1ZYRA

Structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic streptolydigin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
molecule tags Transcription,transferase
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation.
pubmed doi rcsb
total genus 35
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1zyrA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1zyrA01
3GTMC 3S16K 3HOWC 3H0GK 5M5YK 4Y52K 3GTMK 2JA5C 4LK0A 4LLGA 5IP9C 3S1MK 5C4XK 4JK1A 3RZOK 2JA7K 3HOVK 2A69A 2R7ZC 3HOZK 3FKIK 4XLNA 2WAQL 4BBSC 4MEXA 2PPBA 3GTLC 3H3VD 5IYBK 4BBSK 5TMFA 3HOXK 4OIRA 4AYBD 4Y7NK 3S1MC 3S1QK 3I4MC 4KMUA 4A3IC 4A93K 3S1QC 4A3JK 1TWAC 4A93C 2VUMC 2Y0SL 2NVQK 3GTJC 3K7AK 4QIWL 1SFOC 3K7AC 3HOXC 4XSXA 4XLPA 1I6HC 3GTOK 4X6AK 4BY1C 3GTOC 4ZH4A 3S2HC 4A3IK 4A3BC 3EQLA 4C3IC 2VUMK 4BBRK 2PA8D 3GTJK 3S17K 4A3CK 4QIWD 1XPPA 4BY1K 4MQ9A 3PO2C 4G7ZA 4C2MK 4C3IK 1YNJA 3S1NC 4C3HK 5M5XK 1TWGK 3S2DC 4A3GK 4QJVA 2PMZD 4A3GC 3CQZK 4KN7A 3S2DK 4MEYA 5M5WK 4QJVB 4BXXC 2E2HK 4A3KC 4A3LK 1I6VA 3GTPC 2R93C 2E2HC 1TWCK 3S1NK 3S1RK 5IYDK 4YFNA 1TWGC 4OIOA 3GTQK 2R93K 3I4NC 5IP9K 1TWFC 5IYCC 3GTQC 4YFXA 3M4OC 2JA6C 4OIQA 1WCMK 3S14C 2NVYK 4A3FK 4A3FC 4AYBL 4BXXK 5C44K 4C3JK 2BE5A 3WODA 4Y7NC 2R92C 2E2JK 5TMCA 2Y0SD 5IYCK 2NVXC 2O5JA 3HOUK 2NVYC 4YFKA 2B63C 2O5IA 3RZOC 1TWAK 2JA6K 2WB1D 2YU9K 3HOZC 5M3FK 2JA8K 1K83C 4Q4ZA 1IW7A 2JA8C 4A3DC 2CW0A 1TWHC 4KN4A 3DXJA 1TWHK 4X6AC 5D4DA 2R7ZK 5FLMK 2A6HA 4A3MK 2YU9C 4BBRC 4Q5SA 4A3MC 3HKZD 2NVQC 5IP7C 4LJZA 1SFOK 5IP7K 2PA8L 1R9TC 2A6EA 4C2MC 1I3QK 5M3MK 3H3VL 3S2HK 5FLMC 1YNNA 3FKIC 5IYBC 3GTLK 3HKZL 1Y1VK 1Y1WK 1I6HK 1Y1VC 1Y1WC 1R9TK 4NOIA 4YG2A 1I3QC 1SMYA 5C3EC 1TWCC 4A3EC 3S15C 4GZYA 1I50K 5C3EK 3S1RC 4A3JC 3GTPK 3I4MK 1I50C 3GTKK 4C3HC 3S17C 1TWFK 1ZYRA 2PMZL 2A68A 4OINA 3GTKC 3HOYC 3CQZC 3HOYK 3PO2K 4BY7C 3PO3K 4A3EK 3S15K 1HQMA 3PO3C 4BY7K 2E2IK 4A3BK 2E2IC 2E2JC 2R92K 2WAQD 5IYDC 2NVTC 3M3YC 3I4NK 4A3CC 3M3YK 2B63K 1BDFA 4G7HA 3M4OK 3GTGK 4LK1A 4G7OA 4A3LC 5FJ8K 5C4JK 3RZDC 4A3KK 3S14K 1K83K 4A3DK 4C3JC 4XSZA 3RZDK 3H0GC 4Y52C 2WB1L 3HOWK 2JA5K 2NVTK 4OIPA 5C4XC 3HOUC 1WCMC 2NVXK 2JA7C 3HOVC 3GTGC 5C44C 5C4JC 3S16C
chains in the Genus database with same CATH superfamily
3GEIA 4LK0A 5IP9C 2JA7A 5C4XK 1DCHA 1HI9A 1WOPA 2R7ZC 4X6AK 2WAQL 2XCOA 2PPBA 3T00A 3LAJA 3AH5A 2RGRA 3S1QC 2VUMC 1O25A 2NVQK 3GTOK 1XXBA 4KB4A 4A3BC 3EQLA 4C3IC 3ADAC 2VUMK 4BBRK 3GTJK 2JH3A 1EQRA 1YX2A 1EH1A 3PO2C 1Y1WA 4C3IK 4C3HK 5M5XK 1J6VA 3S2DK 1JVIA 4KN7A 1WORA 5M5WK 4A3LK 3CF5S 3GTPC 2R93C 2E2HC 1ZVUA 2KPUA 3I4NC 2V6SA 5IP9K 3GTQC 3M4OC 4KM9A 2V6UA 4A3FC 2NVYA 5C44K 4C3JK 3WODA 1R9TA 2E2JK 3LAPA 2O5JA 3N0CA 4YFKA 1O27A 2YU9K 4WF9S 3N3YA 2JA8C 1TWHC 1IE0A 3DXJA 1PJ5A 3Q3QA 3TFJA 4X6AC 2R7ZK 2A6HA 2YU9C 4A3MC 4KDDA 1L0WA 5IP7K 2PA8L 4C2MC 5CJ9A 1J6WA 2KWAA 1J98A 3FKIC 2L3UA 3PIOS 5IYBC 5HL7S 1Y1VC 1EFWA 3OEPA 3GTPK 4GZYA 1I50K 3AD8C 3GTKK 1ZYRA 3HOYC 5HQHA 1RU0A 3S15K 4WFNS 1HQMA 4FZBA 2E2JC 2WAQD 4LK1A 4A3LC 5C4JK 3RZDC 3VA7A 4A3DK 2WB1L 2L5NA 3HOUC 3GTQA 2JA7C 4GTEA 5C44C 2P5MA 1WSRA 3HOWC 3H0GK 4IO9S 3TFHA 4Y52K 2JA5C 2R7ZA 5IOQA 3S1MK 3RZOK 3BP3A 2JA7K 2A69A 3FKIK 4MEXA 3H3VD 5IYBK 4BBSK 2KQ1A 5TMFA 1XZPA 3HOXK 4AYBD 3GTGA 4Y7NK 4KARA 4A3JK 1WOOA 3AQPA 1UV7A 4XSXA 4XLPA 1I6HC 3GSIA 4XCHA 3GTOC 4ZH4A 1DCPA 4KMHA 3GTJA 2XCQA 3S17K 1O26A 4MQ9A 1YNJA 3OPFA 1TWGK 3S2DC 1DD5A 4QJVB 2E2HK 1J6XA 3N0BA 3S1RK 1ZQ1C 4AH6A 1TWGC 1O2BA 3GTQK 2R93K 1TWFC 1WIHA 4IOCS 1G51A 2JA6C 4A3FK 1WCMK 4BXXK 3GTMA 1XXCA 2R92C 5IYCK 2ZJRS 3HOUK 2CFAA 2JA6K 1VLOA 4KASA 3HOZC 5JVHS 3CQZA 4LQYA 2JA8K 1K83C 3GEEA 1IBAA 1TWCA 4BLBA 1IQ0A 1PJ7A 2RH6A 5E68A 2NVQC 3A8JA 4LJZA 1JQWA 2A6EA 1XZPB 1YNNA 4FM9A 1F7UA 1Y1WK 2XCRB 4NOIA 4YG2A 1I3QC 3GIRA 3T02A 3S1RC 3TTGA 4C3HC 2PMZL 3GTKC 4BY7C 2KXYA 3PO3C 1ISEA 1VGXA 2ZJQS 3V4GA 1IS1A 2E2IC 1WSVA 3M3YC 4PABA 5DM6S 1BDFA 4P5BA 4G7OA 1K83K 3NUHA 3RZDK 1O2AA 5HL8A 2W7VA 3LPXA 3GTGC 4KMUA 4LR2A 3GTMC 2CFAB 4LLGA 4M1XA 3SZYA 4JK1A 4GTDA 4BLAA 3HOZK 5JVOA 4BBSC 5JFEA 3GTLC 3GDZA 4GTAA 2D6FC 2JA6A 2GSUA 1I3QA 4OIRA 2PHCB 4A93K 3GTLA 1TWAC 3FOFA 3GTJC 4QIWL 3JSTA 3K7AC 5IOTA 3AD9C 1ZBSA 3S2HC 1SFOA 1DCOA 1O24A 4QIWD 1XPPA 1Y1VA 4C2MK 5TJ3A 3S1NC 4A3GK 3G4AA 1INNA 4QJVA 1WQFA 1F9NA 4DDQA 1TWFA 5IORA 3L4JA 4MEYA 4J3NA 5EGEA 1WQGA 4A3KC 4BKWA 1TWCK 3S1NK 4LOWA 3SZZA 5IYDK 4YFNA 1AB4A 1JOEA 4WFBS 1X31C 2ZUEA 2E2IA 3S14C 3TFIA 4P9SA 1YCLA 5IOSA 1O29A 5TMCA 2Y0SD 1TWAA 2NVXC 3ERED 2O5IA 1TWAK 2B63C 3RZOC 4GT9A 2WB1D 3DLLS 1WQHA 5M3FK 4A3DC 4PAAA 5L46A 1TWGA 2CW0A 3L4KA 3H0GA 4G0VA 3BP8C 5D4DA 2ZJPS 5FLMK 4Q5SA 4BBRC 3HKZD 1XZQB 4GTLA 3G4CA 1SFOK 1R9TC 1VRQC 5FLMC 4ILDA 4WCES 1USMA 3HKZL 1K83A 4KMAA 1GE9A 1Y1WC 1R9TK 1VJEA 3S15C 1TWCC 3I4MK 5C3EK 4A3JC 3PIPS 2A68A 3CQZC 3PO2K 3FKIA 3PO3K 4BY7K 2E2IK 1XXAA 4WJ4A 2GAGC 2P8TA 3CAGA 4GTCA 2NVTC 2B63A 4A3CC 3M3YK 2B63K 5JVGS 4A3KK 5FJ8K 1BGWA 4XSZA 3H0GC 4Y52C 2V6TA 3HOWK 2GAHC 3AQOA 2JA5K 2NVTK 4G0WA 3AD7C 4OIPA 3HOVC 2VUMA 5C4JC 1EI6A 3S16K 5M5YK 4GTBA 1TWHA 3GTMK 1F93A 1XZQA 2FQOA 4O2DA 3HOVK 4XLNA 2GSOA 2Y3PA 3S1MC 3HXAA 3S1QK 2E2HA 3I4MC 4A3IC 4P5AA 3IPJA 4A93C 5CHPA 2Y0SL 4KATA 3K7AK 1SFOC 3HOXC 1B4BA 2GSNA 2JA5A 4BY1C 4A3IK 2EBBA 4KAWX 2PA8D 4A3CK 4BY1K 4G7ZA 3BUEA 1O2FB 2PMZD 3CQZK 4A3GC 4KB2A 3GTKA 1V5VA 4BXXC 1I6VA 1IL2A 1KQ4A 4OIOA 5IYCC 1WCMA 4YFXA 4C45A 2NVYK 4OIQA 2ZUFA 1PJ6A 4AYBL 2BE5A 4IOAS 1WOSA 4Y7NC 3S0XA 3A8KA 3GTPA 1BJTA 2NVYC 4WJ3M 3FHZA 3QX3A 5EGHA 4Q4ZA 1IW7A 3T01A 3A8IA 4KN4A 1TWHK 3GEHA 3MMLB 4A3MK 1F7VA 4KC6A 4GFQA 2FQTA 5IP7C 3FOEA 2R92A 5M3MK 1I3QK 3H3VL 1BS2A 3S2HK 3GTLK 4GTFA 1Y1VK 1B4AA 1USOA 1I6HK 1C0AA 2YU9A 1I50A 1SMYA 5C3EC 4A3EC 1ZXOA 4WFAS 2NVXA 1I50C 3S17C 1O28A 1TWFK 4OINA 3HOYK 1FEUA 1VH2A 3OREA 4A3EK 2R93A 4A3BK 5DM7S 4KMDA 5IYDC 2R92K 3I4NK 1EK8A 4G0UA 4G7HA 4WILA 3M4OK 3GTGK 3LYWA 3S14K 4U67S 4KM8A 4C3JC 3GTOA 5C4XC 2NVXK 1WCMC 4RMFA 2ZFZA 3S16C
chains in the Genus database with same CATH topology
3GTMC 3S16K 3HOWC 3H0GK 5M5YK 4Y52K 3GTMK 2JA5C 4LK0A 4LLGA 5IP9C 3S1MK 5C4XK 4JK1A 3RZOK 2JA7K 3HOVK 2A69A 2R7ZC 3HOZK 3FKIK 4XLNA 2WAQL 4BBSC 4MEXA 2PPBA 3GTLC 3H3VD 5IYBK 4BBSK 5TMFA 3HOXK 4OIRA 4AYBD 4Y7NK 3S1MC 3S1QK 3I4MC 4KMUA 4A3IC 4A93K 3S1QC 4A3JK 1TWAC 4A93C 2VUMC 2Y0SL 2NVQK 3GTJC 3K7AK 4QIWL 1SFOC 3K7AC 3HOXC 4XSXA 4XLPA 1I6HC 3GTOK 4X6AK 4BY1C 3GTOC 4ZH4A 3S2HC 4A3IK 4A3BC 3EQLA 4C3IC 2VUMK 4BBRK 2PA8D 3GTJK 3S17K 4A3CK 4QIWD 1XPPA 4BY1K 4MQ9A 3PO2C 4G7ZA 4C2MK 4C3IK 1YNJA 3S1NC 4C3HK 5M5XK 1TWGK 3S2DC 4A3GK 4QJVA 2PMZD 4A3GC 3CQZK 4KN7A 3S2DK 4MEYA 5M5WK 4QJVB 4BXXC 2E2HK 4A3KC 4A3LK 1I6VA 3GTPC 2R93C 2E2HC 1TWCK 3S1NK 3S1RK 5IYDK 4YFNA 1TWGC 4OIOA 3GTQK 2R93K 3I4NC 5IP9K 1TWFC 5IYCC 3GTQC 4YFXA 3M4OC 2JA6C 4OIQA 1WCMK 3S14C 2NVYK 4A3FK 4A3FC 4AYBL 4BXXK 5C44K 4C3JK 2BE5A 3WODA 4Y7NC 2R92C 2E2JK 5TMCA 2Y0SD 5IYCK 2NVXC 2O5JA 3HOUK 2NVYC 4YFKA 2B63C 2O5IA 3RZOC 1TWAK 2JA6K 2WB1D 2YU9K 3HOZC 5M3FK 2JA8K 1K83C 4Q4ZA 1IW7A 2JA8C 4A3DC 2CW0A 1TWHC 4KN4A 3DXJA 1TWHK 4X6AC 5D4DA 2R7ZK 5FLMK 2A6HA 4A3MK 2YU9C 4BBRC 4Q5SA 4A3MC 3HKZD 2NVQC 5IP7C 4LJZA 1SFOK 5IP7K 2PA8L 1R9TC 2A6EA 4C2MC 1I3QK 5M3MK 3H3VL 3S2HK 5FLMC 1YNNA 3FKIC 5IYBC 3GTLK 3HKZL 1Y1VK 1Y1WK 1I6HK 1Y1VC 1Y1WC 1R9TK 4NOIA 4YG2A 1I3QC 1SMYA 5C3EC 1TWCC 4A3EC 3S15C 4GZYA 1I50K 5C3EK 3S1RC 4A3JC 3GTPK 3I4MK 1I50C 3GTKK 4C3HC 3S17C 1TWFK 1ZYRA 2PMZL 2A68A 4OINA 3GTKC 3HOYC 3CQZC 3HOYK 3PO2K 4BY7C 3PO3K 4A3EK 3S15K 1HQMA 3PO3C 4BY7K 2E2IK 4A3BK 2E2IC 2E2JC 2R92K 2WAQD 5IYDC 2NVTC 3M3YC 3I4NK 4A3CC 3M3YK 2B63K 1BDFA 4G7HA 3M4OK 3GTGK 4LK1A 4G7OA 4A3LC 5FJ8K 5C4JK 3RZDC 4A3KK 3S14K 1K83K 4A3DK 4C3JC 4XSZA 3RZDK 3H0GC 4Y52C 2WB1L 3HOWK 2JA5K 2NVTK 4OIPA 5C4XC 3HOUC 1WCMC 2NVXK 2JA7C 3HOVC 3GTGC 5C44C 5C4JC 3S16C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM C;  3S16 K;  3HOW C;  3H0G K;  5M5Y K;  4Y52 K;  3GTM K;  2JA5 C;  4LK0 A;  4LLG A;  5IP9 C;  3S1M K;  5C4X K;  4JK1 A;  3RZO K;  2JA7 K;  3HOV K;  2A69 A;  2R7Z C;  3HOZ K;  3FKI K;  4XLN A;  2WAQ L;  4BBS C;  4MEX A;  2PPB A;  3GTL C;  3H3V D;  5IYB K;  4BBS K;  5TMF A;  3HOX K;  4OIR A;  4AYB D;  4Y7N K;  3S1M C;  3S1Q K;  3I4M C;  4KMU A;  4A3I C;  4A93 K;  3S1Q C;  4A3J K;  1TWA C;  4A93 C;  2VUM C;  2Y0S L;  2NVQ K;  3GTJ C;  3K7A K;  4QIW L;  1SFO C;  3K7A C;  3HOX C;  4XSX A;  4XLP A;  1I6H C;  3GTO K;  4X6A K;  4BY1 C;  3GTO C;  4ZH4 A;  3S2H C;  4A3I K;  4A3B C;  3EQL A;  4C3I C;  2VUM K;  4BBR K;  2PA8 D;  3GTJ K;  3S17 K;  4A3C K;  4QIW D;  1XPP A;  4BY1 K;  4MQ9 A;  3PO2 C;  4G7Z A;  4C2M K;  4C3I K;  1YNJ A;  3S1N C;  4C3H K;  5M5X K;  1TWG K;  3S2D C;  4A3G K;  4QJV A;  2PMZ D;  4A3G C;  3CQZ K;  4KN7 A;  3S2D K;  4MEY A;  5M5W K;  4QJV B;  4BXX C;  2E2H K;  4A3K C;  4A3L K;  1I6V A;  3GTP C;  2R93 C;  2E2H C;  1TWC K;  3S1N K;  3S1R K;  5IYD K;  4YFN A;  1TWG C;  4OIO A;  3GTQ K;  2R93 K;  3I4N C;  5IP9 K;  1TWF C;  5IYC C;  3GTQ C;  4YFX A;  3M4O C;  2JA6 C;  4OIQ A;  1WCM K;  3S14 C;  2NVY K;  4A3F K;  4A3F C;  4AYB L;  4BXX K;  5C44 K;  4C3J K;  2BE5 A;  3WOD A;  4Y7N C;  2R92 C;  2E2J K;  5TMC A;  2Y0S D;  5IYC K;  2NVX C;  2O5J A;  3HOU K;  2NVY C;  4YFK A;  2B63 C;  2O5I A;  3RZO C;  1TWA K;  2JA6 K;  2WB1 D;  2YU9 K;  3HOZ C;  5M3F K;  2JA8 K;  1K83 C;  4Q4Z A;  1IW7 A;  2JA8 C;  4A3D C;  2CW0 A;  1TWH C;  4KN4 A;  3DXJ A;  1TWH K;  4X6A C;  5D4D A;  2R7Z K;  5FLM K;  2A6H A;  4A3M K;  2YU9 C;  4BBR C;  4Q5S A;  4A3M C;  3HKZ D;  2NVQ C;  5IP7 C;  4LJZ A;  1SFO K;  5IP7 K;  2PA8 L;  1R9T C;  2A6E A;  4C2M C;  1I3Q K;  5M3M K;  3H3V L;  3S2H K;  5FLM C;  1YNN A;  3FKI C;  5IYB C;  3GTL K;  3HKZ L;  1Y1V K;  1Y1W K;  1I6H K;  1Y1V C;  1Y1W C;  1R9T K;  4NOI A;  4YG2 A;  1I3Q C;  1SMY A;  5C3E C;  1TWC C;  4A3E C;  3S15 C;  4GZY A;  1I50 K;  5C3E K;  3S1R C;  4A3J C;  3GTP K;  3I4M K;  1I50 C;  3GTK K;  4C3H C;  3S17 C;  1TWF K;  1ZYR A;  2PMZ L;  2A68 A;  4OIN A;  3GTK C;  3HOY C;  3CQZ C;  3HOY K;  3PO2 K;  4BY7 C;  3PO3 K;  4A3E K;  3S15 K;  1HQM A;  3PO3 C;  4BY7 K;  2E2I K;  4A3B K;  2E2I C;  2E2J C;  2R92 K;  2WAQ D;  5IYD C;  2NVT C;  3M3Y C;  3I4N K;  4A3C C;  3M3Y K;  2B63 K;  1BDF A;  4G7H A;  3M4O K;  3GTG K;  4LK1 A;  4G7O A;  4A3L C;  5FJ8 K;  5C4J K;  3RZD C;  4A3K K;  3S14 K;  1K83 K;  4A3D K;  4C3J C;  4XSZ A;  3RZD K;  3H0G C;  4Y52 C;  2WB1 L;  3HOW K;  2JA5 K;  2NVT K;  4OIP A;  5C4X C;  3HOU C;  1WCM C;  2NVX K;  2JA7 C;  3HOV C;  3GTG C;  5C44 C;  5C4J C;  3S16 C; 
#chains in the Genus database with same CATH topology
 3GEI A;  4LK0 A;  5IP9 C;  2JA7 A;  5C4X K;  1DCH A;  1HI9 A;  1WOP A;  2R7Z C;  4X6A K;  2WAQ L;  2XCO A;  2PPB A;  3T00 A;  3LAJ A;  3AH5 A;  2RGR A;  3S1Q C;  2VUM C;  1O25 A;  2NVQ K;  3GTO K;  1XXB A;  4KB4 A;  4A3B C;  3EQL A;  4C3I C;  3ADA C;  2VUM K;  4BBR K;  3GTJ K;  2JH3 A;  1EQR A;  1YX2 A;  1EH1 A;  3PO2 C;  1Y1W A;  4C3I K;  4C3H K;  5M5X K;  1J6V A;  3S2D K;  1JVI A;  4KN7 A;  1WOR A;  5M5W K;  4A3L K;  3CF5 S;  3GTP C;  2R93 C;  2E2H C;  1ZVU A;  2KPU A;  3I4N C;  2V6S A;  5IP9 K;  3GTQ C;  3M4O C;  4KM9 A;  2V6U A;  4A3F C;  2NVY A;  5C44 K;  4C3J K;  3WOD A;  1R9T A;  2E2J K;  3LAP A;  2O5J A;  3N0C A;  4YFK A;  1O27 A;  2YU9 K;  4WF9 S;  3N3Y A;  2JA8 C;  1TWH C;  1IE0 A;  3DXJ A;  1PJ5 A;  3Q3Q A;  3TFJ A;  4X6A C;  2R7Z K;  2A6H A;  2YU9 C;  4A3M C;  4KDD A;  1L0W A;  5IP7 K;  2PA8 L;  4C2M C;  5CJ9 A;  1J6W A;  2KWA A;  1J98 A;  3FKI C;  2L3U A;  3PIO S;  5IYB C;  5HL7 S;  1Y1V C;  1EFW A;  3OEP A;  3GTP K;  4GZY A;  1I50 K;  3AD8 C;  3GTK K;  1ZYR A;  3HOY C;  5HQH A;  1RU0 A;  3S15 K;  4WFN S;  1HQM A;  4FZB A;  2E2J C;  2WAQ D;  4LK1 A;  4A3L C;  5C4J K;  3RZD C;  3VA7 A;  4A3D K;  2WB1 L;  2L5N A;  3HOU C;  3GTQ A;  2JA7 C;  4GTE A;  5C44 C;  2P5M A;  1WSR A;  3HOW C;  3H0G K;  4IO9 S;  3TFH A;  4Y52 K;  2JA5 C;  2R7Z A;  5IOQ A;  3S1M K;  3RZO K;  3BP3 A;  2JA7 K;  2A69 A;  3FKI K;  4MEX A;  3H3V D;  5IYB K;  4BBS K;  2KQ1 A;  5TMF A;  1XZP A;  3HOX K;  4AYB D;  3GTG A;  4Y7N K;  4KAR A;  4A3J K;  1WOO A;  3AQP A;  1UV7 A;  4XSX A;  4XLP A;  1I6H C;  3GSI A;  4XCH A;  3GTO C;  4ZH4 A;  1DCP A;  4KMH A;  3GTJ A;  2XCQ A;  3S17 K;  1O26 A;  4MQ9 A;  1YNJ A;  3OPF A;  1TWG K;  3S2D C;  1DD5 A;  4QJV B;  2E2H K;  1J6X A;  3N0B A;  3S1R K;  1ZQ1 C;  4AH6 A;  1TWG C;  1O2B A;  3GTQ K;  2R93 K;  1TWF C;  1WIH A;  4IOC S;  1G51 A;  2JA6 C;  4A3F K;  1WCM K;  4BXX K;  3GTM A;  1XXC A;  2R92 C;  5IYC K;  2ZJR S;  3HOU K;  2CFA A;  2JA6 K;  1VLO A;  4KAS A;  3HOZ C;  5JVH S;  3CQZ A;  4LQY A;  2JA8 K;  1K83 C;  3GEE A;  1IBA A;  1TWC A;  4BLB A;  1IQ0 A;  1PJ7 A;  2RH6 A;  5E68 A;  2NVQ C;  3A8J A;  4LJZ A;  1JQW A;  2A6E A;  1XZP B;  1YNN A;  4FM9 A;  1F7U A;  1Y1W K;  2XCR B;  4NOI A;  4YG2 A;  1I3Q C;  3GIR A;  3T02 A;  3S1R C;  3TTG A;  4C3H C;  2PMZ L;  3GTK C;  4BY7 C;  2KXY A;  3PO3 C;  1ISE A;  1VGX A;  2ZJQ S;  3V4G A;  1IS1 A;  2E2I C;  1WSV A;  3M3Y C;  4PAB A;  5DM6 S;  1BDF A;  4P5B A;  4G7O A;  1K83 K;  3NUH A;  3RZD K;  1O2A A;  5HL8 A;  2W7V A;  3LPX A;  3GTG C;  4KMU A;  4LR2 A;  3GTM C;  2CFA B;  4LLG A;  4M1X A;  3SZY A;  4JK1 A;  4GTD A;  4BLA A;  3HOZ K;  5JVO A;  4BBS C;  5JFE A;  3GTL C;  3GDZ A;  4GTA A;  2D6F C;  2JA6 A;  2GSU A;  1I3Q A;  4OIR A;  2PHC B;  4A93 K;  3GTL A;  1TWA C;  3FOF A;  3GTJ C;  4QIW L;  3JST A;  3K7A C;  5IOT A;  3AD9 C;  1ZBS A;  3S2H C;  1SFO A;  1DCO A;  1O24 A;  4QIW D;  1XPP A;  1Y1V A;  4C2M K;  5TJ3 A;  3S1N C;  4A3G K;  3G4A A;  1INN A;  4QJV A;  1WQF A;  1F9N A;  4DDQ A;  1TWF A;  5IOR A;  3L4J A;  4MEY A;  4J3N A;  5EGE A;  1WQG A;  4A3K C;  4BKW A;  1TWC K;  3S1N K;  4LOW A;  3SZZ A;  5IYD K;  4YFN A;  1AB4 A;  1JOE A;  4WFB S;  1X31 C;  2ZUE A;  2E2I A;  3S14 C;  3TFI A;  4P9S A;  1YCL A;  5IOS A;  1O29 A;  5TMC A;  2Y0S D;  1TWA A;  2NVX C;  3ERE D;  2O5I A;  1TWA K;  2B63 C;  3RZO C;  4GT9 A;  2WB1 D;  3DLL S;  1WQH A;  5M3F K;  4A3D C;  4PAA A;  5L46 A;  1TWG A;  2CW0 A;  3L4K A;  3H0G A;  4G0V A;  3BP8 C;  5D4D A;  2ZJP S;  5FLM K;  4Q5S A;  4BBR C;  3HKZ D;  1XZQ B;  4GTL A;  3G4C A;  1SFO K;  1R9T C;  1VRQ C;  5FLM C;  4ILD A;  4WCE S;  1USM A;  3HKZ L;  1K83 A;  4KMA A;  1GE9 A;  1Y1W C;  1R9T K;  1VJE A;  3S15 C;  1TWC C;  3I4M K;  5C3E K;  4A3J C;  3PIP S;  2A68 A;  3CQZ C;  3PO2 K;  3FKI A;  3PO3 K;  4BY7 K;  2E2I K;  1XXA A;  4WJ4 A;  2GAG C;  2P8T A;  3CAG A;  4GTC A;  2NVT C;  2B63 A;  4A3C C;  3M3Y K;  2B63 K;  5JVG S;  4A3K K;  5FJ8 K;  1BGW A;  4XSZ A;  3H0G C;  4Y52 C;  2V6T A;  3HOW K;  2GAH C;  3AQO A;  2JA5 K;  2NVT K;  4G0W A;  3AD7 C;  4OIP A;  3HOV C;  2VUM A;  5C4J C;  1EI6 A;  3S16 K;  5M5Y K;  4GTB A;  1TWH A;  3GTM K;  1F93 A;  1XZQ A;  2FQO A;  4O2D A;  3HOV K;  4XLN A;  2GSO A;  2Y3P A;  3S1M C;  3HXA A;  3S1Q K;  2E2H A;  3I4M C;  4A3I C;  4P5A A;  3IPJ A;  4A93 C;  5CHP A;  2Y0S L;  4KAT A;  3K7A K;  1SFO C;  3HOX C;  1B4B A;  2GSN A;  2JA5 A;  4BY1 C;  4A3I K;  2EBB A;  4KAW X;  2PA8 D;  4A3C K;  4BY1 K;  4G7Z A;  3BUE A;  1O2F B;  2PMZ D;  3CQZ K;  4A3G C;  4KB2 A;  3GTK A;  1V5V A;  4BXX C;  1I6V A;  1IL2 A;  1KQ4 A;  4OIO A;  5IYC C;  1WCM A;  4YFX A;  4C45 A;  2NVY K;  4OIQ A;  2ZUF A;  1PJ6 A;  4AYB L;  2BE5 A;  4IOA S;  1WOS A;  4Y7N C;  3S0X A;  3A8K A;  3GTP A;  1BJT A;  2NVY C;  4WJ3 M;  3FHZ A;  3QX3 A;  5EGH A;  4Q4Z A;  1IW7 A;  3T01 A;  3A8I A;  4KN4 A;  1TWH K;  3GEH A;  3MML B;  4A3M K;  1F7V A;  4KC6 A;  4GFQ A;  2FQT A;  5IP7 C;  3FOE A;  2R92 A;  5M3M K;  1I3Q K;  3H3V L;  1BS2 A;  3S2H K;  3GTL K;  4GTF A;  1Y1V K;  1B4A A;  1USO A;  1I6H K;  1C0A A;  2YU9 A;  1I50 A;  1SMY A;  5C3E C;  4A3E C;  1ZXO A;  4WFA S;  2NVX A;  1I50 C;  3S17 C;  1O28 A;  1TWF K;  4OIN A;  3HOY K;  1FEU A;  1VH2 A;  3ORE A;  4A3E K;  2R93 A;  4A3B K;  5DM7 S;  4KMD A;  5IYD C;  2R92 K;  3I4N K;  1EK8 A;  4G0U A;  4G7H A;  4WIL A;  3M4O K;  3GTG K;  3LYW A;  3S14 K;  4U67 S;  4KM8 A;  4C3J C;  3GTO A;  5C4X C;  2NVX K;  1WCM C;  4RMF A;  2ZFZ A;  3S16 C; 
#chains in the Genus database with same CATH homology
 3GTM C;  3S16 K;  3HOW C;  3H0G K;  5M5Y K;  4Y52 K;  3GTM K;  2JA5 C;  4LK0 A;  4LLG A;  5IP9 C;  3S1M K;  5C4X K;  4JK1 A;  3RZO K;  2JA7 K;  3HOV K;  2A69 A;  2R7Z C;  3HOZ K;  3FKI K;  4XLN A;  2WAQ L;  4BBS C;  4MEX A;  2PPB A;  3GTL C;  3H3V D;  5IYB K;  4BBS K;  5TMF A;  3HOX K;  4OIR A;  4AYB D;  4Y7N K;  3S1M C;  3S1Q K;  3I4M C;  4KMU A;  4A3I C;  4A93 K;  3S1Q C;  4A3J K;  1TWA C;  4A93 C;  2VUM C;  2Y0S L;  2NVQ K;  3GTJ C;  3K7A K;  4QIW L;  1SFO C;  3K7A C;  3HOX C;  4XSX A;  4XLP A;  1I6H C;  3GTO K;  4X6A K;  4BY1 C;  3GTO C;  4ZH4 A;  3S2H C;  4A3I K;  4A3B C;  3EQL A;  4C3I C;  2VUM K;  4BBR K;  2PA8 D;  3GTJ K;  3S17 K;  4A3C K;  4QIW D;  1XPP A;  4BY1 K;  4MQ9 A;  3PO2 C;  4G7Z A;  4C2M K;  4C3I K;  1YNJ A;  3S1N C;  4C3H K;  5M5X K;  1TWG K;  3S2D C;  4A3G K;  4QJV A;  2PMZ D;  4A3G C;  3CQZ K;  4KN7 A;  3S2D K;  4MEY A;  5M5W K;  4QJV B;  4BXX C;  2E2H K;  4A3K C;  4A3L K;  1I6V A;  3GTP C;  2R93 C;  2E2H C;  1TWC K;  3S1N K;  3S1R K;  5IYD K;  4YFN A;  1TWG C;  4OIO A;  3GTQ K;  2R93 K;  3I4N C;  5IP9 K;  1TWF C;  5IYC C;  3GTQ C;  4YFX A;  3M4O C;  2JA6 C;  4OIQ A;  1WCM K;  3S14 C;  2NVY K;  4A3F K;  4A3F C;  4AYB L;  4BXX K;  5C44 K;  4C3J K;  2BE5 A;  3WOD A;  4Y7N C;  2R92 C;  2E2J K;  5TMC A;  2Y0S D;  5IYC K;  2NVX C;  2O5J A;  3HOU K;  2NVY C;  4YFK A;  2B63 C;  2O5I A;  3RZO C;  1TWA K;  2JA6 K;  2WB1 D;  2YU9 K;  3HOZ C;  5M3F K;  2JA8 K;  1K83 C;  4Q4Z A;  1IW7 A;  2JA8 C;  4A3D C;  2CW0 A;  1TWH C;  4KN4 A;  3DXJ A;  1TWH K;  4X6A C;  5D4D A;  2R7Z K;  5FLM K;  2A6H A;  4A3M K;  2YU9 C;  4BBR C;  4Q5S A;  4A3M C;  3HKZ D;  2NVQ C;  5IP7 C;  4LJZ A;  1SFO K;  5IP7 K;  2PA8 L;  1R9T C;  2A6E A;  4C2M C;  1I3Q K;  5M3M K;  3H3V L;  3S2H K;  5FLM C;  1YNN A;  3FKI C;  5IYB C;  3GTL K;  3HKZ L;  1Y1V K;  1Y1W K;  1I6H K;  1Y1V C;  1Y1W C;  1R9T K;  4NOI A;  4YG2 A;  1I3Q C;  1SMY A;  5C3E C;  1TWC C;  4A3E C;  3S15 C;  4GZY A;  1I50 K;  5C3E K;  3S1R C;  4A3J C;  3GTP K;  3I4M K;  1I50 C;  3GTK K;  4C3H C;  3S17 C;  1TWF K;  1ZYR A;  2PMZ L;  2A68 A;  4OIN A;  3GTK C;  3HOY C;  3CQZ C;  3HOY K;  3PO2 K;  4BY7 C;  3PO3 K;  4A3E K;  3S15 K;  1HQM A;  3PO3 C;  4BY7 K;  2E2I K;  4A3B K;  2E2I C;  2E2J C;  2R92 K;  2WAQ D;  5IYD C;  2NVT C;  3M3Y C;  3I4N K;  4A3C C;  3M3Y K;  2B63 K;  1BDF A;  4G7H A;  3M4O K;  3GTG K;  4LK1 A;  4G7O A;  4A3L C;  5FJ8 K;  5C4J K;  3RZD C;  4A3K K;  3S14 K;  1K83 K;  4A3D K;  4C3J C;  4XSZ A;  3RZD K;  3H0G C;  4Y52 C;  2WB1 L;  3HOW K;  2JA5 K;  2NVT K;  4OIP A;  5C4X C;  3HOU C;  1WCM C;  2NVX K;  2JA7 C;  3HOV C;  3GTG C;  5C44 C;  5C4J C;  3S16 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...