1ZYRA

Structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic streptolydigin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation.
pubmed doi rcsb
molecule tags Transcription,transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 35
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1zyrA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1zyrA01
4YG2A 4C3HC 4G7HA 3GTMC 5M5XK 1Y1WC 4A3BC 4C3IK 3HOYC 2JA7K 2R92K 5IYDC 3FKIC 1Y1VK 2WAQL 1K83C 1YNNA 3WODA 2JA6C 2A69A 3I4MK 3HOXC 1TWHK 2JA7C 4C3HK 2JA6K 3DXJA 4A93K 3M4OC 1XPPA 4LLGA 3H3VD 1K83K 4QIWL 1WCMC 2R93C 2NVYC 2NVTC 4QJVA 5IP7K 4A3FK 1HQMA 3M4OK 3HKZD 4AYBD 5D4DA 4A93C 1Y1WK 3GTMK 4A3BK 1Y1VC 3FKIK 5TMFA 4BY1C 4KMUA 1SFOK 2WAQD 4A3LC 4A3DK 1I6VA 4A3MC 4OINA 1WCMK 3K7AK 2R93K 4A3DC 2YU9K 1SMYA 3RZDK 4A3CC 4LK1A 2E2HK 3I4MC 4KN7A 4LK0A 2R7ZK 1YNJA 3GTPK 3S2DK 3GTOK 2NVXK 2BE5A 5C3EC 3S16K 5C44C 1TWAK 2Y0SD 3S2HC 4Y7NC 3PO3C 3S1NC 3GTKK 2B63C 3HOUC 3PO2K 1TWHC 4XLNA 1I50K 4X6AC 4BY7C 1TWGK 5IYCC 3I4NC 5C4JC 3HOZK 5C4XK 4Y52K 3M3YC 4LJZA 2R92C 4BBRC 4C2MC 4C3JC 4BXXK 2VUMK 2E2JK 4QJVB 4A3IK 3GTJK 2JA8K 2NVQK 5FLMC 3GTQK 3RZOC 2A68A 4OIRA 1R9TK 3S1QC 1TWFK 1TWCK 3CQZK 2E2IK 1TWGC 1I3QK 2WB1L 4X6AK 4NOIA 2A6HA 4KN4A 4MEYA 5IYBC 2NVQC 3HOWC 4G7OA 4A3IC 2JA5C 2O5JA 2B63K 3S15C 3HOWK 2E2JC 4QIWD 3H0GK 4OIPA 4BXXC 3H3VL 4A3JC 2YU9C 1TWAC 3GTLC 3HOVC 3H0GC 1TWCC 2PA8L 4XSXA 1TWFC 1I6HC 3S17K 4A3GC 3HOZC 4XSZA 2E2IC 3GTGC 4A3KC 5TMCA 5IP9C 3S1MK 2PA8D 2CW0A 4BBSK 3S14K 3GTLK 4G7ZA 4C2MK 3S1RC 4C3JK 5M5WK 5C44K 3S14C 4MEXA 3S16C 5C3EK 4A3JK 4A3MK 2PMZL 3RZOK 3S15K 4JK1A 4Q5SA 3S2DC 4MQ9A 1SFOC 3S1MC 4XLPA 5IP9K 1I3QC 4ZH4A 3EQLA 4A3GK 3S1QK 3GTKC 5C4XC 3S1NK 5C4JK 5IP7C 3M3YK 1I50C 2O5IA 4BBSC 2JA5K 3I4NK 4BY7K 2R7ZC 3S1RK 4BY1K 4A3KK 2JA8C 3PO2C 4BBRK 3HOUK 1I6HK 2A6EA 3S17C 1R9TC 4Y7NK 3PO3K 5IYCK 3K7AC 2NVYK 2NVTK 2Y0SL 3GTQC 4OIOA 5IYDK 3GTOC 4Q4ZA 3GTGK 3GTPC 3HOVK 3HOYK 4A3CK 3RZDC 5IYBK 4YFKA 2VUMC 2E2HC 5FJ8K 3CQZC 3HOXK 4YFNA 2PPBA 4OIQA 4Y52C 4A3EC 1BDFA 4YFXA 4GZYA 2NVXC 4A3LK 1IW7A 3S2HK 3HKZL 4AYBL 4A3EK 2WB1D 4A3FC 5M3MK 1ZYRA 5FLMK 3GTJC 4C3IC 5M3FK 5M5YK 2PMZD
chains in the Genus database with same CATH superfamily
3IPJA 1AB4A 1Y1WC 4C3IK 4GTCA 2R92K 3FKIC 5IOTA 1IBAA 2XCOA 3I4MK 1TWHK 2ZUFA 3DXJA 5JVOA 1K83K 2NVTC 4FZBA 1J98A 1HQMA 4A93C 4KM8A 4A3LC 4A3MC 1WCMK 1DCOA 1G51A 1GE9A 2CFAA 4A3CC 4WFAS 1WSVA 4KN7A 3N0BA 3T02A 1YNJA 1WCMA 5CJ9A 5C44C 1TWAK 2ZUEA 3SZYA 3PO3C 2B63C 4XLNA 2KPUA 5C4JC 1TWAA 4LJZA 1ZXOA 3AD9C 1PJ7A 2VUMK 3BUEA 1ZBSA 3T01A 2A68A 4OIRA 1R9TK 1O26A 1HI9A 5E68A 2JA7A 2NVQC 4J3NA 1XZQB 3AD8C 2E2JC 4QIWD 4BXXC 1EK8A 1TWAC 1F9NA 3S17K 2JH3A 3HOZC 5HL8A 3QX3A 1O29A 2PA8D 4BBSK 3OPFA 2KWAA 3GTLK 5M5WK 1DCHA 5C44K 4MEXA 3S16C 3RZOK 1XZPB 2P5MA 4Q5SA 4KATA 4MQ9A 4XLPA 1I3QC 3Q3QA 2E2HA 4A3GK 3TFIA 3GTKC 5IP7C 3M3YK 2O5IA 2XCQA 1BS2A 3GSIA 2JA5K 4BY7K 2R7ZC 4WFNS 1WQHA 4GTEA 3S17C 1R9TC 4Y7NK 5HL7S 2NVYK 3GTOC 4Q4ZA 3NUHA 4A3CK 3RZDC 2E2HC 3CQZC 3HOXK 3GTQA 4Y52C 4YFXA 3HKZL 5M3MK 1ZYRA 2JA8C 4C3IC 1F7UA 3GTMC 5M5XK 2JA6A 3V4GA 3HOYC 5IYDC 1R9TA 2B63A 1K83C 1TWCA 3FKIA 3GEHA 2JA7C 4C3HK 2JA6K 1Y1VA 1XPPA 4QIWL 2R93C 2NVYC 4QJVA 5IP7K 2GAGC 3CAGA 3HKZD 4PAAA 1YX2A 2ZJQS 5TMFA 3TTGA 1USOA 3PIPS 3SZZA 2WAQD 3GTPA 1XZQA 3RZDK 4XCHA 4LK1A 2E2HK 3I4MC 1B4BA 3TFJA 2E2IA 2ZJRS 2R93A 3T00A 3S16K 3S2HC 3LYWA 1J6XA 1EH1A 3VA7A 3HOUC 1TWHC 1VRQC 5IYCC 3M3YC 1TWFA 4KB4A 2E2JK 4A3IK 3GTJK 1I50A 2NVQK 5FLMC 5L46A 3HXAA 1O2BA 2W7VA 4GT9A 3S1QC 1TWFK 4P9SA 2CFAB 4X6AK 2A6HA 4KN4A 2GSNA 1WQGA 2B63K 3HOWK 3AQOA 4OIPA 2YU9C 3S1RK 4WF9S 3GTLC 4LOWA 1TWCC 4XSXA 4FM9A 4A3KC 2FQOA 2Y3PA 1IL2A 1V5VA 3HOVK 4A3JK 2ZFZA 3G4CA 4WFBS 3GTMA 2PMZL 3S2DC 1PJ6A 1SFOC 1ZVUA 5IP9K 3FOFA 1O27A 5JFEA 3GEEA 4P5AA 4WILA 5DM7S 2YU9A 3S1NK 3S1QK 2NVXA 1ZQ1C 4GTAA 2RGRA 3GDZA 2KXYA 3GTKA 5IOQA 1VJEA 4BY1K 4BBRK 3PO2C 4G0WA 1VGXA 3K7AC 3GTQC 4OIOA 3HOYK 3AQPA 2V6UA 2FQTA 2VUMC 2PPBA 4OIQA 4GZYA 4U67S 2NVXC 1O2FB 4GFQA 5M3FK 5JVGS 3ERED 2PMZD 4YG2A 4C3HC 4G7HA 4G0UA 2JA7K 4A93K 2WAQL 3A8IA 3H0GA 1YNNA 3OEPA 1I3QA 4KC6A 2JA6C 2A69A 3AH5A 1FEUA 4KM9A 1F7VA 2R92A 4WJ4A 4LLGA 4A3FK 1DCPA 1WCMC 4M1XA 3ADAC 4LR2A 3GTLA 1USMA 4RMFA 3M4OK 5D4DA 4A3BK 1Y1VC 1EFWA 4KASA 4BY1C 1WOSA 2L5NA 5IOSA 1WIHA 4ILDA 1I6VA 4PABA 3K7AK 4A3DC 1DD5A 3L4JA 1WOOA 1IE0A 4LK0A 3S2DK 2NVXK 2BE5A 4Y7NC 5HQHA 3GTKK 4BLBA 1J6VA 4IOAS 4IO9S 1JOEA 4KMHA 1O24A 4BY7C 4BLAA 5C4XK 5EGEA 4BBRC 4C2MC 4C3JC 1O28A 4BXXK 2D6FC 1WOPA 4GTBA 2GSUA 1O25A 4QJVB 1VLOA 1KQ4A 2V6TA 2GAHC 1TWCK 3CQZK 4GTFA 3A8JA 2P8TA 1TWGC 2L3UA 4GTDA 2WB1L 3HOWC 1UV7A 4G7OA 2O5JA 2V6SA 1XXAA 3S0XA 1XXBA 3H3VL 3H0GK 3S2HK 1JQWA 1BJTA 3HOVC 3H0GC 2PA8L 1VH2A 1I6HC 4A3GC 4XSZA 2E2IC 3GTGC 4G0VA 5IP9C 3FOEA 2CW0A 1SFOA 3L4KA 5C3EK 1WSRA 2XCRB 4A3MK 3S15K 4JK1A 3S1MC 3EQLA 3JSTA 5C4XC 1EQRA 1YCLA 1I50C 3DLLS 4O2DA 3PIOS 3MMLB 4GTLA 3I4NK 1WORA 4A3KK 3AD7C 3GIRA 3PO3K 1X31C 2JA5A 5IYDK 1XZPA 4C45A 5IYBK 5TJ3A 4P5BA 2KQ1A 2NVYA 4KMDA 2VUMA 4AYBL 4A3EK 2WB1D 3GTJC 4A3BC 1Y1VK 5CHPA 1IQ0A 3WODA 1Y1WA 3HOXC 2EBBA 4LQYA 1B4AA 3M4OC 3H3VD 4BKWA 4AYBD 1Y1WK 3GTMK 3FKIK 5IORA 2GSOA 2PHCB 4KMUA 1SFOK 4A3DK 3BP8C 1F93A 4OINA 2R93K 4WJ3M 4KARA 1SMYA 1C0AA 1IS1A 3FHZA 5EGHA 2R7ZK 4DDQA 3GTPK 3GTOK 5C3EC 2Y0SD 3OREA 3S1NC 3PO2K 1JVIA 2R7ZA 1I50K 3A8KA 4X6AC 3N3YA 1TWGK 3I4NC 3HOZK 4Y52K 2R92C 2JA8K 3GEIA 3GTQK 1PJ5A 1TWGA 3RZOC 1I3QK 3TFHA 4NOIA 4MEYA 5IYBC 3GTJA 1TWHA 4A3IC 2JA5C 3S15C 3LAPA 2ZJPS 4A3JC 2E2IK 3GTGK 1K83A 1J6WA 1TWFC 4WCES 3BP3A 5TMCA 4KB2A 3S1MK 5DM6S 1XXCA 3GTGA 3S14K 1RU0A 4KMAA 4G7ZA 4C2MK 3S1RC 4C3JK 2YU9K 3S14C 3LPXA 4ZH4A 3CF5S 1ISEA 5C4JK 3LAJA 4BBSC 2RH6A 4AH6A 4KAWX 5JVHS 3N0CA 3HOUK 4IOCS 3GTOA 1EI6A 1I6HK 2A6EA 5IYCK 4KDDA 2NVTK 2Y0SL 1BGWA 3GTPC 4YFKA 1INNA 5FJ8K 4YFNA 1O2AA 4A3EC 1BDFA 4A3LK 1IW7A 1WQFA 4A3FC 3CQZA 1L0WA 5FLMK 3G4AA 5M5YK
chains in the Genus database with same CATH topology
4YG2A 4C3HC 4G7HA 3GTMC 5M5XK 1Y1WC 4A3BC 4C3IK 3HOYC 2JA7K 2R92K 5IYDC 3FKIC 1Y1VK 2WAQL 1K83C 1YNNA 3WODA 2JA6C 2A69A 3I4MK 3HOXC 1TWHK 2JA7C 4C3HK 2JA6K 3DXJA 4A93K 3M4OC 1XPPA 4LLGA 3H3VD 1K83K 4QIWL 1WCMC 2R93C 2NVYC 2NVTC 4QJVA 5IP7K 4A3FK 1HQMA 3M4OK 3HKZD 4AYBD 5D4DA 4A93C 1Y1WK 3GTMK 4A3BK 1Y1VC 3FKIK 5TMFA 4BY1C 4KMUA 1SFOK 2WAQD 4A3LC 4A3DK 1I6VA 4A3MC 4OINA 1WCMK 3K7AK 2R93K 4A3DC 2YU9K 1SMYA 3RZDK 4A3CC 4LK1A 2E2HK 3I4MC 4KN7A 4LK0A 2R7ZK 1YNJA 3GTPK 3S2DK 3GTOK 2NVXK 2BE5A 5C3EC 3S16K 5C44C 1TWAK 2Y0SD 3S2HC 4Y7NC 3PO3C 3S1NC 3GTKK 2B63C 3HOUC 3PO2K 1TWHC 4XLNA 1I50K 4X6AC 4BY7C 1TWGK 5IYCC 3I4NC 5C4JC 3HOZK 5C4XK 4Y52K 3M3YC 4LJZA 2R92C 4BBRC 4C2MC 4C3JC 4BXXK 2VUMK 2E2JK 4QJVB 4A3IK 3GTJK 2JA8K 2NVQK 5FLMC 3GTQK 3RZOC 2A68A 4OIRA 1R9TK 3S1QC 1TWFK 1TWCK 3CQZK 2E2IK 1TWGC 1I3QK 2WB1L 4X6AK 4NOIA 2A6HA 4KN4A 4MEYA 5IYBC 2NVQC 3HOWC 4G7OA 4A3IC 2JA5C 2O5JA 2B63K 3S15C 3HOWK 2E2JC 4QIWD 3H0GK 4OIPA 4BXXC 3H3VL 4A3JC 2YU9C 1TWAC 3GTLC 3HOVC 3H0GC 1TWCC 2PA8L 4XSXA 1TWFC 1I6HC 3S17K 4A3GC 3HOZC 4XSZA 2E2IC 3GTGC 4A3KC 5TMCA 5IP9C 3S1MK 2PA8D 2CW0A 4BBSK 3S14K 3GTLK 4G7ZA 4C2MK 3S1RC 4C3JK 5M5WK 5C44K 3S14C 4MEXA 3S16C 5C3EK 4A3JK 4A3MK 2PMZL 3RZOK 3S15K 4JK1A 4Q5SA 3S2DC 4MQ9A 1SFOC 3S1MC 4XLPA 5IP9K 1I3QC 4ZH4A 3EQLA 4A3GK 3S1QK 3GTKC 5C4XC 3S1NK 5C4JK 5IP7C 3M3YK 1I50C 2O5IA 4BBSC 2JA5K 3I4NK 4BY7K 2R7ZC 3S1RK 4BY1K 4A3KK 2JA8C 3PO2C 4BBRK 3HOUK 1I6HK 2A6EA 3S17C 1R9TC 4Y7NK 3PO3K 5IYCK 3K7AC 2NVYK 2NVTK 2Y0SL 3GTQC 4OIOA 5IYDK 3GTOC 4Q4ZA 3GTGK 3GTPC 3HOVK 3HOYK 4A3CK 3RZDC 5IYBK 4YFKA 2VUMC 2E2HC 5FJ8K 3CQZC 3HOXK 4YFNA 2PPBA 4OIQA 4Y52C 4A3EC 1BDFA 4YFXA 4GZYA 2NVXC 4A3LK 1IW7A 3S2HK 3HKZL 4AYBL 4A3EK 2WB1D 4A3FC 5M3MK 1ZYRA 5FLMK 3GTJC 4C3IC 5M3FK 5M5YK 2PMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YG2 A;  4C3H C;  4G7H A;  3GTM C;  5M5X K;  1Y1W C;  4A3B C;  4C3I K;  3HOY C;  2JA7 K;  2R92 K;  5IYD C;  3FKI C;  1Y1V K;  2WAQ L;  1K83 C;  1YNN A;  3WOD A;  2JA6 C;  2A69 A;  3I4M K;  3HOX C;  1TWH K;  2JA7 C;  4C3H K;  2JA6 K;  3DXJ A;  4A93 K;  3M4O C;  1XPP A;  4LLG A;  3H3V D;  1K83 K;  4QIW L;  1WCM C;  2R93 C;  2NVY C;  2NVT C;  4QJV A;  5IP7 K;  4A3F K;  1HQM A;  3M4O K;  3HKZ D;  4AYB D;  5D4D A;  4A93 C;  1Y1W K;  3GTM K;  4A3B K;  1Y1V C;  3FKI K;  5TMF A;  4BY1 C;  4KMU A;  1SFO K;  2WAQ D;  4A3L C;  4A3D K;  1I6V A;  4A3M C;  4OIN A;  1WCM K;  3K7A K;  2R93 K;  4A3D C;  2YU9 K;  1SMY A;  3RZD K;  4A3C C;  4LK1 A;  2E2H K;  3I4M C;  4KN7 A;  4LK0 A;  2R7Z K;  1YNJ A;  3GTP K;  3S2D K;  3GTO K;  2NVX K;  2BE5 A;  5C3E C;  3S16 K;  5C44 C;  1TWA K;  2Y0S D;  3S2H C;  4Y7N C;  3PO3 C;  3S1N C;  3GTK K;  2B63 C;  3HOU C;  3PO2 K;  1TWH C;  4XLN A;  1I50 K;  4X6A C;  4BY7 C;  1TWG K;  5IYC C;  3I4N C;  5C4J C;  3HOZ K;  5C4X K;  4Y52 K;  3M3Y C;  4LJZ A;  2R92 C;  4BBR C;  4C2M C;  4C3J C;  4BXX K;  2VUM K;  2E2J K;  4QJV B;  4A3I K;  3GTJ K;  2JA8 K;  2NVQ K;  5FLM C;  3GTQ K;  3RZO C;  2A68 A;  4OIR A;  1R9T K;  3S1Q C;  1TWF K;  1TWC K;  3CQZ K;  2E2I K;  1TWG C;  1I3Q K;  2WB1 L;  4X6A K;  4NOI A;  2A6H A;  4KN4 A;  4MEY A;  5IYB C;  2NVQ C;  3HOW C;  4G7O A;  4A3I C;  2JA5 C;  2O5J A;  2B63 K;  3S15 C;  3HOW K;  2E2J C;  4QIW D;  3H0G K;  4OIP A;  4BXX C;  3H3V L;  4A3J C;  2YU9 C;  1TWA C;  3GTL C;  3HOV C;  3H0G C;  1TWC C;  2PA8 L;  4XSX A;  1TWF C;  1I6H C;  3S17 K;  4A3G C;  3HOZ C;  4XSZ A;  2E2I C;  3GTG C;  4A3K C;  5TMC A;  5IP9 C;  3S1M K;  2PA8 D;  2CW0 A;  4BBS K;  3S14 K;  3GTL K;  4G7Z A;  4C2M K;  3S1R C;  4C3J K;  5M5W K;  5C44 K;  3S14 C;  4MEX A;  3S16 C;  5C3E K;  4A3J K;  4A3M K;  2PMZ L;  3RZO K;  3S15 K;  4JK1 A;  4Q5S A;  3S2D C;  4MQ9 A;  1SFO C;  3S1M C;  4XLP A;  5IP9 K;  1I3Q C;  4ZH4 A;  3EQL A;  4A3G K;  3S1Q K;  3GTK C;  5C4X C;  3S1N K;  5C4J K;  5IP7 C;  3M3Y K;  1I50 C;  2O5I A;  4BBS C;  2JA5 K;  3I4N K;  4BY7 K;  2R7Z C;  3S1R K;  4BY1 K;  4A3K K;  2JA8 C;  3PO2 C;  4BBR K;  3HOU K;  1I6H K;  2A6E A;  3S17 C;  1R9T C;  4Y7N K;  3PO3 K;  5IYC K;  3K7A C;  2NVY K;  2NVT K;  2Y0S L;  3GTQ C;  4OIO A;  5IYD K;  3GTO C;  4Q4Z A;  3GTG K;  3GTP C;  3HOV K;  3HOY K;  4A3C K;  3RZD C;  5IYB K;  4YFK A;  2VUM C;  2E2H C;  5FJ8 K;  3CQZ C;  3HOX K;  4YFN A;  2PPB A;  4OIQ A;  4Y52 C;  4A3E C;  1BDF A;  4YFX A;  4GZY A;  2NVX C;  4A3L K;  1IW7 A;  3S2H K;  3HKZ L;  4AYB L;  4A3E K;  2WB1 D;  4A3F C;  5M3M K;  1ZYR A;  5FLM K;  3GTJ C;  4C3I C;  5M3F K;  5M5Y K;  2PMZ D; 
#chains in the Genus database with same CATH topology
 3IPJ A;  1AB4 A;  1Y1W C;  4C3I K;  4GTC A;  2R92 K;  3FKI C;  5IOT A;  1IBA A;  2XCO A;  3I4M K;  1TWH K;  2ZUF A;  3DXJ A;  5JVO A;  1K83 K;  2NVT C;  4FZB A;  1J98 A;  1HQM A;  4A93 C;  4KM8 A;  4A3L C;  4A3M C;  1WCM K;  1DCO A;  1G51 A;  1GE9 A;  2CFA A;  4A3C C;  4WFA S;  1WSV A;  4KN7 A;  3N0B A;  3T02 A;  1YNJ A;  1WCM A;  5CJ9 A;  5C44 C;  1TWA K;  2ZUE A;  3SZY A;  3PO3 C;  2B63 C;  4XLN A;  2KPU A;  5C4J C;  1TWA A;  4LJZ A;  1ZXO A;  3AD9 C;  1PJ7 A;  2VUM K;  3BUE A;  1ZBS A;  3T01 A;  2A68 A;  4OIR A;  1R9T K;  1O26 A;  1HI9 A;  5E68 A;  2JA7 A;  2NVQ C;  4J3N A;  1XZQ B;  3AD8 C;  2E2J C;  4QIW D;  4BXX C;  1EK8 A;  1TWA C;  1F9N A;  3S17 K;  2JH3 A;  3HOZ C;  5HL8 A;  3QX3 A;  1O29 A;  2PA8 D;  4BBS K;  3OPF A;  2KWA A;  3GTL K;  5M5W K;  1DCH A;  5C44 K;  4MEX A;  3S16 C;  3RZO K;  1XZP B;  2P5M A;  4Q5S A;  4KAT A;  4MQ9 A;  4XLP A;  1I3Q C;  3Q3Q A;  2E2H A;  4A3G K;  3TFI A;  3GTK C;  5IP7 C;  3M3Y K;  2O5I A;  2XCQ A;  1BS2 A;  3GSI A;  2JA5 K;  4BY7 K;  2R7Z C;  4WFN S;  1WQH A;  4GTE A;  3S17 C;  1R9T C;  4Y7N K;  5HL7 S;  2NVY K;  3GTO C;  4Q4Z A;  3NUH A;  4A3C K;  3RZD C;  2E2H C;  3CQZ C;  3HOX K;  3GTQ A;  4Y52 C;  4YFX A;  3HKZ L;  5M3M K;  1ZYR A;  2JA8 C;  4C3I C;  1F7U A;  3GTM C;  5M5X K;  2JA6 A;  3V4G A;  3HOY C;  5IYD C;  1R9T A;  2B63 A;  1K83 C;  1TWC A;  3FKI A;  3GEH A;  2JA7 C;  4C3H K;  2JA6 K;  1Y1V A;  1XPP A;  4QIW L;  2R93 C;  2NVY C;  4QJV A;  5IP7 K;  2GAG C;  3CAG A;  3HKZ D;  4PAA A;  1YX2 A;  2ZJQ S;  5TMF A;  3TTG A;  1USO A;  3PIP S;  3SZZ A;  2WAQ D;  3GTP A;  1XZQ A;  3RZD K;  4XCH A;  4LK1 A;  2E2H K;  3I4M C;  1B4B A;  3TFJ A;  2E2I A;  2ZJR S;  2R93 A;  3T00 A;  3S16 K;  3S2H C;  3LYW A;  1J6X A;  1EH1 A;  3VA7 A;  3HOU C;  1TWH C;  1VRQ C;  5IYC C;  3M3Y C;  1TWF A;  4KB4 A;  2E2J K;  4A3I K;  3GTJ K;  1I50 A;  2NVQ K;  5FLM C;  5L46 A;  3HXA A;  1O2B A;  2W7V A;  4GT9 A;  3S1Q C;  1TWF K;  4P9S A;  2CFA B;  4X6A K;  2A6H A;  4KN4 A;  2GSN A;  1WQG A;  2B63 K;  3HOW K;  3AQO A;  4OIP A;  2YU9 C;  3S1R K;  4WF9 S;  3GTL C;  4LOW A;  1TWC C;  4XSX A;  4FM9 A;  4A3K C;  2FQO A;  2Y3P A;  1IL2 A;  1V5V A;  3HOV K;  4A3J K;  2ZFZ A;  3G4C A;  4WFB S;  3GTM A;  2PMZ L;  3S2D C;  1PJ6 A;  1SFO C;  1ZVU A;  5IP9 K;  3FOF A;  1O27 A;  5JFE A;  3GEE A;  4P5A A;  4WIL A;  5DM7 S;  2YU9 A;  3S1N K;  3S1Q K;  2NVX A;  1ZQ1 C;  4GTA A;  2RGR A;  3GDZ A;  2KXY A;  3GTK A;  5IOQ A;  1VJE A;  4BY1 K;  4BBR K;  3PO2 C;  4G0W A;  1VGX A;  3K7A C;  3GTQ C;  4OIO A;  3HOY K;  3AQP A;  2V6U A;  2FQT A;  2VUM C;  2PPB A;  4OIQ A;  4GZY A;  4U67 S;  2NVX C;  1O2F B;  4GFQ A;  5M3F K;  5JVG S;  3ERE D;  2PMZ D;  4YG2 A;  4C3H C;  4G7H A;  4G0U A;  2JA7 K;  4A93 K;  2WAQ L;  3A8I A;  3H0G A;  1YNN A;  3OEP A;  1I3Q A;  4KC6 A;  2JA6 C;  2A69 A;  3AH5 A;  1FEU A;  4KM9 A;  1F7V A;  2R92 A;  4WJ4 A;  4LLG A;  4A3F K;  1DCP A;  1WCM C;  4M1X A;  3ADA C;  4LR2 A;  3GTL A;  1USM A;  4RMF A;  3M4O K;  5D4D A;  4A3B K;  1Y1V C;  1EFW A;  4KAS A;  4BY1 C;  1WOS A;  2L5N A;  5IOS A;  1WIH A;  4ILD A;  1I6V A;  4PAB A;  3K7A K;  4A3D C;  1DD5 A;  3L4J A;  1WOO A;  1IE0 A;  4LK0 A;  3S2D K;  2NVX K;  2BE5 A;  4Y7N C;  5HQH A;  3GTK K;  4BLB A;  1J6V A;  4IOA S;  4IO9 S;  1JOE A;  4KMH A;  1O24 A;  4BY7 C;  4BLA A;  5C4X K;  5EGE A;  4BBR C;  4C2M C;  4C3J C;  1O28 A;  4BXX K;  2D6F C;  1WOP A;  4GTB A;  2GSU A;  1O25 A;  4QJV B;  1VLO A;  1KQ4 A;  2V6T A;  2GAH C;  1TWC K;  3CQZ K;  4GTF A;  3A8J A;  2P8T A;  1TWG C;  2L3U A;  4GTD A;  2WB1 L;  3HOW C;  1UV7 A;  4G7O A;  2O5J A;  2V6S A;  1XXA A;  3S0X A;  1XXB A;  3H3V L;  3H0G K;  3S2H K;  1JQW A;  1BJT A;  3HOV C;  3H0G C;  2PA8 L;  1VH2 A;  1I6H C;  4A3G C;  4XSZ A;  2E2I C;  3GTG C;  4G0V A;  5IP9 C;  3FOE A;  2CW0 A;  1SFO A;  3L4K A;  5C3E K;  1WSR A;  2XCR B;  4A3M K;  3S15 K;  4JK1 A;  3S1M C;  3EQL A;  3JST A;  5C4X C;  1EQR A;  1YCL A;  1I50 C;  3DLL S;  4O2D A;  3PIO S;  3MML B;  4GTL A;  3I4N K;  1WOR A;  4A3K K;  3AD7 C;  3GIR A;  3PO3 K;  1X31 C;  2JA5 A;  5IYD K;  1XZP A;  4C45 A;  5IYB K;  5TJ3 A;  4P5B A;  2KQ1 A;  2NVY A;  4KMD A;  2VUM A;  4AYB L;  4A3E K;  2WB1 D;  3GTJ C;  4A3B C;  1Y1V K;  5CHP A;  1IQ0 A;  3WOD A;  1Y1W A;  3HOX C;  2EBB A;  4LQY A;  1B4A A;  3M4O C;  3H3V D;  4BKW A;  4AYB D;  1Y1W K;  3GTM K;  3FKI K;  5IOR A;  2GSO A;  2PHC B;  4KMU A;  1SFO K;  4A3D K;  3BP8 C;  1F93 A;  4OIN A;  2R93 K;  4WJ3 M;  4KAR A;  1SMY A;  1C0A A;  1IS1 A;  3FHZ A;  5EGH A;  2R7Z K;  4DDQ A;  3GTP K;  3GTO K;  5C3E C;  2Y0S D;  3ORE A;  3S1N C;  3PO2 K;  1JVI A;  2R7Z A;  1I50 K;  3A8K A;  4X6A C;  3N3Y A;  1TWG K;  3I4N C;  3HOZ K;  4Y52 K;  2R92 C;  2JA8 K;  3GEI A;  3GTQ K;  1PJ5 A;  1TWG A;  3RZO C;  1I3Q K;  3TFH A;  4NOI A;  4MEY A;  5IYB C;  3GTJ A;  1TWH A;  4A3I C;  2JA5 C;  3S15 C;  3LAP A;  2ZJP S;  4A3J C;  2E2I K;  3GTG K;  1K83 A;  1J6W A;  1TWF C;  4WCE S;  3BP3 A;  5TMC A;  4KB2 A;  3S1M K;  5DM6 S;  1XXC A;  3GTG A;  3S14 K;  1RU0 A;  4KMA A;  4G7Z A;  4C2M K;  3S1R C;  4C3J K;  2YU9 K;  3S14 C;  3LPX A;  4ZH4 A;  3CF5 S;  1ISE A;  5C4J K;  3LAJ A;  4BBS C;  2RH6 A;  4AH6 A;  4KAW X;  5JVH S;  3N0C A;  3HOU K;  4IOC S;  3GTO A;  1EI6 A;  1I6H K;  2A6E A;  5IYC K;  4KDD A;  2NVT K;  2Y0S L;  1BGW A;  3GTP C;  4YFK A;  1INN A;  5FJ8 K;  4YFN A;  1O2A A;  4A3E C;  1BDF A;  4A3L K;  1IW7 A;  1WQF A;  4A3F C;  3CQZ A;  1L0W A;  5FLM K;  3G4A A;  5M5Y K; 
#chains in the Genus database with same CATH homology
 4YG2 A;  4C3H C;  4G7H A;  3GTM C;  5M5X K;  1Y1W C;  4A3B C;  4C3I K;  3HOY C;  2JA7 K;  2R92 K;  5IYD C;  3FKI C;  1Y1V K;  2WAQ L;  1K83 C;  1YNN A;  3WOD A;  2JA6 C;  2A69 A;  3I4M K;  3HOX C;  1TWH K;  2JA7 C;  4C3H K;  2JA6 K;  3DXJ A;  4A93 K;  3M4O C;  1XPP A;  4LLG A;  3H3V D;  1K83 K;  4QIW L;  1WCM C;  2R93 C;  2NVY C;  2NVT C;  4QJV A;  5IP7 K;  4A3F K;  1HQM A;  3M4O K;  3HKZ D;  4AYB D;  5D4D A;  4A93 C;  1Y1W K;  3GTM K;  4A3B K;  1Y1V C;  3FKI K;  5TMF A;  4BY1 C;  4KMU A;  1SFO K;  2WAQ D;  4A3L C;  4A3D K;  1I6V A;  4A3M C;  4OIN A;  1WCM K;  3K7A K;  2R93 K;  4A3D C;  2YU9 K;  1SMY A;  3RZD K;  4A3C C;  4LK1 A;  2E2H K;  3I4M C;  4KN7 A;  4LK0 A;  2R7Z K;  1YNJ A;  3GTP K;  3S2D K;  3GTO K;  2NVX K;  2BE5 A;  5C3E C;  3S16 K;  5C44 C;  1TWA K;  2Y0S D;  3S2H C;  4Y7N C;  3PO3 C;  3S1N C;  3GTK K;  2B63 C;  3HOU C;  3PO2 K;  1TWH C;  4XLN A;  1I50 K;  4X6A C;  4BY7 C;  1TWG K;  5IYC C;  3I4N C;  5C4J C;  3HOZ K;  5C4X K;  4Y52 K;  3M3Y C;  4LJZ A;  2R92 C;  4BBR C;  4C2M C;  4C3J C;  4BXX K;  2VUM K;  2E2J K;  4QJV B;  4A3I K;  3GTJ K;  2JA8 K;  2NVQ K;  5FLM C;  3GTQ K;  3RZO C;  2A68 A;  4OIR A;  1R9T K;  3S1Q C;  1TWF K;  1TWC K;  3CQZ K;  2E2I K;  1TWG C;  1I3Q K;  2WB1 L;  4X6A K;  4NOI A;  2A6H A;  4KN4 A;  4MEY A;  5IYB C;  2NVQ C;  3HOW C;  4G7O A;  4A3I C;  2JA5 C;  2O5J A;  2B63 K;  3S15 C;  3HOW K;  2E2J C;  4QIW D;  3H0G K;  4OIP A;  4BXX C;  3H3V L;  4A3J C;  2YU9 C;  1TWA C;  3GTL C;  3HOV C;  3H0G C;  1TWC C;  2PA8 L;  4XSX A;  1TWF C;  1I6H C;  3S17 K;  4A3G C;  3HOZ C;  4XSZ A;  2E2I C;  3GTG C;  4A3K C;  5TMC A;  5IP9 C;  3S1M K;  2PA8 D;  2CW0 A;  4BBS K;  3S14 K;  3GTL K;  4G7Z A;  4C2M K;  3S1R C;  4C3J K;  5M5W K;  5C44 K;  3S14 C;  4MEX A;  3S16 C;  5C3E K;  4A3J K;  4A3M K;  2PMZ L;  3RZO K;  3S15 K;  4JK1 A;  4Q5S A;  3S2D C;  4MQ9 A;  1SFO C;  3S1M C;  4XLP A;  5IP9 K;  1I3Q C;  4ZH4 A;  3EQL A;  4A3G K;  3S1Q K;  3GTK C;  5C4X C;  3S1N K;  5C4J K;  5IP7 C;  3M3Y K;  1I50 C;  2O5I A;  4BBS C;  2JA5 K;  3I4N K;  4BY7 K;  2R7Z C;  3S1R K;  4BY1 K;  4A3K K;  2JA8 C;  3PO2 C;  4BBR K;  3HOU K;  1I6H K;  2A6E A;  3S17 C;  1R9T C;  4Y7N K;  3PO3 K;  5IYC K;  3K7A C;  2NVY K;  2NVT K;  2Y0S L;  3GTQ C;  4OIO A;  5IYD K;  3GTO C;  4Q4Z A;  3GTG K;  3GTP C;  3HOV K;  3HOY K;  4A3C K;  3RZD C;  5IYB K;  4YFK A;  2VUM C;  2E2H C;  5FJ8 K;  3CQZ C;  3HOX K;  4YFN A;  2PPB A;  4OIQ A;  4Y52 C;  4A3E C;  1BDF A;  4YFX A;  4GZY A;  2NVX C;  4A3L K;  1IW7 A;  3S2H K;  3HKZ L;  4AYB L;  4A3E K;  2WB1 D;  4A3F C;  5M3M K;  1ZYR A;  5FLM K;  3GTJ C;  4C3I C;  5M3F K;  5M5Y K;  2PMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...