1ZY2A

Crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
139
Chain Sequence
b'MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLLLLPDVNGLEILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRKLRKENELLRREKDLKEKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator NtrC1
publication title Negative regulation of AAA + ATPase assembly by two component receiver domains: a transcription activation mechanism that is conserved in mesophilic and extremely hyperthermophilic bacteria
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 41
structure length 139
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zy2A00
2FLKA 3QEMB 4XLTA 5EWLB 1WETA 2P9HA 3KTOA 3NNNA 3F73A 3QK7A 4Z4GA 3CG0A 3IDOA 3RVOA 4DN6A 1U2QA 4Q6BA 3M9WA 2LPMA 2E4XA 1CEYA 4NICA 3KKEA 1ZHHA 1S8NA 2RJNA 5EWJB 3FDFA 1TMYA 4N47A 5TPZD 4MR9A 2L17A 1M5UA 1NY5A 4OG2A 2CHEA 3R0JA 2P4UA 3H5WA 3N0RA 4IMIB 3UUGA 5IULC 2GI4A 2KYRA 1JDNA 1BDHA 3RVJA 3NNDA 3JS5A 2PL1A 2JVKA 3KYJB 2RGYA 1YVUA 1U8TA 1DG9A 2JVIA 4G0OA 4YWHA 3O1IC 2FEWB 2IPAB 5FWXA 1DBPA 1BDIA 1NXOA 2N9UA 4KV7A 5DLEA 3NBMA 5FWYB 2H0AA 3RH0A 4G0ZA 5ED4A 2PL9A 4XASA 2JBAB 1JYEA 1MB0A 1B00A 4MS4A 4KZKA 1IIBA 2PKXA 3LUAA 4H3HB 1JHZA 2VK2A 3O74A 3Q15C 5HKOA 3RVMA 1E2BA 1Z25A 4ETIA 1FQWA 2CHFA 3CU5A 2RJOA 1ISRA 1DJMA 3LUCA 4IF4A 3I45A 1SXIA 3QLVC 4MGEA 2MSWA 4N0QA 3CRNA 4L4UA 5C5CA 1BVHA 2HQRA 3HK2A 5IEJA 3N75A 2VUIB 3EJWA 2PUFA 1ZDMA 5B3JA 5CNJA 2V0NA 2QW1A 1LBIA 1QKKA 3LOPA 4OLBA 2A9OA 1BDJA 1EAYA 1BA2A 1FFGA 2ID9A 3EQZA 4ZPJA 4M88A 4YR7A 4Z4CA 3EQ2A 4LZLA 4QYMA 3OQNA 2JK1A 1U0SY 5EWMA 4MR7B 4PZ0A 1CYEA 4RKQA 4RDCA 3RVPA 3SQNA 1QNLA 1ZGZA 3CG4A 5CNKA 3RVRA 4PEVA 1QQBA 4RK6A 7ABPA 1EFAA 3TMYA 3IPCA 4PICA 4RY8A 5C5EA 5TE9A 5TPWB 2HPHA 2B1JA 5JNUA 2MSLA 2QU7A 4YGXB 4G0YA 3MIZA 4EY3A 5IX8A 5KQLA 3OMWA 3KLOA 2GKGA 2NT3A 3O2JA 4MS1A 4RXTA 3TX6A 3DGFC 8ABPA 4IGAA 1UDRA 1URPA 3HSYA 4QICA 1U2PA 4MRMA 3CKMA 4YO7A 3FFTA 1NXXA 2JB9A 4MQFB 4GNRA 1BAPA 4RK4A 4HNQA 3FMVA 3O2SB 1KRWA 2LBPA 1ZY2A 1JH9A 4N0PA 1P6QA 4IMJB 4KK4A 4OATA 1JYFA 2ZWMA 4MR8A 4RK0A 3FFWA 3UK0A 3SM9A 2FN8A 1Z2EA 3ILHA 3QLTA 3SY8A 5KC8A 4RKRA 3EULA 3DLBA 3EAFA 4OBBA 1QO0D 1MB3A 2TMYA 2NZVG 1J56A 2FLWA 4N76A 1F51E 1P2FA 1QMPA 4F8JA 3LTEA 4W5RA 3C97A 2CWDA 3LKBA 1SXHA 4UHJA 6CHYA 3Q7TA 4EYQA 1M2EA 4CBVA 1YIOA 2A9PA 2WY2D 3QLUC 4MR9B 3CS3A 1OXKB 1GUDA 4Z9AA 5BR1A 1ZH4A 5JNRA 4W5NA 3E61A 3JVDA 2DRIA 3LUHA 2GWRA 2PUEA 5CNIA 3OMXA 5IBQA 2L19A 4Q7EA 4G0MA 3IP5A 1E6KA 1M2FA 4H3KB 1JDPA 3E3MA 1YMUA 5IUNC 1A2OA 5FWXB 4Z9BA 2FXIA 2E4YA 1NXVA 4H60A 1KMIY 2F8TA 4PE5B 4JAVC 3MM4A 4KVFA 3KG2A 1SXGA 1NXPA 2B4AA 1CHNA 3CHYA 5ABPA 3HUUA 4LDZA 2MSKA 2NUBA 5TPZA 2PUAA 4MS4B 2QVCA 4ETNA 5IUJC 5PNTA 1C0EA 3A10A 1ZH2A 2OENG 5JNSA 3OO1A 5IEBA 5TQ0A 1VRVA 9ABPA 3A0RB 3BRQA 3RVLA 2FMKA 1QP7A 2H3HA 3H6HA 5TQ2A 1JFTA 2IKSA 2FMHA 1YS6A 3BREA 3H5OA 4JB2A 3RVKA 1T34A 1M5TA 3QX8A 2HQOA 4RSMA 4D74A 4DQDA 3QEKA 1NTRA 1ZGGA 5HQJA 1C4WA 3C3WA 4LE2A 5GQSA 2PUBA 4QPJC 3ROFA 3HS3A 4YRZA 3KHTA 5HSGA 1PEAA 5EWMB 1USKA 2E4VA 1DC7A 4B09A 1D4ZA 1XWWA 2QVGA 2WMYA 4WT7A 3RQIA 5B3JC 1VPWA 1NATA 3SNKA 3OO0A 2JCGA 2O20A 5EWJA 4EVQA 3GV0A 1E6MA 1TM2A 4F3TA 4NCBA 4MS1B 3P9YA 4TN5A 1LK0A 3OM1A 5DGCA 5FBKA 1W25A 4TLMB 4EVRA 3LFTA 2M1ZA 2M98A 3NHMA 3T8YA 4KFCA 1JLKA 4MRMB 1YS7A 2LP4Y 3N53A 4G97A 3GL9A 2FQXA 4RXUA 6ABPA 2QSJA 3GA5A 1K66A 5KQMA 2WJAA 3GT7A 3M9XA 1NXWA 3OLVA 2HJ9A 3DLHA 4Z4EA 3D8UA 4RK5A 5FBHA 3N0XA 5DTEA 1ABEA 2LIVA 1KRXA 4KMRA 1PEYA 1TVMA 3QLVA 4JP1A 4KQCA 4MR8B 3HVRA 2JVJA 2ZAYA 1RZRD 2MYUA 4OLAA 1ISSA 3HZHA 3D02A 1JWLA 4RY0A 1I3CA 3GBVA 3NHZA 2GBPA 3OLXA 4MLDA 4RY9A 5IUKC 1FFWA 3JTEA 4GPAA 5KWSA 1PUXA 3IP6A 3CNBA 3FGZA 5T3YA 3QELA 4KQ9A 2FMIA 1LJUA 3OLYA 5JS1A 4LE1A 2QV0A 3JPYA 4TMYA 4F11A 2L18A 4PYRA 1ZVVA 2E4UA 2WB4A 1DRJA 2RDMA 5KQPA 2A9RA 2F8SA 1D5WA 4EGSA 1Z17A 2PUGA 4RXMA 5DKFA 2GX6A 1JBEA 3KS9A 4XFKA 3IP7A 4D6YA 2PUDA 4XAQA 2I6FA 3BILA 3ROTA 2MYTA 3G85A 3KSMA 4IRXA 2AYZA 5CHYA 1QO0A 3H1GA 4JOQA 3O1HB 3UKJA 2CD7A 3H1FA 1DP4A 1F4VA 1NXSA 2J48A 4RU1A 4KREA 2IYNA 1H9CA 3L49A 1Z2DA 2E4ZA 1XHFA 5I4CA 2FEKA 4RV5A 2PAFA 1LJLA 3O75A 4KK3A 5CNMA 3MMNA 3CZCA 1GCAA 1DZ3A 1QQAA 2BGGA 3TD9A 3LUKA 3BRSA 4JA2A 3C6QA 2WRZA 4YLEA 1Z12A 3KYIB 3H75A 3JVIA 1VLZA 4G0PA 4FE4A 2FEPA 1YK1A 4RZSA 3GYBA 4N03A 4RS3A 4G0XA 1W9HA 3JY6A 4JASB 2VUHB 5GOTA 5TQ0B 2YHBA 3HO1A 2VYCA 3T95A 4HNRA 1L5ZA 4Z4IA 5TQ2B 2FQYA 2IPNA 2QR3A 3KCNA 3OLZA 3GWGA 3VNAA 2FKAA 3CZ5A 3SG0A 3F6CA 4MS3A 4XXHA 3NNSA 3L6UA 3MYYA 4QYWA 4W5TA 2A9QA 1EWKA 3LKVA 1YK0A 2IDMA 5BRJA 3DZDA 4LDAA 1OXBB 3EGCA 3JPWA 3RVNA 3EDCA 4IILA 1K68A 1QP4A 4O1IA 2FW0A 1MIHA 2IPLA 1P8AA 4LRQA 1SRRA 1E6LA 1QPZA 4G86A 3T6KA 3N6VA 5JS2A 3W9SA 1EHCA 1ZITA 5E3JA 1DCMA 1JFVA 4YS6A 2WWVD 2FTKE 3FFXA 3A0UA 4RWEA 2LUOA 1GCGA 2NZUG 3CFYA 2R48A 4WXMA 5DCLA 4F12A 1DRKA 4EYGA 1USIA 4MQEA 2QXYA 4P98A 3HDVA 3HUTA 1D1QA 3HCWA 5BQ3A 4MLCA 2FSPA 3LUDA 4WUTA 3SAJA 4WXEA 1TJYA 3I5AA 4O5AA 3QEMA 2AYXA 2Q5CA 5EWLA 3S99A 1D2AA 1RNLA 3OQOA 4O1HA 4Z4FA 3H5VA 4Z0NA 2FMFA 4WZZA 1ZN2A 4DADA 3VNBA 1EWTA 3F6PA 3O21A 1TLFA 1QP0A 3A3KA 1JFSA 5JNWA 3Q7SA 1P6UA 1PHRA 1U04A 1DCKA 2R4QA 2QZJA 3N8IA 5KC9A 3K4HA 3CLKA 5JNVA 1XHEA 4ETMA 4S05A 2IPMA 4EUKA 3I42A 4FE7A 1DCFA 4LX8A 2FVYA 3LUFA 4ML3A 4YV7A 1PNTA 3Q9SA 2PUCA 1YTUA 3QELB 3LMKA 1SD5A 4NQRA 3HM9A 4Y9TA 3URMA 3CTPA 4NCAA 4Z99A 1MAVA 4Q6WA 2WJWA 3T38A 2MYNA 3ILYA 4JB0A 4YP9A 2OQRA 3Q7RA 4UHKA 5FWYA 1AB5A 1USGA 3OM0A 3HDGA 4YCSA 1VKRA 3B2NA 3N0WA 2JBAA 5F64A 2XDYA 3Q41A 2W42A 1APBA 1RZRA 1Z16A 4OTZA 4HNSA 3H1EA 4KPYA 1D1PA 3MA0A 4MPTA 3QX9A 2NT4A 4RK7A 1RXEA 1PNRA 3TO5A 4ZMRA 5JNTA 3H5LA 4EYOA 4N41A 1Z26A 5BRAA 1NXTA 5TQJA 3EODA 1GLGA 4KRFA 3C3MA 1A04A 3HEBA 1Z15A 1FFSA 3MQ4A 4W5QA 2E4WA 3GRCA 1JF8A 1RPJA 1YMVA 3O2QB 4NV3A 3RVQA 4ZMSA 5D2CA 2PMCA 1AB6A 2HQBA 5KQGA 1Z18A 4KNYA 2ID7A 3MF4A 5T7BA 2PLNA 3OQMA 3HXMA 1ZAYA 3F7NA 3HJFA 3HV2A 1KGSA 4LE0A 4MR7A 4TLLB 1A0OA 4E7OA 4ZYLA 1LBHA 5HM6A 4ZJPA 1HEYA 1Y1LA 4L85A 4MYRA 5TPWA 1JX6A 1RXIA 4MS3B 4P1ZA 2FN9A 2R25B 2R47A 3I09A 3IP9A 4WWHA 1MVOA 1GUBA 2YHAA 1DC8A 4XARA 3K9CA 2L2QA 3OLWA 3TB6A 4FB4A 3KJXA 3IPAA 4S04A 2PE5A 3H6GA 3C3KA 3H5IA 1R8JA 3O1JC 4MQFA 3RVSA 4EVSA 4W5OA 2IOYA 4EYKA 1JL3A 4HYEA 3G1WA 3KLNA 3LUJA 1DBQA 1EWVA 4D6XA 4Z4HA 4RK1A 3DGEC 3LUGA 4G0QA 3M6MD 1FSPA 2HSGA 4MQEB 1ZESA 4F06A 2PJUA 3GBPA 5IC5A 1Z13A 5KI6A 2FQWA 1L5YA 2MYPA 3BBLA 3QLUA 3H5TA 1ABFA 1DBWA 4E7PA 3DBIA 2JRLA 2X7XA 4MAAA
chains in the Genus database with same CATH superfamily
1ZGJA 2D4HA 2AJDA 2AXEA 5F77A 1DT3A 3JQAB 5LP1A 4NS1A 2XBMA 4L0MA 3ROPA 2XMPA 2VYVA 4DGSA 2FCRA 5F2NA 1H0RA 2X9NA 4RKYA 1ST3A 3N39C 1NC1A 2B4QA 1CEYA 1NWCA 4Z3OA 2O5EA 3F5DA 1U7PA 4IFTA 1HLGA 5LNK6 4QHTA 3VYRB 3AI3A 4LVUA 1NR5A 1E59A 2QMYA 1JJIA 4PIVA 2XJ4A 1J39A 3VR3A 1XKXA 2G17A 2GI4A 1X74A 2IY9A 1TKBA 4OBXA 2FMUA 1KI2A 1XTJA 3P9XA 1OGYA 4IJVA 2JBHA 4I3GA 1F2TA 4GP6A 5HJEA 2XUGA 3LT2A 4O2BF 3HP1A 1OH5A 3D3EA 2QW0X 3KVNA 3IUNA 4FMDB 2RGYA 3RRMA 4D56A 3ZOKA 4IIDA 4RW0A 4GPTA 3PT5A 4DYVA 3CLUC 4GXTA 1P1JA 2HJRA 4JUBA 4TXNA 3F49S 1P1RA 4K03A 3N8DA 4HGNA 2I7CA 1Y5NA 3V3TA 4QOIA 1SCAA 2I55A 3CEPB 1VJ5A 1OD6A 5A06A 1G2QA 1B00A 5HR5A 4F6LA 1QHXA 3A26A 1RCFA 3Q15C 4P7BA 4TQUS 5B58T 3T5DA 1VE3A 2SBTA 1PLLA 4EELA 1GP2A 3MJHA 1DPGA 2HLPA 3Q98A 4UTPA 3H2ZA 5JDIC 1KY3A 3M5CA 2GHQA 1HTTA 1W8DA 2Z58A 3H8VA 3IKMB 1G7TA 2YJZA 3U09A 3CVUA 3QYJA 4NBLA 3EDRA 3UHAA 4GX2A 2CMKA 1K1EA 1SKBA 4IJUA 3I3SR 3HK2A 4O4HB 1Z0DA 4I19A 3RIMA 4NECA 1LNSA 4Y1RA 4BPBA 3EJWA 4RIIA 3V7WA 4X7MA 1I6MA 4LBVA 5K3DA 3RD5A 1QOZA 2PSSA 4BQPA 3QP9A 1WDTA 3FPLA 3LOPA 1OJ7A 1XQ1A 2QI9F 4WLEA 4GZ5A 5D8DA 3WHKA 7REQB 1PFWA 2FXVA 3BIFA 1KF0A 1WXIA 4FFLA 4N5IX 1EWQA 2QR2A 3EOBI 1P44A 3N2ZB 1Z0SA 4BJ1A 3M9LA 4FMBB 3TIIA 1VGQA 2JK1A 3C3BA 1KY2A 3KQOA 3FPFA 4MI3A 2MJLA 3QPVA 4ZVRA 1VCIA 1ZGZA 2SKEA 3DZHA 3FPEA 3GH1A 2PXXA 2A4MA 2BDTA 2Z98A 4AJEA 3ICQB 7ABPA 3AYXB 4XJTA 3IPCA 4NZYA 4RNCA 3JYHA 2R2AA 1CUIA 4LHXA 1YS9A 4IIEA 4UUMA 4WLUA 5CGZA 4C6RA 2V03A 2Q5FA 3WYDA 3L41A 1FNSA 5HF9A 3KLOA 1RKXA 2HF9A 5ALMA 4GOOD 3IAM1 4WTOA 3H3XA 3K31A 4Q7LA 5D3MA 3NIFB 1TTQB 1XRLA 3V2HA 9GPBA 1URPA 2IZZA 4QEDA 3K8YA 5EJEA 3GZTB 3W5IA 1XL1A 2P6MA 4LOHA 3SQWA 3PQFA 4B3FX 2C7RA 1X7WB 3WDLA 5INTA 1E32A 1Q6ZA 2DQKA 2RI1A 5DGIA 2BSQA 3H1BA 4E5NA 2LBPA 3DUFA 1G16A 3HB7A 3U3DA 3VV2A 4YB8A 4CL2A 1G7CA 3PD0A 5U1PA 3GVPA 4J0FA 1JYFA 4KK4A 5CVJA 3CWZA 4FGWA 3OOSA 5J2UF 2SCUB 4XDYA 1UKZA 4NATA 2CLMB 1Y34E 2V0CA 1KIMA 4LC0A 2Z04A 3LXMA 1D2MA 4MDHA 4UREA 5KUTA 5LZ4A 1C9MA 3PUYA 4MVJF 4A27A 2JANA 2ZGVA 3LECA 2I29A 5CXUA 1GG5A 4L8LA 4EF6A 4M7PA 3IALA 5FPHA 4RZ2A 5CPFA 1PZNA 2IX9A 1WUJS 2VHWA 3G8BA 4HAXA 4JJ4A 2FX5A 4HATA 4R5MA 2CJPA 2XNKA 1G5IA 1KH1A 4KFSA 1S1CA 4XX1A 3VR5H 4CMJA 1A8PA 4IDFA 2XTZA 4NAHA 3BGOS 5DCUA 5I9TA 5IYZB 3U7RA 3WIVA 1W1UA 1YIOA 1MXFA 3T9CA 5C1DA 3IOMA 3KJGA 2W2TA 2JW5A 3LUBA 1LH0A 4MR9B 5EIXA 1NP3A 3LVQE 1YKSA 4FI3F 5GPBA 4DRYA 2FYTA 4KW7A 5DNCA 1GUAA 3ZDRA 2PT9A 1LNQA 3RROA 2VH2A 1LWNA 4QBTA 3L6OO 2Y68A 6AT1A 3RASA 3MD0A 3ND7A 4D2IA 4MWDA 1EX9A 3O2NA 4K6FA 2C2KA 1IONA 1P17A 1ZWKA 2J6HA 2ROQA 2W6CX 4MQ4A 3K9QO 4JVOA 3GFRA 2VAVA 4ZVMA 2D3WA 2ZSIA 3JASA 4X62B 4Z7NB 4CMHA 4EW3A 1O5TA 2E4YA 3TQOA 2NVOA 1E94E 1H9AA 3WGVA 3NBAA 2HGSA 2Q1XA 4XQGA 4I14A 1LVUA 5T67A 5I47A 4JROA 1JT2A 3KFXA 2P9GA 4G67A 2V5AA 3HKCB 4MHSA 5F35A 5KX5B 1BWPA 2QVCA 2R0QC 4CEJB 1SGWA 3I61A 2PUWA 1KMHB 1U5BA 1C0EA 5EUQB 3M1LA 4PLZA 4U7PB 3UNXA 5B57C 3C7TA 2YMQA 2J4DA 1ENYA 4FHGA 1DBSA 2J7KA 1FOEB 3R5JA 3NWOA 5GOZA 4DJAA 1RAHA 2X0EA 4OSPA 5BUZA 5TQ2A 4TYWA 1HNNA 1OU4A 1C14A 1RWWA 2HV9A 1WMSA 2YHIB 3MMSA 3MTGA 1SMKA 1M1YE 1Z4LA 5FBZA 1SC6A 3BMNB 4FR2A 4I1VA 4YP7A 1KSGA 1U2TA 3EF0A 1H3EA 5CDFE 5IH3A 4WVLA 1E3IA 3DVRX 4ZVQA 4AX8A 2A14A 4OQ4A 1WKBA 4C88A 3CPEA 1OT3A 3LRXA 4PC1A 2WHQA 3MT7A 4Y8VA 4DKJA 4QPJC 2HBZA 3GD5A 4FOLA 2QUKA 1QCDA 3IP8A 5EJ9A 3QWFA 3KHTA 5JIBA 1SUFA 4UCQA 2YICA 2XVMA 4FSXA 4ZC8A 1H2RS 1C30A 1LPOA 1TT7A 4CT0A 5CEJA 2HK8A 4J1TC 2JGIA 1Q3TA 1BX0A 2G9UA 2EG5A 2WMYA 3BZWA 4E88A 4LOAA 4P4UA 2B8NA 1L9XA 2RAFA 4QT0A 3WGYA 1CEQA 2YIMA 3PXEA 1RP7A 1I2BA 1EQUA 2RBGA 4FIZA 4YREA 4ZXPA 2APJA 4K2AA 3VTKA 4HVCA 5JO0A 3G2QA 3HG7A 4D4IA 2ERCA 1DBVO 3DZCA 1IU9A 3LFTA 4M0MA 2HJVA 3NHMA 1XDUA 2AYYA 2ZR9A 3GRZA 2PKWA 3VR0A 3FF4A 1DAKA 3HY3A 4G97A 2C5BA 3CEJA 4HD8A 3FTEA 2AMYA 1V5GA 2AXPA 1K66A 2HRBA 3N9IA 3CISA 4KX5A 4W5WA 1R4ZA 1DIOB 5HF5A 3ADBA 1YDWA 2XE7A 3GYGA 4M1EA 1CUYA 4YJ3B 1N5DA 5E4JA 2XR1A 3DVQX 1YVDA 2RHJA 2M6RA 4D80A 2YWJA 1E3MA 2HCTA 1I7NA 3FMIA 5TS3A 4B73A 4WEQA 4XH9B 3I6IA 3SJ7A 2AVDA 1QE5A 2EP5A 2XB8A 1UADA 3HL0A 4K05A 3R6GA 3DT6A 4DXHA 4TV8A 1UBSB 5DTJA 5IUKC 1N2EA 1XTRA 4B44A 3JTEA 3U7GA 3KC2A 1PF7E 3EDOA 3L7DA 2ZJOA 2ZSAA 1IVNA 1PUXA 1H4TA 4PYMA 3FVWA 1ND5A 3AFNA 4GBED 3ZWMA 2BHNA 3EFOA 4LQ4A 3TOVA 2OHXA 3OLYA 1AC5A 1MHPA 4EPWA 2VP5A 1ANKA 4DCNA 3EXFA 2DU8A 2KW5A 3NBQA 5CRIA 5LJLA 2FW7A 3D7MA 4LF4B 1SVWA 4HZUB 3ZV7A 3ZWKA 4FQ5A 2R7KA 3VUEA 2A9RA 2Q50A 4FHCA 1BFUA 2DFNA 4P84A 2O48X 3BKWA 4EX7A 2CUNA 3C8ZA 4YPFA 4WGFA 4MICA 4RXMA 1DSSG 3A7EA 3LDHA 4G8DA 2DT8A 4GLFA 1VA5A 5DBOA 1TKCA 3M6XA 4ZP1A 2PUDA 1D09A 421PA 1C7EA 3F8SA 5L7TA 3I2FA 4N9WA 2PAAA 5H4HA 4AG5A 2XE6A 5BSEA 1ONSA 5KNLA 1SFRA 1ACLA 2Q5QA 1KSHA 2O2JA 3H9QA 4JOQA 3R9XB 4UNIA 3WYNA 2C1XA 2PD4A 4KPEC 4L8FA 3U7EB 3E81A 4KI0A 1IUOA 1I6KA 2LRHA 1YBMA 2B2XA 3IUMA 4FEAA 1K5PA 1C0LA 1UOQA 4IO0A 1I10A 2JG3A 3AEQB 4S3MA 4UDOA 4ZAXA 2J5RA 2OBBA 2H06A 3HZRA 1L1EA 1B76A 2I7XA 5D1HA 3EGOA 3OE5A 1QQAA 2X9QA 3BDIA 2ZUEA 3L0YA 4WQMA 4FVTA 4OP3A 4GHWA 4BNWA 4UQPA 1YB7A 4FE4A 2QLBA 3M6FA 5EEHA 5HGJA 4N5LA 4RS3A 2H1LA 1W9HA 5DWQA 4A2WA 1Q84A 1VMAA 2HH9A 4Q3BA 2O23A 3DEFA 3P0EA 3PDJA 3WJ1A 5JBNA 4RV4A 2P5YA 2V55B 2DR0A 2AVNA 2D2VA 3T9BA 2PLWA 5DGDA 5CB4B 4QJ3A 3E9ZA 1BU5A 1H0HA 2DPXA 3ZG6A 4YRSA 1ZMRA 1E58A 1OVGA 1Z36A 2WJVA 3FSRA 3K6RA 4KYIB 4R8RA 2BFMA 4PLGA 2ZFUA 3EUEA 3B9PA 2XMDA 3I37X 4NCKA 4S0XA 1OHHA 1TYDE 2PUJA 1WF3A 4KE6A 1MDFA 5ALSA 3JQRA 4ZQBA 4WJKB 2HJWA 3DLCA 4XTRA 3ZE1B 4LRQA 2A0XA 4HDMB 5JU6A 3LHIA 4ZCIA 2Z2KA 4M8LA 4J76A 1YDFA 4N65A 3H7IA 3P2EA 3KOUA 4R01A 5JYDA 4R5HA 3BD8A 2XAUA 2OHIA 3FOFC 2IH2A 1O1YA 3LF1A 1SOAA 4DWWA 4BNTA 1G3MA 2PRKA 1P9LA 5KHOC 4JT8A 2ID8A 1JIUA 2P78A 3R6TA 2IS2A 2HU8A 3NTXA 4NOKA 4O4LF 2QS9A 4ZICA 1GKKA 3E0XA 3OT4A 1QYWA 1ECJA 1XEXB 1FVFA 1QC5B 2YCBA 1XZCA 4GOMD 2C4HA 5EUBA 1XJQA 4WUTA 5E7IA 1WP9A 3SYTA 4LTNA 4C0HA 5I5GA 4QJ5A 2H4HA 3WL4A 1FMLA 3TI9A 3AETA 1HFKA 2P68A 2VPZA 4BJ3A 4BVLA 3BORA 2NU6A 2V7WA 3ZLVA 2HO4A 2VKQA 4LAFA 5B3KA 5B7GA 5K6RA 2Q3JA 1JJBA 5AJVB 4E5DA 3FYUB 5KINB 1SU4A 2AMJA 2QTWB 3PGXA 2WT4A 4B6JA 3NHAA 1PV4A 1ZKMA 1BVYF 3NVAA 3KJQA 4L9WA 3T7RA 3SC2B 3I34X 3OKAA 1KJWA 4GWKA 1LDEA 3PHCA 1JFSA 2O3UA 2HA3A 4ZO9A 4CM9A 4UBJA 3IAFA 3FOCA 1SWVA 3WS7A 5EKDA 5DTQA 5HHTA 2DLCX 2AE2A 5ENVA 3B51X 1IN6A 2ECFA 1W85A 3WIUA 1ZEJA 3LKZA 3O90A 3G23A 4TKUA 4W7SA 4FE7A 2XWBF 3BJIC 4KQGA 4YN3A 2ZJ6A 5BR4A 4EW1A 1USWA 1PGQA 3HDQA 4NESA 1DIRA 1NVTA 2OHVA 4WNYA 4DNPA 1RLJA 4QIHA 1NM5A 1MAVA 3DM9B 2BTQB 4UU1A 4WA7A 5K3BA 4C21A 1LQ2A 4P31A 2VTBA 2HBQA 3MSXA 3HDGA 3G02A 1SVMA 2RH5A 2QRPA 3GQBB 3NEAA 4V03A 1OYWA 2XDYA 2QX8A 4XLLA 1ZGBA 5JXHA 2OWEA 1C2YA 3AB3A 1YR7A 3K0AA 2H48A 4KXVA 1AHPA 1YCDA 2DH5A 1S2GA 1OX4A 3O73A 4G85A 4UEOA 3SX4A 3TM5A 5K0ZA 1RXEA 2IY8A 1BX1A 1PT7A 4X45A 2O3QA 3SX2A 1PFVA 1M2HA 2PSFA 3AF3A 3KYCA 5KMGA 4TMWA 5GGXA 4KRFA 1Y8QB 4K9LA 1A04A 3H9BA 4MUMA 2NO1A 1S8AA 2ON6A 4ZYVA 2V7TA 1FLVA 1OW3B 4MUGA 2OEPA 3H6KA 2XHZA 4J91A 4Y2YA 2QZ9A 2COEA 2F9FA 3S2ZA 2OY0A 4JZYA 2BBOA 3ZIDA 2LZ0A 4Z0TA 1ZIDA 3WLHA 1NW9B 3VU1A 2Z5LA 3U16A 4CMAA 1A9PA 2FWIA 4FDVA 3L8HA 4OY3A 4X1KA 4XWWA 3SQMA 1DKLA 3HUEA 1VE7A 1UK7A 4A16A 1DJOA 1SVIA 1Y63A 3TF5A 4UD6A 3PSAA 2V98A 3D3WB 3PUWA 4KN9S 3M49A 4M6WB 4RDHA 4UM7A 3TJMA 1O95D 2XOKA 3UGQA 4E33A 4L85A 1J5XA 4MYRA 3FUXA 5FTLA 1NIJA 4MS3B 1FDIA 4X41A 3QBEA 3MBIA 5DZSA 4RMJA 1RXVA 3OJ0A 2D2IA 5FOXA 4L16A 2C4UA 3PR1A 5JCPA 1VKHA 1LFAA 3LSTA 1DC8A 3T7JA 4DMCA 1OLUA 1UBOS 2O0LA 3E48A 3QPAA 5JH7A 1FSGA 3RFFA 1JEYB 2WJ3A 2QMQA 2Y1EA 1ECCA 4C7VA 4EY6A 1TPYA 1XDGA 2QRLA 2ADFA 2FA9A 2PWYA 1ZVJA 2NPIA 3A6PC 3SOZA 3A6ZA 2BFOA 3HA2A 1GEEA 1RKUA 4FPXA 1GGKA 2P2ZA 2WIJA 1EWVA 3L8EA 2YS7A 3EVZA 1XTKA 4YWJA 4DV5B 1NF9A 1JDSA 2C07A 2OHOA 1J09A 2Q8QA 4AP6A 3MMPA 5AM1A 4XWTA 4OGFA 5HEKA 2Z43A 5BOVA 4GC5A 3A25A 3ZHBA 2FU5C 3QLUA 2H07A 1ZKDA 3FWZA 5AK3A 1C8LA 5JISA 3A9SA 1R9JA 3EIFA 5KNBD 1OU0A 5B1IA 1IN5A 1X7YB 2VJNA 3WLNA 2ACVA 1ILEA 3K2EA 5I6DA 4MPJA 3VNSA 1NQOA 1IM8A 3EC1A 1UPCA 1E5QA 2V5VA 3G0BA 4JXKA 1GQQA 3KT3A 5BWBA 2AQ8A 3PLRA 2C2OA 3VU8A 3KSAC 2NXCA 4DC0A 4K8OA 1RCTE 4DANA 3GLHE 4WK2B 2WOOA 3ZHYA 4BLOA 3FUVA 2YXLA 3P45A 3FDFA 5BXQC 4DUGD 3KDSE 1NY5A 3OZUA 1N5RA 2XOEA 4QGGA 4ZWNA 2BT4A 5DOVA 3FRJA 2WUVA 3CSDA 1XAJA 3D8NA 2JAXA 1E7YA 1LRLA 2R6CA 2RB4A 3DR3A 2XQVA 3H5RA 3LC2O 4E0BA 1J97A 1QS0A 4LSMA 4C4RA 4A8HA 5BVGB 1X80A 3N2LA 3GRKA 1U8TA 4YWHA 4FINA 4RHCA 1YAJA 1RRFA 2CJWA 3CLSC 4M1QA 4E6EA 2LV8A 3RTEA 1QIKA 1FP6A 4QTTB 1O87A 3PGKA 5HE9A 1UMBA 2X40A 2I91A 1AF7A 3UTCA 3ZZNA 4JP5A 3OP1A 3KQVA 4M1OA 1XXHA 3PHIA 2GN1A 4ETIA 2CHFA 2RJOA 1DJMA 4QU0A 2IH4A 1V8BA 3IQDB 4XW2A 1YO6A 1R27A 3TCNA 4NVRA 3C5EA 1LPMA 1ZBDA 4PFKA 1PSWA 5D7BA 1YTLA 5HP4A 3FOEC 2PUFA 2HTEA 4W63A 1GGMA 4LXXA 3JQ8A 4DCTA 1QKKA 2ZSDA 3QA3E 1Q0HA 1ZVMA 2W70A 1C3LA 1AQLA 2OTCA 1K5GA 1M34B 3IV9A 2QEQA 4F5WA 2WILA 1YE3A 4JDPA 3W2IA 4U7WA 3EQZA 2DJIA 1UXOA 3Q7QA 2I4MA 2PLAA 1EM8A 2G80A 4M88A 4WX2B 2HRDA 4UQOA 1NJFA 2C29D 1ZISA 4I3HA 5JJBA 2NO0A 2YZGA 2BR5A 3G8YA 4ND8B 2IYYA 4DV2B 4ITUA 5F21A 4FR5A 2OCBA 3IEIA 1TEZA 4K5QA 1DAHA 4EHHA 3JR7A 3DVLA 3TCKA 1NW7A 1XZAA 1U2EA 2HV8A 4PICA 4RY8A 1K2WA 5TE9A 2VN8A 1JP7A 4GOLD 4FWTA 4US2R 4U5XA 1U0JA 5HIKA 1TCCA 4G0YA 2IS1A 3X1MA 3R9WA 5KQLA 3OMWA 2PX8A 3H5NA 4MZDA 4LYFA 4FBMA 1M1NB 3FFBA 1FC0A 1IDN1 1RC1A 3LQKA 2EJBA 1WV0A 5F7XA 2UXDB 4IRMA 6YASA 3MWDB 4C2BA 1ZOLA 2WM8A 3GO4A 3V6MA 4BZWA 1TZKA 4II2A 3DW1X 2A6PA 2UV8A 1X2EA 1NVVR 1T3ZA 1S6YA 3GJSA 2YWCA 3HCBA 1T3SA 1U0EA 2KX7A 3F5SA 3L0ZA 4WN3A 3MWYW 1P6QA 3RFUA 3ROKA 3EY4A 3UOAB 2ZWOA 4QREA 4C87A 2OXTA 1HQYE 3T9EA 3TTUA 1L7PA 2ZTMA 3GRAA 1QGYA 4L72A 1QZ3A 2EKBA 4P4SA 5F2KA 5I7HA 1G5PA 3F6SA 2O0JA 3HXPA 4NMLA 4DPKA 4R2XA 1ISMA 3T7AA 1WLSA 1WXHA 2GCIA 4JI2B 1UBCA 3AESB 3EGIA 3NHSA 1EE9A 2VDWA 4IVQA 1OR8A 1SHTX 4R1NA 1EK6A 4N7JA 2HT6A 3U13A 4XWOA 2Z6QA 2VHCA 5I4BA 3IDQA 2CJYA 1HT0A 1JHMA 3BL6A 1HH4A 3LA6A 3MS4A 4L4SA 3W9YA 4AWAA 1UJBA 2J67A 4A23A 2J07A 3NDRA 3JVUA 4PAMA 2C4VA 3KKOA 4B3SB 3NT5A 3O47A 3VKUA 1RWMA 2DRIA 3ME5A 3CZ4A 4J75A 3WLQA 2YYAA 4GW3A 5JV5A 3HMQA 1JWBB 2XUFA 3DBHB 5TMBA 4NCAA 1NUSA 1U02A 3HR4A 3TTWA 4JLNA 4Q7EA 3VSDA 4YT5A 3UW3A 1AMUA 4CL8A 1KFEB 2XQGA 3BWEA 3DLAA 4GZMA 3P0RA 1P31A 3MN1A 5IABA 3OZWA 4PAQA 2GBLA 2FXIA 2X8WA 2W4MA 3LE8A 1ZS9A 4KGXA 1JQAA 3IIKA 1XNHA 3K2BA 4I5DA 4IXTA 1GQRA 2EFHB 4JAVC 3DB1A 4JQOA 2GRAA 4NTZA 4AZ0B 2QXUA 3RJ5A 5FTNA 5JCJD 1WB9A 3GZ4A 3WYEA 1EM6A 1HDOA 1SVOA 2ODBA 2ZUBA 3RANA 4AJIA 3PRHA 5A9TA 5PNTA 1NU8A 2FUKA 1XF9A 2OXFA 1PW5A 4A0FA 1X1TA 3GDWA 3M70A 5FUQA 5IT0A 1T3LA 2ZOSA 4JBYA 3FY4A 3LP5A 2UZIR 1KEKA 2REQA 1L8OA 3LSYA 1YB5A 4IXDA 3JQ9A 3ODPA 5EZ6B 1LI7A 3TLXA 2XXAB 1PUJA 3W2HA 2IKSA 1WX1A 2FMHA 3DZFA 3NU1A 3OUTA 4PSAA 2X0KA 1RXUA 2F43B 1VPTA 1X7XB 2GD6A 3P52A 3DDNA 3FPBA 4KNWA 5KVQA 3SYRA 4DNFA 4DNXA 2DFLA 4ZREA 3TECE 5AXAA 4BX8A 3DM5A 3D64A 1OROA 3WK7A 4BE9A 4OQNA 2AT1A 3HFGA 3EJ6A 2Y76A 1KJNA 1NSYA 4B6GA 3NCTA 3TLJA 2C4WA 3WTBA 4GWLA 5KS2A 3CONA 4CI9A 1CLUA 3ZX4A 3ER8A 1HL3A 3K09C 4OH1A 4QUAA 2B4TO 4KWHA 2QVZX 4TTQA 4FLEA 5CIYA 4TWZA 4D45A 1PEAA 2Q7OE 3WLRA 4C08A 2XUIA 3R6DA 5G3YA 3LJKA 4C20A 4B09A 3EHEA 1X8KA 1UKCA 1E2FA 5BN3A 4DV4B 1XEWX 3E9DA 1VPWA 3PL1A 5CDSA 1T9CA 3Q3EA 1RI4A 1KJ8A 2DSTA 2HWUA 1R5JA 4XVHA 1KKUA 3GK3A 2YUIA 1ATZA 2O1SA 5JMPA 1M1XB 4WNIA 4X94A 1TYZA 3MMXA 2A78A 3H9CA 4C03A 1VKOA 2PT5A 1W2GA 1PTJA 5GM2A 3G0HA 4G5GA 2BP7B 4RANA 3VYVA 1ONNA 4TQAA 4NBWA 4BFLA 2ZSEA 1ZCZA 3WGHA 5JWOA 1S2MA 4RPJA 2YH2A 2ZIGA 3DO8A 5DTEA 4ZYTA 3ECSA 3QLVA 1KFCB 1G8YA 3QNMA 4OM8A 4CGYA 1N8KA 1MBZA 4MWGA 1MRNA 2C5SA 3CZRA 4NULA 4RY0A 4RMHA 5KKAA 3GBVA 1NY6A 4E1AA 2CE2X 3OLXA 5TJHA 2ZM6B 2IEGA 1QHIA 4BVHA 5KTKA 4YMSA 3ZGXA 2BYTA 3HB4X 1VYVA 3L79A 4UBMA 5JQWA 5K3OA 4O6VA 1TF5A 2AWOA 1F5SA 3JYPA 5G3ZA 1B74A 3OFKA 4LF9B 3KXPA 4UFNA 2IV2X 5AIBA 2MMGA 2Z3VA 4L7QA 5AW4A 3MCUA 2PS9A 1TYCA 2HO5A 1NKSA 1IOLA 4TV8F 4EJSC 5JS6A 4MKGA 4V1CA 2CXPA 2WB4A 4IDPA 4YUVA 2ZRIA 1G3UA 4UU7A 1FJ2A 1I4LD 4V0MA 2GEVA 4EATA 2VTEA 1YJXA 3CO0S 5AVYA 1N2OA 1Y9AA 3QHQA 2QX4A 2R11A 3FROA 1H1LA 4AN0A 4DIBA 1VOTA 1TJ5A 2GESA 4LDRA 2Q2OA 4RJKA 3V3KA 4JYZA 2Q3HA 3O7MA 1FS4A 4KIFA 4G89A 1I5RA 4L76A 1J5EB 1K88A 2G88A 1L7QA 2E4ZA 3ZHTA 1KY5A 4DBLC 4Y2XA 5EJMA 5IRCD 2BM9A 1P1IA 2M9MA 2GPTA 5TLSA 3VXKA 1HOXA 1IG0A 2IHBA 2JAWA 4NC9A 3FR7A 4DIFA 1ZW1A 3TL2A 4HWPA 2ZPAA 3W6PA 1JAIA 1ZX1A 2YY6A 3BE6A 3E3OA 3T9AA 1LB1B 2CV2A 1A5AB 5AJTA 2D6FA 5BUSA 1C7RA 5JJIA 5CK4A 2OZKA 4HZIA 3K8QA 4P83A 4QPZA 3PG5A 4UNNA 2GCGA 5DT9A 2OFPA 5GOTA 1JAZA 5TQ0B 4AMUA 3C4QA 2FRDC 1I2ZA 4H31A 3CEAA 4GP7A 1O54A 2XUPA 4NCXA 1C4OA 1K8XB 1N7HA 3KOOA 2RH9B 3P2MA 3AVPA 5DF1A 5CAEB 1DAOA 4KRYA 4O59O 4WV3A 3NTVA 4K28A 2Q28A 4YT2A 5BUCA 2BDEA 3SVZA 4X3CA 1IK4A 5FI3A 1E0JA 1PR9A 4LZAA 4MV6A 1J5PA 2GXQA 1FMCA 2PZJA 4J2HA 4L8WB 1CUBA 3R7SA 3SYMA 4DR6B 1WDWB 3H9JA 4MVYA 3WISA 3G8AA 4HZGA 4DSZA 1GQSA 4F6CA 4MHTA 3FUUA 3HB5X 3W9SA 4BRZA 1U80A 4XFJA 3JQDA 1JFVA 3ZLJA 3W05A 1JKMA 4W82A 2IIBA 2JHPA 3A0UA 5A4FS 1PJAA 4ZARA 4QPCA 3U5ZB 4CTOA 1MUUA 4HMOA 3ENZA 4UFPA 4LK2A 4KO1S 4CT5A 4E2FA 1E5TA 1BU8A 4XEHA 4MLCA 5C7IO 1I13A 3E2IA 1MC5A 3LXRA 4OAQA 3OCUA 4EH1A 7GPBA 3A1VA 5CFLA 3CVYA 5AJYA 4D8UA 1ZD5A 5I7AA 2F9MA 5IBPA 2BFFA 5EHQA 2ONYA 4LHWA 2OSBA 1KEZA 3ES9A 5FL7D 4LRWA 1TPZA 4RIEA 4US1R 4WFKA 1MX3A 3R9XA 3HN7A 3ZY6A 1W6RA 2VJBA 2PZ8A 4NH0A 4Q4AB 3RS7A 5L6MB 3C3JA 1PZHA 8MHTA 2JA2A 5TMPA 2X8LA 5I4KA 3ANSA 3CXRA 3OIVA 3SF8A 4U7TB 2QUIA 4OH7A 3WK8A 1M10A 4J16C 3KO8A 4QXQA 4LGCA 1FVOA 5JNVA 1JAXA 2DR2A 1MJHA 5U9CA 1SOWA 4JBWA 1I7DA 1A88A 4L2IA 1MOQA 1LTQA 3LP6A 1WB4A 1QGAA 2GR9A 3G5AA 4EO9A 2BGWA 4Q7MB 4ML3A 4G9GA 1ZUIA 4G8JA 1Y5MA 4P5EA 3ZGVA 1XO1A 3N2NA 3WL5A 3URMA 2GCPA 2QZSA 3F5MA 3N8NA 4Q6WA 3KZMA 4Z99A 3GRPA 1MC4A 2MYNA 3THWB 3I5UA 3VJRA 4NU8X 3Q7RA 3TE7A 2HBRA 5FWYA 4J9UE 1AV7A 3R1IA 3C3PA 2I2AA 1DCTA 3L4EA 4J3JA 1P60A 2A0UA 1YVPA 1RQ7A 5JRDS 1RZRA 2NTNA 2BMVA 4OTZA 3GAAA 5CMLA 5KYXA 3RAEC 4C76A 1GPLA 1J20A 1NVMB 2NT4A 4E2XA 4S1TA 4RJIA 4NEHB 5AM4A 2J3MA 3MRXA 2V7GA 3CLHA 1QLWA 1QIMA 2PS0A 1C3XA 3UUEA 3VZRA 5EJGA 3RUFA 1XPOA 1IXRC 1C8VB 2XUQA 3HA3A 4MKZA 4TVBA 3TZQA 3V4SA 2GZMA 3B1YA 4P3KA 2IX3A 1XVVA 1IEVA 4UE2A 4KRGA 3QF4B 3RUCA 1Y5RA 2C9MA 1OZ0A 2GEJA 1QRSA 4HGZA 3R40A 3AEUB 3UT5A 2JKZA 3B53X 1XTVA 3HWRA 4F3NA 3K71B 1YB4A 3MQFA 2R8XA 4ZMSA 5AKJA 4CF3A 3LQ1A 4G5OA 1G5RA 1YRBA 1QFXA 1VJGA 2DE0X 2WVJA 4UUNA 5K0NA 1SA0A 2ID7A 4DAOA 3SHFA 4I99A 1D6MA 4IXNA 4X7PA 3X44A 3REQA 1G8GA 3AR9A 3HKDB 2ZVQX 4H1UA 1HE8B 3HVUA 4MVJD 2BGNA 4G2NA 1KGSA 2XMCA 3UB3A 4EVIA 3R4VA 3PU6A 4U8HA 1R18A 3WAJA 4E7OA 4OQPA 3AU9A 4NZNA 2AG0A 1HEYA 4WK4B 3UJHA 1L1QA 4WIAA 1JSZA 4LBZA 3G2LA 1N2GA 2FN9A 4ID3A 4M9RA 3IP9A 3N5KA 3PXUA 3DLBA 4BXOA 1P9WA 2HIAA 2L2QA 4ZVLA 3VKVA 1LLFA 1PGOA 4J7CA 4KQWA 2WIGA 3OH8A 3B1KA 3FDJA 4IIHA 3UUWA 2FG6C 1I24A 3ONNA 5CJPA 2EATA 1GGHA 2IXAA 3GNLA 5CFZA 3T1TA 1QAOA 3KAPA 3M6UA 2AFIB 3DEAA 3H05A 1YKFA 1QRDA 4LPKA 4QQ8A 1Q7TA 3IOBA 5FHQA 4YXFA 3J81A 4NV1A 1KZHA 2O0KA 3RHFA 1QGDA 2IE8A 4K6OA 5JH7F 5TJ9A 1FSPA 4AKIA 2JEYA 3T35A 2GAAA 4F4HA 1GAWA 3B36A 2AB0A 3Q10A 5IC5A 1E8MA 5CXXA 4HOYA 1YOBA 4MVWA 1E3LA 3COPA 2B8JA 4PXSA 1IQPA 2EWWA 4MW1A 4IOMA 3FNGA 3Q2IA 2BFEB 2FLKA 3QEMB 1JA9A 2GZDA 4LA4A 4OXQA 4XD7A 5DOZA 3NNNA 4AS1A 2YY5A 1M7BA 4Q4HA 4Q21A 3RVOA 1TA0A 2DQYA 2I3BA 4PU0A 1QLJA 3VC1A 5LQNA 5ARDA 3PC4A 5JD6A 5HYVA 4PN3A 4IDCA 3UHPA 3QKTA 2CXXA 2F1HA 2O2IA 4MO2A 2E4XA 1T0PA 2K2QB 5DGTA 5FAXA 1YJ8A 3FVVA 4FIDA 3CVOA 1H23A 1GARA 1S8NA 1J0BA 4AM8A 1TMYA 3ETEA 2C2MA 2AN4A 2O8EA 3HR8A 3ZE2B 4DQKA 4HNUA 5K6TA 1JIQA 1G20A 1PHPA 1HMPA 2C58A 1MORA 3EQ8A 1QIIA 5A7HA 1ZUD1 3RG2A 2VRNA 3V5NA 4M0CA 5JAIA 2UUBB 3H1TA 3TBFA 1RADA 1XPJA 1D0SA 1JIKA 2X5OA 3IEMA 3A9WA 1PQPA 2G7ZA 2XOXA 4IIJA 4EMUA 4A10A 1RLIA 2X0RA 3P9NA 2WT9A 2D8AA 5JXIA 3STVA 3TG8A 1VL2A 2ZBVA 1XLVA 3AR4A 1P4HA 3DL4A 3NBMA 4D25A 2ZSFA 3GLQA 4MUJA 5K9ZA 1J2JA 4H15A 4H7HA 4D9JA 1KDVA 4MYTA 4IWNA 5KAMA 3UVEA 4LDPA 1RABA 1D4FA 4W99A 1T8TA 4ZKEA 2NYRA 2PNJA 3ERCA 2OC9A 4RFVA 4AAYA 1F1JA 3O74A 4RTOA 1Y7HA 2JHFA 1V8DA 2SHKA 2XVZA 1J0XO 3NRBA 5EIFA 1THTA 1SHJA 2OAEA 4UTZA 5T41A 4RTMA 3SI7A 2P9YA 2ONZA 4FFPA 5EIOA 4F6RB 2PL3A 5DCYA 2BM1A 2ZJ7A 3AF4A 4ISBA 1NJ5A 1V1JA 3K15A 1FDSA 4PPQA 3AB7A 5CR9A 4EK9A 4ARIA 1K3UB 4UW9A 2E5LB 5AP9A 1ZCJA 3R3XA 4JSRA 4GUDA 1NMZA 2G0TA 2QW1A 4HP8A 3S1SA 2O7NA 3QFCA 4HUQB 2IWRA 3ZUPA 2MINA 4EFNA 3ZWCA 5CDFA 1I8TA 4G1BA 3IVMA 3DMTA 5ALUA 2GFIA 4RVOA 2BFCA 4J29A 4WKBA 5DEOA 5AD1A 1TQ8A 3PWTA 4JP2A 1E7RA 4UUBA 1H6BA 4XVQA 4ALMA 4CLHA 5HS4A 5FUVA 5LD2B 2Z56A 1M1ZA 3CG4A 4RMGA 1KPGA 1FMFA 3NM6B 1NBEA 3VOBA 5TB5A 4AYWA 4RS4A 2GCOB 3WRYA 1RM5A 4YRMA 4K9QA 3W04A 2G5CA 5LQAA 4BCBA 1KAMA 1WQ1R 1QORA 4GOKA 5L3SA 5GJBA 1T6YA 2HIMA 4UFOA 1DLJA 1CQPA 1UDRA 4TWJA 2IYSA 4QICA 3C1TA 4MRMA 1SM4A 3BG5A 1EFHA 1Z2AA 1YD7A 2W6MA 5J5VA 4D7AA 3U5TA 1W36D 3SFTA 1J9GA 4YDHB 3I9JA 4ALNA 4R8KA 4ZO7A 3R3ZA 4D3XA 2OCKA 4BL5A 4IJQA 5HKKD 5A3VA 1IQUA 1UT6A 4UNPA 2IPXA 3MAAC 1E9DA 5A0FA 4CL3A 4OMCA 4RK0A 5KU7A 4BP8A 3STYA 4JLMA 4HLUA 5D01A 3V46A 3V8PA 3X1ZA 3ILHA 1Z5GA 4FQ7A 1SUAA 3N86A 2WZBA 5E7MA 4BU0A 1ZRMA 1KQFA 1ID1A 3HBMA 3IEXA 5F7JA 4FJ0A 5DNDA 3A1WA 1A9QA 1UFRA 3TKAA 4N0DA 4KH1A 4GPBA 5LNK1 4B46A 2BBWA 4RD6A 4JX8A 3RRFA 2EQ5A 1JR3A 3GC6A 1Y1RA 2XNDA 4FNMA 5M2QA 4J0KA 2LIPA 5CFPA 3NRJA 4C4ZA 1F4LA 2VK1A 2ZSHA 2B8EA 1BQ3A 2PT6A 3LKBA 3T3NA 3TZKA 1Q16A 1D2GA 1PJ2A 3KEOA 4MUEA 4PSDA 4EHNA 4M22A 4PC6A 2DERA 4LWQA 2NV0A 4M4SA 3RHTA 1A5ZA 1L5NA 1QIJA 1AOXA 3ZNPA 1DBRA 1DMSA 4I4TA 2A1UB 3LX6A 4MB0A 4P0TA 1UZLA 4DT1A 4BO6A 2VDLB 1FQOA 4HDKA 5CNIA 1ESDA 3TQCA 1WUKS 3VSEA 5DIZA 1NV9A 2FP4B 4RVHA 3ZHOA 3DYBA 4JKIA 3IR7A 2B99A 2CY0A 1XXLA 1XAGA 5FI1B 1UEIA 4YJHB 1N7JA 3D43A 1QYCA 1YMUA 4V38A 4CMEA 1N8NA 3ED1A 3FOWA 4M1ZA 4YUYA 5AQEA 2QTNA 3ZZUA 1WBDA 4PXYA 3DFIA 3ZV6A 2WJPA 1L4NA 3GXBA 4R9VA 4INOA 1OFUX 3MCAA 2B4AA 4AECA 3TLGB 4LN1A 1IB6A 2G72A 4MIEA 3E5HA 1NW4A 1ZK2A 3MOIA 1A71A 3KUUA 4U6NA 2VUTA 3OTGA 4M60A 1WIWA 3FH0A 4NRDA 2HCRA 4B79A 3PPVA 4FT2A 5EY5B 5LN1A 2OENG 3OFSA 1XDDA 3R3SA 2ZE6A 4B6OA 5COBA 2PMWB 4JR1A 3VO1A 1ML3A 3FNEA 1ZCAA 2WTEA 3DV0B 3GAZA 3VBCA 3JU3A 4O29A 2IV3A 4AS3A 4DG8A 5MGBA 1WQ3A 4G1CA 4AZ3A 3AGPA 3L82B 2TRSB 2ZI9A 2XI4A 3SQDA 3EH2A 1T4MA 3DFZA 1X19A 2EW2A 4KN6A 1L3CA 3QU4A 1FX0B 3ZGYA 3BWBA 3MT0A 5K3SA 4PAWA 4TMKA 4CR6A 1KEEB 1YHNA 4LOKA 1QGUA 1ZSNA 2G5PA 4BFUA 3D7RA 3VR6A 4U63A 1RRKA 1RTKA 3OC0A 4KAJA 2G28A 3OECA 2XB2A 1QHGA 3G6WA 3YASA 2FF5A 3A14A 3ZU3A 5HSGA 4YHBA 3NI2A 5FO0A 2Q5IA 4YQFA 2ZE7A 1P2SA 2CFSA 4PZAA 2W8ZA 3BMXA 2QVGA 2JARA 4BU1A 1FU7A 4Y2VA 2WD8A 3D2AA 2D5AA 1O58A 2FG5A 2J4CA 1T29A 3ZCPA 4NZPA 2ZWPA 4EVQA 3GV0A 3I9FA 3PDUA 4E11A 1CG6A 3B3JA 1B1AA 1GWNA 3L0PA 5DGCA 1LK0A 1WL8A 3OM1A 5EYPB 2XGSA 1H5QA 3ZHZA 4EB3A 1KBOA 1QM5A 1TMGE 1XEFA 2MSCB 4GVXA 5DT2A 3K0CA 4M2LA 3RU3A 4IZIA 4UOEA 1CZNA 1EFCA 1GV1A 4RXUA 2C96A 5JECA 2PH5A 1AHIA 2VJKA 3D3KA 3DT9A 5FHRA 1NXWA 1P2DA 4Z4EA 3VX3A 4Z4QA 4F3YA 5FBHA 4MGIR 2PH7A 2XNHA 3MTQA 3SZRA 1V71A 3LC0A 1TVMA 3ECAA 4PR3A 2QN1A 2EJVA 2HIHA 2ZAYA 2Z4RA 3K0KA 2E1PA 1LC3A 1Y6QA 2I2CA 2B8TA 3KQWA 1VLVA 3BQMB 1CRQA 4KPFC 4DF3A 3DH0A 4TRMA 4I5FA 4WA8A 4CKWA 1UBLS 5FF9A 3NPMA 2X9VA 3J81k 4P34A 4DV6B 1CCWA 3U3KA 3KCQA 2QPLA 3RYHA 1D6JA 1T26A 2FZVA 3IYLW 1YASA 1U3GA 1XZDA 3RUDA 1YNOA 1J8QA 4Y2QA 2FK8A 4X7BA 3QKRA 4MW0A 5IC6A 1EEHA 4CG1A 3IUYA 4LE1A 2Q8PA 3SS7X 3M4NA 5AW0A 4OGLA 1JALA 1LQTA 3LY9A 4UUAA 5DHFA 2UUOA 1I80A 5J9FA 3QOXA 4TTJA 4JD5A 4NBUA 3Q3VA 3C0KA 1QYRA 1RLUA 2HMWA 3ILXA 4TLDA 1JHQA 1HYQA 4YDSA 5CFRA 4GYWA 1E2PA 4JUFA 5DHUA 5DKFA 3U7JA 2K7ZA 4AVYA 3RKRA 3TQSA 1CR2A 3DBLB 4RTKA 1O6GA 1YL5A 4F60A 3UOWA 4XX0A 3EXEA 1QYVA 2Z9CA 3UIEA 5HUHA 3CRVA 4C4PA 3UKJA 3HXTA 2CLCX 4HRXA 5T57A 5JSZA 1JEAA 2C99A 3FUTA 3IDFA 1HXHA 1X13A 5E6UB 1UMDA 3KQUA 1CUHA 3OICA 3HO8A 5B30A 4D9FA 2HLHA 2FEKA 4RV5A 1L7EA 2QRQA 2VTVA 2QROA 3IRVA 1DTWA 3TBKA 5HOEA 4XSHA 2EYUA 3GD7A 2QTLA 3PSHA 2QM0A 2WPDD 4TM8A 1V9CA 4KSCA 2OYCA 1ONBA 2ST1A 3DZIA 3ZWOA 4PHFA 1GITA 4G0PA 4ISCA 3DVAA 1IN7A 4PHGA 3W79A 1E3TA 3RAGA 1PD1A 4BFTA 2C03A 2LE0A 2QTFA 2HLNA 4Y6GB 5J1SB 4U0KA 1EXVA 3BK7A 4ZVNA 3KEGA 2XCQA 1CQZA 1KU6A 4UPEA 2CXOA 5DN6D 2BGTA 4DM7A 1GTVA 4O4IB 5BV8A 2AV6A 3DPIA 4OAPA 2FKAA 4QE3A 4BDSA 3W1EA 1DQNA 5FOTA 1ES9A 3HVJA 3S8YA 2BGUA 2O5CA 3M5DA 2Q2WA 2ZU6A 3WAGA 4KJZA 5K99A 4C5AA 3Q8WA 4IILA 1AY0A 4DDHA 2VHTA 4L5AA 3CUYA 3UQZA 5F76A 4N6GA 5CDHA 3JYNA 4BMZA 5FQOA 4GWGA 1SRRA 1E6LA 1OA1A 2O2GA 2VYVD 2Y3IA 4G2TA 4JB3A 4M0EA 5A0TA 4HN2A 4G26A 3F67A 4OMUA 4ZEXA 2HX1A 1M2OA 3OX1A 3VTFA 4YMTA 2OFWA 4LSGA 3AVTA 1ZD3A 2PJDA 3THXB 2RHGB 2W2KA 1K7XB 1PJBA 1T5BA 2UZ1A 4X00A 2NZUG 3SMQA 1N8TA 1ADGA 1J6UA 2J7PD 3WHLA 4F12A 5JMTA 2YQ4A 1TJ4A 2Q5EA 4G81A 1JVBA 2JK0A 1PJCA 3VR3D 1K89A 2ECQA 2IU6A 2VWPA 5AKLA 3ST7A 2FN7A 4RTSA 1GU7A 1ZN8A 3CF6R 1ZZEA 4RC9A 2DLNA 2YXPX 3LUDA 3ZUGA 1IRIA 4JLAA 1K27A 1OLXB 3TIGA 1BHQ1 2GK4A 3P9PA 1SUPA 4WY5A 4X60A 4LW8A 1ZOIA 3JQAA 3TOXA 1KEWA 1NFRA 1F9AA 2IEAA 1NQVA 2C2WA 5JD4A 1U7WA 1V1RB 2KLBA 1OI2A 1RBMA 3TN7A 3FTPA 4Z0NA 1XZKA 1MENA 1SBTA 3HP4A 3OQHA 3DHVA 1BMFA 1POXA 1RIIA 1RHUA 2LNDA 1NOKA 1YJCA 1P1FA 1VSTA 3MVEA 4C5BA 5LMZA 1BOFA 1AD2A 1L1RA 1MAAA 4Q4JB 1DDIA 3TLYA 3QOFA 4QODA 2H0QA 5TC4A 3ZI4A 4C07A 3MJ4A 3L0SA 1KJZA 1E0KA 1U04A 1JPVA 3E8SA 4HH0A 4M87A 4DC9A 5DIFA 4GC9A 4QAJA 4R6WA 3C6XA 4MP6A 1FW6A 2CK3A 3D6FA 5AVZA 3P2IA 3NBUA 3VBEA 2TS1A 2FVYA 4KQEA 3K5PA 3Q2OA 4Q7JB 4UEWA 1TB4A 3TDMA 4BNXA 5CU7A 3AKYA 3O9ZA 2ONJA 4KLCA 1VKZA 4MJLA 2WKRA 2W2VA 2ISQA 4Y9TA 5G1OA 1KMCA 3SIXA 3P2OA 3KNZA 3PUHA 5H3LA 2ZAIA 1M6NA 2P8JA 5AXCA 1LU9A 2B37A 1NE2A 3EUWA 4XWYA 2YOGA 3ROGA 3B2NA 3HCAA 3I64A 4LWOA 1JAHA 3GUYA 3NWJA 5JTTA 1Z5PA 1J7KA 5K6AC 3SVTA 2QY9A 1RZ3A 3WDKA 4R0VA 5GONB 4M0KA 5AXDA 4AQ7A 2GM3A 1EE1A 1Y3IA 1ZNXA 4K9NA 5DGXA 1VPLA 3KZ1E 3UK6A 5FR1A 2UYGA 2V45A 4C3ZA 1HRDA 2DCUA 4B3XA 1A97A 1TVCA 3HEBA 3P0FA 4O4HA 2X5KO 4PRZA 5AHRA 3KXDA 2O59A 1SIOA 2IOHA 2XY4A 3NEPX 4KIWA 1N1GA 4O3FA 4MSUA 1MNQA 2I2FA 3R8XA 1E18A 7REQA 2PLFA 3OWOA 2A5DA 3R2JA 3BZUA 1K6IA 1PG0A 3MF4A 4TKVB 5DBEX 4X66B 1FYFA 1PK9A 3OQMA 5ETJA 1Z68A 3J7AC 3QE9Y 1Q3KA 1WZNA 3QH4A 4QQNA 4MB6A 5CH3A 3KU1A 4M9QA 2E18A 4GM1A 3FCYA 3RC3A 1YFKA 3QU7A 1ADFA 1Q5PA 1Y1LA 2FEOA 1VBKA 5JT1A 2YVKA 3MJVA 2GARA 3W7VA 4WPGA 3LYUA 1SURA 2CNDA 3BEDA 4CQLB 1DS6A 3N70A 3U48A 4AUKA 2UUAB 2G5TA 3RJZA 4OKNA 1FFBA 4ILEA 3KE8A 3BIWA 4ND4A 2GWHA 4AJNA 5LLDA 5DW0A 4BMPB 1HYGA 1W49A 3KB1A 3L8YA 1QRUA 2QT1A 4OV6B 3G2OA 4R8MA 5AW1A 2AFIE 2HZ7A 3P8ZA 2R1VB 2H8GA 4WBXC 1N3YA 4I7EA 4Y6LA 5DXAA 3WZMA 4LSZA 2PA0A 1X7WA 3H04A 3WRWA 1XRMA 3AVOA 2AL7A 3GR6A 1XDBA 1AUOA 4MARA 1US8B 4ZOBA 5KOIA 3JAWB 3NT4A 4BZXA 1UPAA 2YHSA 4B4WA 2AG5A 2VQ6A 4HO1X 3QVWA 2C8LA 3GJ4A 1FTYA 2SCUA 1M83A 1UKBA 2OBYA 4P3XA 2OXRA 3CXUA 2MYPA 2NTJA 3RQSA 2WSMA 2VJCA 3H2HA 4H08A 4Q48A 1IY1A 1Z6YA 2Y0PA 4X5OA 4HAOA 3ABRB 2PGOA 3M89A 5K5EA 2OCLA 5IN5A 3ZI0A 1VPEA 5I9LA 1X9IA 4PLYA 4YMGA 3A2NA 2C9YA 1G9XA 1JH8A 4IL5A 4XUEA 2YZ2A 3SZMA 3DHNA 3PTZA 3GDOA 4OLFA 2HSJA 1IEXA 2NO4A 3CMMA 4I5EA 4I8IA 1J2EA 1Z6XA 5IYZA 4ILKA 2BEJA 2BHSA 4RAOA 5FUWA 1SXPA 3EXG1 1FUKA 1LI4A 4MR9A 2JI4A 1RYMA 4C7MA 4BN0A 1RYYA 1XVTA 1AF4A 1ZRHA 5ECGC 3RRNA 4IMIB 4EENA 5LOVA 1KWGA 2NSYA 4NE9A 3O8RA 3FCOA 2FG7C 4B6RA 1JDNA 3LPDA 3AM5A 3L7CA 4WW0A 2NZYA 3IUQA 3I30X 4DCMA 1WXXA 2C77A 3EVDA 4R98A 1JFLA 3TOZA 5KQSA 1J70A 3WNVA 3ZV3A 4F72A 1TF2A 3QVMA 1HDYA 3MWEB 2OHHA 1XMQB 1LW6E 1YB6A 1Y82A 3EA4A 1V48A 5DLEA 2BKXA 2GNAA 1NN3A 1WUTA 2RK6A 2OQIA 3DJYA 3O92A 3GEEA 1EB9A 1M76A 2ZRJA 3JD0A 4JY7A 1RC8A 4NYMR 4BO0A 4Z0HO 2A4KA 3IPLA 5AVUA 4EW6A 4JEHA 4MRSA 4IIJF 5HFJA 3PIIA 3HKCA 5KX5A 5LL6P 3L05A 1C9EA 5LMUB 3O31A 1GADO 4CEJA 2PTHA 4JV5B 5JDCC 4EP1A 3AHEA 4Q5IA 1TGYA 1I3MA 3T1VA 2XAAA 2M6LA 1P4JA 1FRVA 1WSWA 4ZO8A 1YOVB 2IP1A 4FYYA 4JLVA 4HLNA 3FA2A 1T2NA 1IQ0A 3AOEC 4L4UA 1GNTA 2YHIA 4BRUA 4CIBA 3BMNA 3ROZA 1IN4A 2GO7A 4M9ZA 4X85A 1KS9A 4I50B 3IXLA 4MJ7A 1U8YA 5JSYA 3RFVA 5MFZA 2V0NA 1GZDA 2JEZA 4R8VA 4YAJA 3KKLA 2RHHA 2A9OA 2IHUA 2Z2IA 3GX1A 2WAOA 4G3XA 4YRTA 3L4SO 5TEVA 4E03A 1BA2A 1X1EA 3HI4A 3TVTA 3UXYA 2N46A 3ZWWA 3WAKA 4ZU3A 4MROA 1VLHA 3NAGA 1AE1A 4LZLA 4GKJB 3T5TA 2C5EA 1EESA 3O95A 3KWLA 1IHDA 3QVUA 5HK9A 4MR7B 5HX7A 1JJ7A 2OPBA 4D3YA 5CNKA 4LY3A 3GGSA 5L7WA 3KK0A 4GLBA 2QRHA 2NZXA 4Y2HA 2ZUDA 5DLPA 4O2AB 3MIZA 1P7ZA 3I1YA 3CF4G 1W34A 1RSZA 1XCOA 2BMWA 2B78A 4G36A 1HURA 4URFA 5I45A 1T13A 2DY1A 2R86A 3K0SA 5K8UA 4M0DA 3TS1A 2ZT7A 4HNAB 2JIQA 2D4AA 5LIPA 1EZZA 2V6JA 2JLZA 2B4YA 3AW8A 3F2VA 2QJRA 3K30A 1AKYA 3U3MA 4RK4A 3Q1LA 1G7SA 1YR9A 1AKWA 2C78A 3B70A 2EL7A 3A4VA 1ESZA 2CWWA 2Q6KA 3HBJA 4YJ3A 1T0HB 3NV7A 5HCIA 5KKNB 3EW7A 3TVYA 4DMHA 3GCWA 1U7XA 2QMEA 3GGDA 5CT6A 5IAGA 1JEJA 2CFCA 3NUGA 3ROXA 3SZLA 1HSOA 3B9RA 2AJLI 4QO7A 1U7DA 2PRYA 3LCVB 3EZ9A 4BWFB 3GT0A 1LDBA 3ONFA 4WESB 4D97A 4E51A 3FCAA 5EIHA 4KDEA 2Z2XA 4ZK2A 4XIGS 2OGWA 4Y3UA 4GVPA 1T8UA 3EGXB 4YP6A 1NLZA 3V1LA 4PX9A 2QE6A 3HYSA 4FE3A 1N9ZA 3NVMB 4NMWA 4ENVA 2EFCB 2I4IA 3R3HA 2QQ5A 1DEAA 3AFMA 2FSHA 3PJEA 3R74A 1CZHA 5G1NA 3F74A 2JLCA 3U81A 1HNXB 1S0UA 4A3SA 2YIVX 2WWXA 4I9GA 4UHJA 4D9NA 1KYVA 2I65A 1UH5A 4CBVA 4HZUA 2A9PA 4E07A 2ZRAA 1YRQA 1JZTA 3TMAA 1B2RA 4P0QB 1PU2A 1YI1A 3CS3A 5A0VA 1NDHA 2V4MA 4O0MA 1FE8A 2I7DA 1XRRA 3AWDA 4L7VA 1YQDA 4R54A 3WK4A 4W5NA 2CDBA 1KMNA 5KWVA 5FPPA 4X6UA 3K3PA 4B7AA 3NZEA 3CPHA 3WKDA 1ODTC 3S2YA 2HDNB 1YXMA 5IVDA 1TM7E 3CRRA 2B9VA 3SQOA 5B36A 2GJ9A 2OE2A 3P4YA 1Y3HA 1CY2A 1XRJA 2PX4A 4X93A 5ES4B 2GEBA 1AUXA 1DJPA 3QVXA 4G09A 1UP6A 1W5TA 2PKQO 5FI5A 5AT1A 5K8JB 4I4TF 3PQDA 4JQZA 4XGNA 3ICWA 3AJAA 3R7DA 4QG3A 1AQUA 4YECA 5JSKA 4HBGA 4M8NE 4PYJA 3SBEA 4H60A 4NJMB 3UWSA 5IG2A 1OAAA 1OHHD 3MM4A 3AEQA 3CRQA 1V41E 4GU5A 4QHSA 1CQWA 3RFTA 1NBMD 3CCCA 1S89A 4UPVA 4ZZ1A 1N36B 4QDJA 3H0EA 1UPFA 4OYRA 5AI0A 1YS1X 2WYWA 5AVSA 3OFJA 3GJRA 3JAMA 2BMJA 3FJOA 3PFHA 1NMSA 3A10A 1YZ3A 2X9LA 2RG7A 5E8JA 2FJUA 3HH8A 4KTTE 5KVSA 5LQUA 1OXTA 3NEJA 5G2OA 1GG2A 1NT2A 1XMXA 5MHTA 1VSQA 2OM6A 2WDPA 1R0XA 3QYFA 4G6ZA 3A4MA 4QVIA 3GA0A 4ZVVA 2H1IA 3DC7A 3H5OA 4HXFB 4MB2A 4ZI7B 5J4HA 3I3OA 5CB4A 3TFOA 3R4CA 2EP7A 1YV9A 1HYEA 2G67A 2I1VB 3AO0B 4RSMA 4D74A 3ZQ6A 1LDYA 4GSLA 3WX0A 1RFLA 3ZZ0A 3JQFC 4CMCA 2ZB3A 1YQXA 3ICOA 3Q3GE 4TVOA 3UMGA 3IA2A 1QDLB 1XEWY 5KB3A 2CCKA 3G2IA 2EJTA 5HIAA 1TM5E 4HX2A 2ZIZA 3PC8A 1U3DA 1GG9A 4N6OA 3RVBA 3RRJA 4HDMA 4L28A 4ZEWA 2VP0A 5ILGA 1OI4A 4BWYA 1L7NA 2IOQA 1KVSA 2RAUA 2JFOA 3L0DA 3QXCA 4F2WA 3C70A 1C0PA 3VO9A 1H8HA 3BMCB 4AO8A 1XWWA 3DJFA 4X97A 3RQIA 4BZQA 1K6MA 1DFHA 3DOCA 1G2OA 3BX1A 3D6UA 4G1MB 3DW3X 4K3VA 3HB1A 2GOYA 4ZEVA 1E6MA 2YYSA 4IUCS 1TM2A 1YL7A 4M0LA 3GLFB 3IB6A 1XEXA 2YV1A 1QC5A 3AUJB 1QH0A 4CU2A 3WJ2A 2PZFA 1P0PA 2MSNA 4WNCA 3AHDA 4B3JA 3AF5A 1W5SA 2I3AA 1X86B 2WIFA 1AKNA 1MB9A 4PQGA 1B6RA 3CVWA 1W4ZA 2G40A 2P27A 4YRRA 5HQ3B 1NX9A 4OQYA 1X9GA 3FYUA 3CKKA 1TLLA 3M9XA 3OLVA 4JOBA 1HG1A 4G4GA 2FW1A 4J2TA 2PMFA 3SC2A 3HJTA 3MWFA 5E2AA 3EZXA 1XMJA 1CUXA 3RJTA 4AC9A 5DTMA 1E99A 3I28A 5HA5A 1V7PC 3C43A 3PJFA 3NHZA 1ZH6A 3B85A 3EEBA 4PLVA 4DXDA 3K0FB 4FNGA 4X20B 4GPAA 2NSDA 1D4OA 2QN8A 4H6PA 2H2WA 3RM3A 4P3NA 3HFRA 4Z9XA 4YRKA 2X6QA 3KVYA 5I9BA 2HWXA 5CT4A 1H2HA 1KYWA 1P0MA 3A1CA 3L93A 1ZN9A 1EK0A 4UEKA 4ZOLB 2IVZA 1C9NA 1N5OX 3HV0A 4JYCA 3UMCA 1A4IA 1WAMA 2PGAA 1V95A 1BMDA 3EK2A 3HWSA 2BTQA 1C3JA 1U1DA 3GY0A 5AIAA 4DUPA 3QJGA 2GJ4A 5C8YB 1DG3A 1SVSA 5BSWA 3H8SA 1RE0A 3Q7EA 1ZU5A 3EEYA 2O19A 1NF2A 2IF2A 6REQB 4DIUA 2IXTA 2QTZA 2OCYC 4IRXA 1PEDA 1B0PA 2VYND 3D2BA 3FAKA 3RVDA 3S2GA 1QH8B 4FS8A 3K70D 2AEJA 3BGWA 2VG8A 3PUKA 4RLSA 4Y98A 5FOSA 1JV2B 2XOKD 2FP3A 3U7QB 4QM7A 3H1FA 4PVCA 3AIOA 1MAHA 1REQB 2AKYA 4RU1A 4IHJB 1IE3A 1Y8QA 4DABA 3T4EA 3EPLA 3OQ1A 1QQ7A 1X92A 2EKLA 4YYZA 3TQRA 4CGZA 1TO1E 3MTDA 2HUNA 1W29A 1GPYA 2X22A 4HRYA 4L9RA 4C4TA 4RIHA 3IVRA 2BGGA 1I0LA 4D3DA 1L1FA 4IF6A 2AR7A 3BRSA 2X0FA 3ZJVA 3I2JA 2XZPA 2XQJA 5JAOA 3HKEB 1DWPA 1KAQA 2I2WA 1WA5A 4RZSA 4UBNA 5DCWA 4AQYB 4G0XA 5SV2A 3HU5A 2FI1A 4YFVA 4IVPA 2P41A 4O4LB 3ZVRA 4Z1OA 5JCZA 2O8DB 3SZGA 2W93A 3ASZA 3CZPA 4QATA 4REMA 3G3EA 2GERA 3CUEF 1BKSB 2CXHA 3D3WA 3E7WA 4UEJA 4CLRA 3D7LA 4ZYZA 2XUKA 2JLSA 4KG7A 4Q9DA 2VTKA 3VNAA 4H35A 5JQGB 2F1RA 1M74A 2HWYA 4MS3A 1CY4A 3NNSA 1EFTA 3ANLA 3R77A 4QU9A 1DRUA 2XTAA 1LRJA 1OF1A 4KE8A 3Q7IA 2FR8A 1GGNA 3GFPA 5T8KC 5GWXA 3W0LB 2VA8A 4B74A 5AOBA 3C7AA 1LSJA 2Y9MB 4HFMA 1JEYA 1CUEA 2NWQA 1P1CA 1XAHA 3BRWA 3OFVA 4ZU1X 2QL6A 1KZ4A 2I6QA 3BJMA 2FX2A 2V6GA 3CUSA 3OG9A 3OE1A 4NR0A 1W73A 2IKQA 3T4PA 4CNQA 3QV1A 3UEOA 3PNOA 4YCLA 1Q0LA 1OXVA 1DCMA 1U3TA 2QQ0A 3KQSA 2HUPA 2WWVD 3RBXA 2AJ8A 3PHBE 1Y9ZA 3CFYA 3NMUF 2G71A 2ZVDA 2PXHA 4UHBA 2OZVA 3PFFA 1TAUA 3B6KA 3HDVA 4BKQA 4ZV4A 4PX5A 1Y9EA 3CLVA 2IXBA 3VVBA 5HJ7A 4TZ0A 1VI2A 4FWBA 2P7HA 4BASA 5IJXA 3I5AA 2MTBA 1SC3A 4P7GA 2FEXA 4Q19A 1VZ2A 5CIWA 4EFKA 2E0IA 1X7YA 3C7DB 1UBMS 2NSLA 1SQ0A 1XD9A 2CFTA 3X0DA 3CURA 3IMGA 3G5UA 3O9MA 4UHEA 1PT8A 3KQMA 1PJRA 1U63A 3M2PA 4FYKA 1AS3A 1DKQA 4RA6B 3VPAA 1WBJB 2ORVA 4MV8A 3F2IA 3H2IA 2B83A 4E31A 1IEQA 4K1LA 3O21A 3NKLA 3MBOA 5FBLB 3KQNA 1NT4A 4GL4A 4YJGB 4D4GA 2HA0A 4KV9A 4OHYA 2JGJA 5JXWA 4RQTA 4KR7A 1JZSA 1U90A 1TZ2A 5CVDA 2VT6A 4QJBA 4LYHA 1GLVA 4B4VA 4S05A 1Y5LA 2YW9A 2J0QA 2I8AA 3UCFA 3GNQA 1IM5A 1TO6A 2AHOA 4ZDIA 1GM5A 4RVNA 1EBFA 2PD6A 1FYEA 4UTNA 1V5WA 2PGJA 1TMKA 5BVGA 2BUBA 1H2FA 1KFBB 1T1GA 3QELB 4RD2A 1SD5A 2Z8ZA 2GFQA 3GJQA 4E3WA 1ZR4A 4GRDA 5EPOA 2Z8XA 3I12A 4FS3A 4PG6A 3T38A 3V4VB 2HY7A 3BGIA 3E9RA 3TW8B 3NFYA 4IJKA 5T4BA 4KMMA 2BZGA 2ZZKA 5EJAA 3TUZC 5AKKA 4CCAA 5D5PA 3K96A 3T4UA 1C3VA 4EHBA 1CW2B 3Q85A 4FMDF 1RBYA 3AP1A 4JWTA 5DM1A 2X58A 4JA0A 4BO7A 3D4IA 1QTQA 4HNSA 3ZGZA 2Q4DA 5JS7A 1D1PA 2X3YA 2QN7A 4OI1A 1H6AA 4RK7A 1I9CA 4RZXA 4RM2A 4D0GA 2G8NA 1T10A 2BKAA 3V9PA 1E1RA 3MAGA 3I1IA 3NYRA 4TQ9A 5AO9A 3TRJA 1KNQA 4D4HA 1GLGA 3CX7A 2EJCA 1VG9B 3LL4A 4NAUA 5AW9A 3EASA 4RHXA 3TGWA 4HMPA 3UG6A 2XYPA 3LM8A 3WLIA 1EZ4A 4IQFA 1WABA 1PR4A 1XKTA 2HRRA 2ZRQA 1QP8A 2HEIA 4RVDA 4HQOA 3V4OA 2FW8A 3ZZ1A 4COOA 3UBTA 1NNEA 5D2CA 1TK9A 1R0SA 5KJ6A 2HD4A 1M34A 5AK0A 5LIRA 2XCIA 1E4VA 1NUPA 3F97A 4RTQA 2FFRA 1T4BA 3C1UA 4BMYA 2BONA 1WXQA 5DRYA 3HJAA 4HTAA 5ITZB 3ICPA 3DNMA 3OC6A 1UJCA 3SJZA 2H1WA 2GD2A 1LBHA 2VZLA 2IQ5A 3Q9LA 3OSUA 5CT5A 3R5KA 1Z4PX 1IZYA 4BDTA 5GINE 2AI3A 2ETXA 4EIWA 3IBCA 5KVCA 5G0TA 4L75A 1Z6PA 2CYCA 5FULA 1TX4B 3FFAA 3RSHA 5E7QA 3RSCA 2QZPA 1M1NA 1U3WA 5KCZA 3T3OA 3ZOZA 2C4MA 5KNDH 1EJ6A 1P61B 3P19A 1XRPA 3VJKA 5JW6A 4OIFA 4KEAA 5C53B 4HNGA 5LQKA 3AY0A 1A5TA 1VKNA 1VMDA 4XCQA 3MWDA 5K3CA 5TVKA 5IDQA 5JSQA 4DARA 1V3TA 3ZQ4A 3K2IA 4RKFA 2PPLA 3RVSA 3LIPA 2AI1A 5F1KA 1Z29A 5E3IA 4H7JA 3U0VA 2O2CA 4PZUA 3ZU6A 2G04A 2UYQA 1NBIA 4H6WA 5F78A 1JQEA 2N42A 5CB8A 3GBPA 4DEYA 1N1MA 3OU7A 4OLJA 1ZAKA 1FK8A 4K6KA 4L9SA 1OMOA 3U62A 3LT4A 1SUSA 5JG7A 3T4XA 1L5MA 1UFQA 3DBIA 5I8PA 3PPXA 4EG0A 3IJPA 1UQRA 5EWLB 1IM2A 4MMXB 1WETA 1LKZA 4HYTA 3AESA 4M83A 5F2EA 3HPQA 3G88A 2QLLA 3WRXA 4AIRA 3EVNA 4YMIA 3RO7A 4D5EA 1EJBA 2V7XA 2XYHA 1N32B 3I73A 1CNMA 1U4OA 1WUIS 1TZBA 2IHKA 2QG9A 5I7WA 3MILA 3RG8A 1NZDA 4II3A 1Z06A 1NC3A 2PJRA 2RKOA 2CLLB 3LD9A 1JHAA 4F1KA 2WHEA 3WB9A 3CNHA 3KZNA 2P1RA 3BERA 3BE8A 2CVPA 3Q88A 4PINA 4Q47A 1R64A 3NORA 5IULC 4UNQA 3TJZA 3UUGA 3W3AH 2OAGA 1GA4A 4JNKA 1XUOA 4B83A 3HN6A 1QO7A 1SKYB 3DBHA 3VI3B 1ZW6A 1S2OA 4B0PA 5BV7A 3C39A 3S2UA 2Y0EA 4OVKA 2GVZC 3V7UA 3DFKA 1HORA 4YCAA 2DECA 1FTQA 3GPLA 1ODIA 2QZ4A 2GUWA 2ZW9A 3HGTA 2H17A 2ZXEA 4G65A 2OILA 4OJNA 4HQ6A 3MT9A 1OBFO 3L8FA 1P72A 2H0AA 3EQ9A 3VO2A 4B2PA 4AZ0A 4GDFA 3WBBA 2H1OA 4S1NA 2GEKA 5DX0A 4HR7A 5IM5A 1UXGA 4MA5A 2RAPA 4B8ZA 3LUAA 1RYNA 3DD1A 1XZNA 4TX1A 4MKIA 5A02A 5IJWA 3EMKA 3WLOA 2BBSA 4RIGA 3N2EA 1PJSA 2FETA 3L8MA 3C8HA 5SZIA 3VSAA 3LBAA 5FP0A 3WK6A 5JC1A 4MRNA 5COAA 3R8FA 5DHAA 4ZVKA 1EVKA 2FFQA 1ODCA 3I45A 3EC2A 3LUCA 5KKCA 5KX5F 2CVFA 2HQRA 4RVFA 2F43A 3G6KA 1X7XA 4S0ZA 3SBDA 4DRXB 3MIIA 4G4JA 5B3JA 3EMDA 5IWCA 4P93A 2NMVA 1V7ZA 1OLSB 4FOSA 2VUUA 4I1SA 1CC1S 3UUFA 2XTNA 4AY3A 2EX0A 3W1WA 2VBCA 1FFGA 3PA8A 2ID9A 4PGHA 3OWXA 4DSTA 2I3DA 2FGKA 1T4CB 3PJGA 4YXWD 3DAHA 4MDEA 1KJQA 1PR1A 1T2CA 4LMAA 4UNRA 1R8SA 2V74B 3RVPA 2GEDA 3M4JA 1YZVA 1AV6A 3GEBA 1E2EA 4RK6A 1EX6A 3SE0A 2GZAA 4HPJB 4ZVOA 1ULUA 4MVXA 4OB7A 1WXGA 1YQUA 4MPRA 1UKAA 4ZGGA 1EP2B 3W5VA 1Y42X 4KYTA 2QU7A 2VDRB 1RU3A 2Q0XA 2XEXA 3FKJA 1PGNA 3VFDA 5AM3A 3PEVA 2L82A 1W1WA 2CNOA 3E2PA 3FYTA 4F46A 1SY7A 4XE5A 5BSKA 3S8EA 2YVLA 3GVIA 1MX1A 3ZNQA 2A94A 1GOTA 2VYFA 3MBKA 1L8LA 1PQWA 1WXDA 5TR9A 5DPMA 2ZYSA 4Z2YA 4Q00A 3UPTA 2H2AA 2YR0A 2Y71A 3KD3A 2Y6UA 5H02A 5ICSA 3QXSA 2FEMA 3IQZA 4U2FA 5D3ZA 4YV2A 4ZFNA 4MDFA 2BR3A 2I6UA 2EBWA 3ELBA 3IEKA 4PW0A 4MUAA 3PQEA 1JQ5A 2J9FB 5FOWA 5K05A 2SKDA 4DOMA 3N58A 3CLTC 4HV4A 4YJ3F 4DLKA 2TMYA 2FQQA 2R65A 1UZUA 3N1UA 4BP3A 2FLWA 1PR3A 3S5JA 4N0EA 3MFQA 3NDJA 1Y1KE 1Y8RB 1ZIYA 3I9V1 1OZAA 4W7IA 2QE7A 1M0EA 3C97A 3LXUX 1NOIA 1UDCA 3OQVA 4NV0A 5C52B 3NT2A 3A7DA 3HNRA 2YIDA 1D5CA 3ZCSA 3FCUB 5IAOA 1A8QA 2ABWA 1FP1D 3GUHA 3GT4A 5JOQA 4PNZA 4NMHA 4XRGA 2QPAA 1VSBA 1POWA 3SEZA 4EW2A 3F1LA 4JYPA 4MCHA 1TADA 4FFSA 4ZO4A 1C1YA 1SAYA 4MPDA 1DL5A 2CXQA 1CZLA 2G08A 5IBQA 6PFKA 3E3MA 2DOKA 3Q87B 2VNJA 3CNLA 2JNWA 3O8BA 4JNCA 1T36B 2JGNA 4ITVA 5H80A 5HOQA 3S7TA 1ZMBA 3VPFA 1C9JA 4MDYA 2QQEA 4JLJA 3P9KA 3EGEA 4Y0AA 3RC8A 3MJRA 4PO1A 4YACA 5BN5B 4BNDB 1LBEA 4YRQA 4IEIA 2VXOA 1M2VB 2BFWA 4EB0A 2Q3DA 4FZRA 5IUJC 5K0SA 4LVNA 2X0DA 2H52A 4IS3A 1OY1A 3OHMA 1OAKA 4Y1FA 1I51A 3VNRA 1MAWA 5TQ0A 4BN4A 3FNFA 4FGSA 3AKZA 4HNHA 1P9OA 1WCXA 5DSZA 3ZXUB 3QG1A 4EY7A 1O6ZA 2DFPA 3LX8A 3A28A 1DV1A 3LQ2A 1T34A 5P8WA 4TQGA 1TUIA 5CAEA 2JFWA 4MK4A 1MR3F 1XCGB 4FYJA 2V4ZA 1ZGGA 1T5LA 3IS3A 3C3WA 2AN1A 3U61B 3LWBA 3WP1B 3VU0A 4LY0A 4MP8A 5FFMA 5CB4F 2PUBA 3GU3A 3Q9UA 4O2RA 2G09A 1Q20A 1E3WA 2VJAA 3FB4A 3IPXA 1HGXA 2HXSA 3T0IA 3N6RA 3NXSA 1JHXA 4FK8A 3AQIA 4WGGA 1ZM7A 2L0XA 3CIOA 4DFDA 5CD9A 3SC3A 1ZIXA 3FPJA 4YJKA 8ADHA 4R83A 4FW9A 3BFKA 3RTAA 5KJCA 1NPYA 5BYBA 1KOFA 1MQAA 3OCJA 4II7A 4Q18A 2ZRKA 5GGYA 4AKEA 3ABOB 5KTOA 4MS1B 3MJTA 4F1JA 1EYZA 1MA3A 1D7OA 2G36A 1PJTA 2QY6A 3ISTA 4JVMA 5CM9C 5J58A 1KR2A 2AIR