1NF2A 3R20A 4RV9A 1QO9A 2GRAA 4TMFA 4K9QA 3S2GA 1TXGA 3MCZA 1G8SA 2J48A 2C5AA 2IE0A 2VJOA 3OZAA 2ZRDA 4K6OA 3RVRA 2OQRA 4JIMA 4BNYA 4ZIRB 3CZCA 3I1IA 4FOPA 4I0WB 3ZWXA 1I3CA 3T06B 2X2FA 1PGOA 3E3MA 5K8JB 4Z7OB 4CIXA 3FMOB 2Z5VA 3U9TA 3WXBA 3ONFA 1F48A 4MYCA 2XD4A 2XEXA 1DAPA 4I2VA 4YUXA 5B5SA 4RGVA 5EIHA 4PYKA 4KPGA 4JQCA 2HIGA 3M8KA 3RRJA 2Q5IA 3C7CB 5K6AC 1RLUA 2GBCA 2J30A 4BJ6A 3DULA 1H3NA 1BWRA 4BVJA 3CW9A 1UQUA 4KSBA 1DT3A 1RE0A 1VM6A 3D7LA 3E9DA 3KKZA 4LQ4A 4R51A 3PQDA 3RH0A 2VHTA 2FF7A 2NYAA 3AEKB 4J0KA 2ZTHA 1B6SA 4GMXA 5C1PA 3D6MA 3R6GA 2HCTA 4I55F 5FBKA 5BSGA 4MX8A 4QYSA 2BF7A 5FEUA 4I50A 1ZJYA 4R7TA 2ARKA 4UD2A 3LCCA 1OX6A 1OILA 2HJWA 1FUYB 1SMKA 2OWDA 2Q46A 3RFFA 3WQQA 2A5GA 3OX2A 4QDZA 5DSTA 1GYQA 2HUPA 3FPJA 3ZV3A 3GXOA 3Q9LA 4IAOA 2V8BA 3DAYA 1FTGA 1KZYC 2QUIA 3I0MA 4OFWA 4Q48A 4LJ6A 1E9DA 2VRWA 2WV7A 4KVZA 2CFRA 3GCWA 3DHEA 1JU3A 1T9ZA 1TQ8A 1Y89A 4R69A 4DAOA 4TUYA 3IVGA 4B4DA 5L7TA 1U0RA 2C1EA 3DYVA 4U2DA 4A8JA 4C6SA 2J87A 1Q15A 3JAWA 5J1TB 3THOA 1U8EA 1RXCA 2ZRCA 5BSFA 1X0XA 4Z3KA 1H3EA 2OE2A 4HN9A 4DV7B 1KDYA 1YR1A 3HSSA 1FVOA 3OPNA 1SIBE 1IOZA 1N0IA 4LQDA 1MLDA 2O8CB 4GR9A 4OBWA 4YRRA 1Z4OA 3FAZA 2I7CA 4LVUA 3ELUA 5DSXA 5WRFA 1ANKA 1XZBA 4IHQA 2XYHA 2ZRNA 3PENA 3RT1A 2AV6A 2W2LD 3O4JA 4OHWA 1SXGA 4NBWA 3ZJVA 3HCOA 3CLRD 3TLAA 1XMVA 5FOWA 1MABB 4RADA 3RK1A 1VGRA 1EUDA 3WLSA 4EO7A 3LQ4A 1VG8A 3PRYA 5FL7D 3QSGA 5BWCA 1R0LA 1L0BA 1ZXXA 2WFLB 3R5SA 1YRBA 4KFTA 4ZOEA 5AXBA 4A23A 5JNVA 5DNVA 4UQOA 2IP4A 1WSAA 1AS3A 2I6FA 3LRTA 5AK5A 3S0JA 3GD5A 1KFEB 3G68A 2WWHA 1U0OC 5GVSA 4EA7A 2YXLA 1XLTA 4P4GA 2KE5A 2GCNA 4H1TA 3QEMA 4TV9F 3ROQA 3WNQA 1OGJA 1SKBA 1Y1RA 2HB6A 2M6RA 2WU8A 3HQ4O 3UUWA 1AZLA 4BLWA 5B55A 2CSXA 1ZQ1A 3CH4B 1KU0A 2C5GA 2QRVA 2YZKA 2QX6A 2Y93A 1N1EA 3L8MA 4HRYA 1AMNA 3GJTA 2ZKIA 1IWOA 3L77A 3RU3A 2F1JA 1OLSB 5EYPB 2FPOA 1A9OA 1TM7E 2E82A 4LV6A 1XTPA 1RWKA 2D00A 4EUSA 2GJ4A 3FIUA 3KUKA 3DZ8A 1JDTA 2BYTA 3OC0A 1DOAA 3SNKA 3FRJA 3PP8A 1EFCA 2ACKA 4A3SA 4WLUA 5J5AA 3Q6IA 3EPPA 3K15A 4UEJA 6REQA 2OYSA 1XVAA 3CJQA 4GMKA 2PMFA 4R1SA 5KC8A 2Q21A 4D96A 4RZQA 2NXCA 4BJHB 1NW7A 3QMPA 1WNFA 3BRCA 4PRLA 3AL3A 4LECA 1W0JD 3IIJA 5EZYA 1AO3A 2RHHA 1V25A 1C30A 3I8OA 5FI5A 1WKCA 3M49A 1D1QA 1P77A 1GFSA 1P6QA 3FB1A 2E7ZA 2JGRA 3LCUA 4AI6A 3Q41A 4WCVA 1L5QA 5JG7A 5HF8A 3NONA 4KPYA 1UFVA 4B6EA 2MSWA 2BMDA 5T57A 2K4MA 2JDIA 3C1OA 3T3MB 2YWXA 3CA8A 2WBLC 2YJ5A 4GRAA 4YCMA 1HRKA 1NQOA 3NHBA 3OO0A 3PXCX 1NULA 3FBTA 2JEYA 1MGPA 4RVHA 3WYBA 3AVOA 1KI7A 3ZZNA 2X42A 2YVUA 5BUZA 4Q4DA 2ONJA 5J63A 2YY7A 3L7OA 4QBKA 1DPFA 4BGDA 2WZBA 5DT2A 1DC4A 3FI9A 4ML3A 4CMIA 4DREA 1Z3IX 3FN4A 4MTLA 5JNWA 4KIGA 1IK4A 1A95A 2FPPA 3ITNA 4R8MA 1WF3A 3KAKA 4RTJA 3TK1A 1JEQA 4X94A 1KI8A 1YWGO 5JAHA 4INJA 2XMPA 3O93A 3QWBA 3FFAA 4N4AA 2OB2A 3SYMA 3F3MA 3W9UA 5IULC 5IXJA 4LY3A 4BQIA 4QPDA 4JFAA 4EECA 4ZDWA 3M34A 1Y6QA 2YFKA 3QF7A 5BSVA 1GRCA 1P2BA 5DDIP 1C0IA 1L5VA 5LUAA 3JAMA 3TIFA 4GLJA 2HNBA 2PKQO 4KGXA 5COBA 3WP1B 4QJ3A 3K09A 4K86A 4YP1A 9GPBA 3O2NA 4OGWA 5FORA 2ZJOA 1UFKA 3CF0A 2R0QC 5KNBA 1ZD5A 1XHLA 4CKCB 1IBLB 5AVWA 2WSSA 1BCSA 1U28A 1EM8B 3THRA 3CYFA 1HRDA 2KB0A 2NV6A 2FZVA 4ZT5A 1NYRA 1OY1A 3H3FA 3HGMA 4L85A 1J24A 2AE1A 4MJLA 4TTJA 4X84A 3UFBA 4NI5A 3OOEA 1ORDA 1W48A 3MAGA 4CF3A 4E5VA 4ZAWA 2FMKA 5SYMA 4CBVA 1L5ZA 1WDWB 4X1IA 2CLOB 4XLTA 4ZYZA 4DW8A 5CDYA 2YVLA 2HWUA 4LWZA 2WDZA 4G5GA 4M38A 3OCCA 3L1KA 2OPBA 4M9RA 1EKXA 4K9NA 4B47A 2GJSA 4AN4A 3PHLA 4YV0A 2CDNA 3SC6A 2BKLA 2ZSBA 5DVZA 3I9NA 4WNCA 5FNVF 3GQVA 3L93A 3ZLJA 1FMJA 1Y98A 3UO8B 3DS8A 5DLYA 4E4RA 4RY9A 1A2KC 1WKVA 5HJ7A 4DM3A 1DHRA 1NLYA 1OFTA 2O06A 3A0UA 3KT0A 1TYEB 5BSRA 5EJ7A 1G4AE 5DFAA 4FN5A 1UODA 4HWTA 1BVRA 1P7ZA 2R6DA 4R8KA 2ZYHA 4TQAA 5EUCA 1XD8A 1UT5A 1OXSC 2C83A 2ONCA 3E7WA 4W7IA 1ECLA 3OOJA 4BFYA 4BE7B 5KNLA 2GJAA 3CNBA 2VZLA 3EGWA 3R0VA 4K8RB 1RM5A 5KAMA 4UUQA 5HZMA 2B8NA 4JLWA 2DZDA 4UBOA 3PWKA 4YMLA 2ZSDA 2OYCA 1A72A 4NCJA 3AVVA 3G02A 2FLVA 3RSZA 4DY6A 1Q21A 2R7AA 1P62B 2VFAA 3VOAA 1R6DA 3R0IA 1U4NA 3TTVA 3K94A 3ZE8A 3BXZA 3CO0S 5BYKA 1G41A 2X2PA 4JQOA 2NVOA 5CVCA 3AV3A 1PSDA 4C4RA 5DH9A 2VLIA 1YA6A 4ZZ0A 3CLTC 3ETNA 4RORA 1RWNA 4N3AA 1AN0A 4DJ5X 3UPUA 4W9RA 3WYAA 1RLTA 2VK2A 4YJHB 1DOHA 5DBGA 5JPDA 3RYFB 4CKBA 3SWWA 4W1PA 1R6VA 4FHGA 3AR4A 1P3Y1 4DDWA 5JD4A 1AF4A 3BF8A 3SX4A 3H4MA 3CU5A 3WK8A 4ID9A 5JRJA 4YRDA 3A27A 4BJ1A 3T94A 4OSOA 4YJFA 1F4PA 3IPAA 2O8FA 3GCXA 3HY3A 4MW5A 1MT3A 3E0QA 1V8ZA 2J9ZB 3FKSA 3L1IA 2XIJA 1OZHA 4RDXA 4PPFA 1Z22A 4GNRA 1D2AA 1H22A 6Q21A 5MDHA 1FW8A 1GPBA 3S2ZA 3KTOA 1M7HA 3PWSA 5AW9A 1GNLA 3GPBA 3LV8A 4EJSA 2ZUEA 2VP0A 2ZSKA 4JU8A 2BFAA 2E6KA 2Q3CA 3QOWA 3VR1A 4MAFA 3MJFA 3ULKA 2FXIA 1C0PA 3F78A 3VU8A 4RSRA 3ZWKA 2UZ4A 1EX9A 4V1CI 2X0JA 3CTPA 3ROPA 4KW7A 2VDPB 2CJYA 1B8NA 1ACJA 2O3TA 2B4RO 3AFOA 3FPKA 4L9RA 4LV8B 3W5IA 4YJGB 3SXUB 3ZW7A 1JQAA 1ZWLA 5HZGA 4RVDA 3PD7A 2HPAA 4JBXA 4NBLA 2ZR8A 5JZOA 4Q7EA 4YNBA 1I2DA 1DADA 3KJGA 1EUQA 1N0WA 3DFKA 1RLIA 4IH1A 4JJ7A 4QBIA 4JLJA 3SSAA 1UH5A 4PSKA 3Q85A 5AI4A 3FOBA 1G8AA 4CMEA 1EM6A 4FQ5A 1Z6PA 3U3MA 3ZHVA 3K0SA 5I4BA 3UVEA 5K4AA 4HBGA 5CPFA 3KRTA 4K6FA 1T6YA 5TMEA 2JK1A 4CE6A 4BAUA 1JNYA 1I5EA 2HV9A 2Z9CA 1EFVA 2XEDA 4OLHA 4HJRA 3L4KA 4XWOA 1OIVA 2JFUA 4EG3A 3UXHA 4IX9A 4GT1A 5JXGA 4H77A 1M1NA 2Q5EA 3N9IA 9LDBA 1FJXA 4WERA 2EHJA 1XX6A 2V3WA 1IIBA 1COWA 1L5RA 1N9ZA 5BW5A 4CFSA 4AUMA 1N3IA 4HDRB 2WHEA 5LZ8A 2IHTA 3QTBA 5B58T 3M4NA 5ALEA 3SDSA 3W79A 3DBLB 3CURA 1DWOA 4UUBA 1T3HA 4O0MA 4B82A 2Q29A 4Y2VA 4ZCSA 2VKTA 1C1DA 4K2HA 2DX7A 5BSMA 5ES4B 5ED4A 3V33A 2VJMB 4ZJPA 1T0JB 5GJBA 4QUGA 2W6JD 3IT3A 3ZUPA 1P75A 2ZPUA 3MFQA 3Q9UA 4QYIA 4N65A 3FLAA 2ZREA 4QU9A 5TV2A 3RRNA 2J0UA 3GEBA 3NAGA 3D2LA 2B7BA 3HHEA 1Q1QA 2C0CA 2ZSFA 4H3VA 2G9QA 4TXNA 4B3XA 3WQHA 2WHYA 5TE9A 4R9SA 3GELA 5C2JB 5HRCA 2QORA 2ZR9A 2IPAB 3AERA 2VUUA 4AQYB 1ZPDA 3T9BA 5KKCA 3BMCA 2CBGA 5K0GA 2B5WA 3RVPA 1SK8A 4OYRA 3U1BA 1JEAA 2OR3A 4X3OA 1C80A 2IEAA 4FINA 3ZPXA 2R25B 1JZQA 1MMFB 3LHDA 1QK3A 3DDHA 5HILA 4RAOA 4LGYA 1XALA 2QYHA 4MB0A 4DCUA 2ZZNA 3UGJA 1D9XA 3DEIA 1VIAA 1CE8B 1Z16A 4BO1A 5KQPA 3A6ZA 3G8BA 5DM1A 5AW6A 4B43A 3OFSA 4JAVC 3TIVA 3GJYA 5A5EA 4MPTA 4QDKA 1GR0A 2IHJA 3IKTA 3K31A 2YINC 3LY9A 3NU1A 2HA7A 4HLUC 4B85A 4NCBA 1UK7A 3AESA 5LZ4A 4NYIR 3T1VA 1VE6A 2E4UA 5K0BA 4HWKA 4O3FA 3W6ZA 3DFMA 2O4UX 1VL0A 3KWMA 3BD9A 4A36A 3ZHBA 2NZWA 2BMFA 4RANA 4MDEA 4BDTA 4GBJA 2XQGA 3Q3IA 3AEUB 2RHGB 2DFTA 4O2RA 2JGDB 5CNMA 3RSGA 4X71A 4FYPA 2BFFA 1FPQA 2UXBB 3B5IA 2CSUA 3B9QA 3LHIA 3Q2IA 4JC5A 3C8DA 4BLRA 4M0KA 2QUJA 1TKRA 3LP5A 1C7QA 1SOVA 2DUNA 5AVRA 4BLPA 5ELXA 1A7UA 4ACBA 2O1SA 2SCUA 1VXOA 2P2ZA 4I4CA 4RL6A 4JEHA 5SZIA 1P29A 1OCEA 4G01B 1L7RA 1A9RA 5FA6A 2EF1A 4IEIA 1JILA 3CLUC 4PZ9A 2AYXA 4TVBA 1JYEA 3JD0A 1IXYA 2W2NA 3EOZA 3KQVA 2PUBA 3ORSA 3PI7A 3R40A 3ZU6A 5J1SB 2PXAA 3CEJA 1NUSA 4Y2PA 5LYYA 4AJ1A 2AF4C 5H4GA 1NMYA 4TZKA 1JKJB 5K45A 3PKZA 2QRJA 4MRVA 5LM3A 3U1TA 1WXFA 3WRXC 1G2QA 4RWEA 1S02A 3WNVA 3ZVRA 2HW8A 1RMQA 2ZIFA 3P2YA 4RNCA 2AA3A 4L57A 3MCUA 3VI4B 4DTIA 2P9EA 3RUIA 4Z1MD 1JT9A 1EVLA 2QT9A 1ZH0A 2W2XA 2WSLA 4JZYA 3RV3A 3ZTWA 2E1PA 4J94A 4BWGA 5BPHA 1DC6A 4LEIA 1PTKA 4PC3A 5CHEA 2YXNA 1DAEA 1GZ4A 4MGYR 5AUNB 4HPXB 1QIFA 2Q07A 1A76A 3CRVA 1Y1QA 1U0EA 1E9FA 3KE8A 4GPBA 2W2PA 1EWRA 1BN7A 4XOIA 3RT7A 1QH1B 2FFBA 4ATNA 4AXXA 1Z5WA 1JFFB 2GMWA 4YHHB 4AJ2A 3R9IA 1YBMA 3AI3A 3QIAA 3H9EO 1Y8AA 3K1AA 3ZE0B 5ADHA 1HQCA 2PK3A 1NSTA 5B53A 4XD7A 5AVOA 4A0GA 3VR4D 5JANA 2ZYRA 2DUMA 4L15A 4D6YA 4DE5A 2VUTA 1R66A 1NI4A 4Q05A 3IQXA 1N5RA 1JIXA 2IP1A 3PXEA 5C1DA 1NPYA 2IIBA 3JPWA 2Q1XA 3JVVA 3IVAA 4ZWNA 3SDBA 4N6OA 1WETA 1SKYB 1LSUA 5JWOA 2ORIA 3IBFA 3NASA 1HOTA 2A9QA 1PJZA 2MR5A 1RQ2A 2VJDA 4HWSA 4UM7A 1V43A 4XQGA 4RJ2A 3FWYA 3JR7A 2K7FA 1UAYA 2E5FA 5FBRB 5HK8A 3RLIA 2OV1A 3RIXA 5HGXA 1YA4A 2VCEA 1B3RA 3C0KA 1ADCA 5BQ3A 1MO3A 4Q4HB 4U2EA 1PKEA 2O7RA 3GWGA 1HNNA 2CHEA 3KZ1E 3E9QA 1OOEA 1U7ZA 2FWNA 3TQHA 4YJKA 1Q2UA 4GRDA 4AG3A 3PC8A 3REOA 4URYR 4U0JA 2Q6TA 3IAAA 2BN4A 3Q7TA 5ERXA 1C9JA 3QYFA 1U04A 4EL0A 4PNZA 4D8YA 1AY0A 3BVPA 2UYGA 3L49A 2DH5A 4Y1GA 2JGFA 3RAEC 4REQA 1OX4A 2VAVA 4ZCLA 3CZ5A 4F1KA 3WG9A 4HDSA 3B1ZA 3UTCA 3VDMA 2FSGA 4Z4CA 1IN4A 1DC3A 3ROZA 1PJLA 3KG2A 1M0TA 2VXOA 4XTRA 4BQEA 3ZOZA 4F84A 4TKVA 2MDTA 2Z8XA 3ZR4B 1DTWB 1S7GA 4ED9A 3ND9A 3A4TA 1NMEA 4RQBA 1EA5A 3QH4A 2PBFA 2O2XA 2PKEA 5HUHA 2D3WA 2WUDA 1PYGA 1UMCA 4LG1A 5LD2C 1P7CA 3QV1A 4TT3D 2CJFA 1M8PA 1T35A 2XUFA 2QTTA 2YCLA 1EWTA 3PDCA 2BBOA 3C3AA 2DHRA 4ZGGA 5CJ2A 5JMOA 3D1JA 2YNMD 1NJFA 4NJEB 2DLNA 2ZBFA 3C3PA 2GF2A 1Q7GA 3KJZA 1RLMA 1TADA 3Q12A 4RPJA 3CH6A 1Q50A 4HCJA 1IHPA 3NVDA 4C9BA 5LXTA 2DPYA 1OKKD 2F8LA 3LY8A 4ZQCB 2DB3A 1M67A 3T3PB 3KQYA 3K6KA 2RB5A 3ONDA 3TAUA 2C9DA 2JFWA 2FPRA 4M6WA 1U2ZA 4IRMA 2AFHE 2J5XA 1PDOA 3H0CA 3DL2A 3AB3A 3LP6A 2G5TA 4Z0TA 2IOQA 5ULLA 2VRCA 1CS0A 2WJ3A 3BL8A 3NKFA 4KQ9A 4QXAA 1YE5A 3TOCA 5IYZA 1TX4B 1W5SA 1Y8ZA 2C31A 1Q0QA 2Q4RA 4JLPA 4M37A 4W4TA 3GUHA 1YS2X 4HTFA 1FTWA 5HNKA 2BDTA 3DDWA 4NCXA 4M1QA 2AYZA 4PTLA 5BR8B 2ZSUA 3HB1A 1ATIA 3F5MA 5G02A 3SC3A 4AQ7A 2ZBDA 2XNHA 3QY9A 4BO6A 3NP7A 5JFTA 2HCFA 4G23A 2GM5A 2CFCA 4PVCA 1NM5C 3PIRA 2LWIA 4WY8A 3V8VA 2E55A 1PR9A 1SZDA 1X8JA 2XKAA 3G5TA 4GI5A 5J2UF 4U7JA 3OTGA 3SVLA 1GZ3A 1JW9B 3NALA 2EZTA 1PV4A 2C5BA 2X1MA 1IRIA 1U11A 1Y3BE 2XMZA 3DDUA 1OYYA 1JDPA 2IS6A 5C5EA 3N8KA 4AURA 1W85A 2DWPA 2GZAA 2O6LA 1Z62A 3A70A 1ZH8A 3OOHA 2Y6VA 3ZW8A 1V7PC 4FNAA 4HAWA 1AKRA 3DL0A 3HB5X 2AWNA 5EMKA 2A59A 4JLBA 4ND8A 3R5JA 4KDCA 1GIAA 4RFLA 4WCFC 4WCFB 4Y2HA 3WQBA 5JYBA 3BYZA 3G7NA 2EJWA 1JLHA 5IH7A 2W37A 1V3TA 3H7IA 2W6MA 2ZYUX 4GI1A 3ASVA 1YO6A 3CR7A 3DBIA 2DH6A 3I42A 1ZW6A 2FJUA 3OKFA 3WA6A 5CBKA 1ZK3A 4EHAA 5ICSA 3SE0A 4MGEA 5CDFE 3ZE2B 4HNQA 1C1XA 2EZ4A 3C39A 3LC1O 2DPMA 2A9RA 1NRXA 5CM8B 2QLTA 3E22B 3JQ8A 3KZKA 4TXHA 2V7XA 1ZNZA 4TTTS 3QPWA 2C97A 3RSHA 2ZI9A 3OLVA 4MKGA 4WN9A 1E61A 2OGTA 2ZG6A 3FCYA 3UY4A 4MUJA 4ZTUB 1XCGB 3CRW1 3OHPA 4BGEA 3NEJA 3A1SA 3OURA 3AONB 3FHCB 2ZVPX 2QQ5A 4GFDA 2M98A 4QXQA 5KTNA 3ZDDA 1ND5A 1UIRA 1GPMA 5BV7A 5CX1A 1SBCA 2J09A 4TL7A 2BMWA 4BX2A 2Y1XA 1HTTA 2HR1A 3GB9A 5M34A 3EQ6A 1OHHD 5JHGB 3EWAA 3BF7A 1CJBA 5LP6C 4R2MA 1TM5E 1E6EA 1Z4MA 4FUTA 5EUQB 4B4UA 1C4KA 2P11A 3TYXA 3FZYA 3OEHD 5AKJA 1GCUA 2GAJA 2HU7A 4NYIQ 1ZNWA 2IYWA 2VK4A 3OFKA 3BJZA 1ID8A 1P5JA 4MYUA 3C3CA 4DQXA 6PFKA 1PKXA 4PNPA 1SN7A 1W96A 3SJBA 3BOSA 3RKUA 2O3SA 1WXEA 4YFVA 4DV1B 5IS2A 5HJ5A 4OPMA 4YUZA 4ZQGA 4M8SA 3P2JA 3OEWA 5KS2A 4X97A 3VR6H 1AT1A 3L82B 3PZRA 2WTMA 4B0PA 2HMTA 2XYVA 2FHSA 4PC6A 4NPAA 4ZI2A 2MOKA 1IY0A 4NU6A 3WQSB 1NPTO 1KZ4A 2AG8A 2ZWOA 2JLBA 5ECYA 1RBZA 3T8YA 3UJ8A 3WB1A 4YRGA 2D2FA 4RMNA 4RIEA 4AZ3B 4CKYA 3LXMA 3HFRA 4V2UA 1Z4JA 3GN1A 3HV2A 4MRRA 3LYAA 4ZAFA 4EVSA 5KQGA 2ZT8A 3A1FA 3EZ9A 4QPCA 1LLQA 1Z2NX 4IQ0A 2FW1A 4E11A 4V2IA 2QLNA 4ERNA 1GRRA 2RHMA 4TRRA 4U2GA 5JDIA 3R3HA 4YPVA 4QATA 1ESZA 2B5OA 3BE6A 1X70A 3HV0A 3I37X 1ISIA 1BXRA 5FTKA 5IF9A 3L7KA 3A37A 4OMDA 4AU1A 1V1RA 1QVVA 3NHMA 1ISSA 3RAPR 2IC5A 1PNTA 3W7VA 4EF5A 4JYZA 3E9RA 3WYNA 2R66A 1SA0B 2DBVO 4MLCA 1P2GA 1AA6A 5GQSA 1B1AA 4RHCA 1ADYA 1T1GA 2B3