1ZYRA

Structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic streptolydigin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation.
pubmed doi rcsb
molecule tags Transcription,transferase
total genus 35
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1zyrA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1zyrA01
4C2MC 3GTQK 5M5XK 4KMUA 2JA8K 4BXXK 2CW0A 2A6EA 1I50K 1TWGK 4MQ9A 4BBSC 3GTJK 2A69A 3GTLC 4A3CC 1Y1WK 4OIRA 4LLGA 2JA5C 4XLPA 1TWAC 2R7ZK 1Y1VC 4A3GK 3S1QK 3RZOC 4A3JC 1K83C 5D4DA 3M4OK 1R9TC 3GTMK 2VUMK 2NVTC 5C3EC 3S15C 3I4NC 5FLMK 3S14K 1I3QC 4XSXA 2PPBA 3S1NK 3HOXC 4MEYA 4QJVA 4X6AK 4A3BK 1XPPA 2PA8D 2PA8L 3H0GC 3GTGC 1TWCC 2E2HK 3S1RK 5IP9K 3S2HK 4Y7NC 3HOVK 3GTKC 3PO3K 2YU9C 1SMYA 2O5IA 5IYCC 4G7HA 4QJVB 2R93C 1TWHC 2JA7C 4Q5SA 4NOIA 4MEXA 2B63K 2WB1D 4BBSK 1SFOC 1YNNA 1ZYRA 4G7ZA 3I4MC 4BBRC 4BY7C 2WB1L 3K7AC 4LJZA 1TWFK 2NVXK 3RZDC 4C3HK 2E2JC 1TWAK 3HOUC 2JA6K 5M5WK 1K83K 3S17C 5C4JK 3FKIC 4Y52K 3HKZD 3HOWK 4A3LK 4G7OA 3HKZL 4A3KC 3S2DC 4C3JC 1I6HC 5C4XC 4LK1A 2NVYK 5IYBK 5IP7K 3GTGK 3GTPC 4KN7A 2O5JA 4A3MK 3S1MC 4BY1K 4ZH4A 1HQMA 3DXJA 4XSZA 2E2IC 3WODA 4AYBD 4KN4A 3M3YC 3S16C 4AYBL 2R92K 4A93C 3PO2K 4C2MK 4A3EC 4A3DC 4A3IC 3K7AK 2WAQL 3GTQC 5C44C 3EQLA 5IYDC 5M5YK 1TWGC 1I50C 3GTLK 3GTOC 4A3CK 4YFXA 2JA5K 4YFKA 1Y1VK 4A3IK 3RZOK 4A3JK 4A3KK 2PMZD 2R7ZC 1R9TK 2PMZL 3HOZC 4A3GC 5C3EK 3S1QC 2NVTK 3I4NK 3S15K 1I3QK 4YFNA 3M4OC 3GTMC 4C3IC 2VUMC 3HOXK 3GTPK 5FLMC 3S1MK 2NVQC 4OIOA 3H0GK 3S1NC 5FJ8K 1TWCK 4X6AC 2E2IK 3S16K 4QIWD 4QIWL 1WCMC 4Y7NK 3GTKK 4A3EK 4A3FC 4JK1A 2BE5A 2YU9K 4A3DK 3HOYC 2E2HC 5IYCK 5IP9C 5M3MK 1IW7A 3HOVC 4GZYA 1TWHK 3PO3C 2JA7K 4OINA 2R93K 5C44K 1SFOK 3I4MK 3CQZC 5TMCA 4BY7K 4BBRK 5IYDK 2WAQD 2B63C 3GTOK 2JA8C 4BXXC 3RZDK 2E2JK 4YG2A 3HOUK 1TWFC 4LK0A 2NVXC 4C3HC 3GTJC 5TMFA 3S17K 3FKIK 3HOZK 1BDFA 3H3VD 2JA6C 3H3VL 1Y1WC 2A68A 5C4JC 1YNJA 4C3IK 3S2DK 4Y52C 4C3JK 5C4XK 1I6HK 3HOWC 4A3LC 2NVQK 4XLNA 2Y0SD 4OIPA 2Y0SL 1WCMK 5M3FK 2NVYC 5IYBC 5IP7C 3S14C 4A3FK 4OIQA 2A6HA 4Q4ZA 3HOYK 3M3YK 4A3BC 4BY1C 4A93K 4A3MC 2R92C 3CQZK 3PO2C 3S1RC 1I6VA 3S2HC
chains in the Genus database with same CATH superfamily
4C2MC 3GTQK 2CW0A 4KMDA 3T02A 1I50K 1TWGK 2XCOA 1DCHA 4MQ9A 2GSNA 1PJ5A 3SZYA 4A3CC 4KASA 1Y1WK 3CQZA 2R7ZK 1DCPA 1TWAC 3GTQA 1O25A 1R9TC 3GTMK 1TWGA 1I50A 5FLMK 4XSXA 4A3BK 1VLOA 1PJ6A 1XPPA 1Y1WA 3GTGC 1TWCC 3VA7A 2L3UA 3T01A 4Y7NC 2FQOA 1JQWA 4BBSK 4WJ4A 1ISEA 1TWFK 4C3HK 4KAWX 4M1XA 4WILA 3TTGA 4G7OA 4RMFA 1WQFA 5IOSA 5C4XC 4LK1A 1TWFA 5IP7K 3GIRA 3SZZA 3GTPC 2O5JA 3PIPS 3S1MC 4LOWA 4A3MK 3M3YC 3Q3QA 4BKWA 1C0AA 3K7AK 3GTQC 1EK8A 1B4BA 3EQLA 1TWGC 1I50C 3GTLK 1UV7A 1TWHA 3V4GA 2JA7A 4YFKA 1USMA 4GT9A 4A3JK 4KMHA 2Y3PA 2R7ZC 2NVTK 3S15K 1I3QK 3JSTA 1JVIA 3GTMC 3HOXK 5DM6S 5FLMC 3GTLA 4OIOA 3H0GK 1ZXOA 1ZQ1C 1AB4A 3GTKK 4A3EK 4JK1A 2BE5A 5TJ3A 2YU9K 4BLBA 1BS2A 1I3QA 4IOCS 4C45A 2P8TA 4BBRK 2WAQD 2JA8C 2E2JK 3GTKA 3HOUK 1TWFC 4C3HC 1DCOA 2YU9A 5TMFA 3S17K 4C3IK 2ZFZA 4C3JK 2GAGC 1WCMK 5IP7C 3DLLS 4A93K 1USOA 4A3MC 1EQRA 4U67S 4GTCA 4A3IK 3S1RC 4BXXK 1XZPB 1WCMA 2L5NA 1WORA 2PHCB 4GTAA 4PABA 3GTJK 1O24A 4FZBA 2A69A 3GTLC 1VJEA 1WOPA 3AH5A 4OIRA 4LLGA 4XLPA 4A3JC 1K83C 1KQ4A 2NVTC 2P5MA 3S15C 1I3QC 2PPBA 3GTJA 3HOXC 4QJVA 3S0XA 5IORA 4WFAS 3H0GC 3S2HK 3TFJA 3GTKC 3PO3K 4P5BA 2YU9C 1SMYA 4G7HA 5HQHA 1F7UA 4NOIA 1ZYRA 1J6XA 4BBRC 4O2DA 4XCHA 2NVXK 2R92A 2E2JC 3HOUC 3N0CA 3S17C 4Y52K 4AH6A 4A3LK 4C3JC 4FM9A 5IYBK 2NVXA 4KN7A 2CFAA 4BY1K 4ZH4A 3DXJA 4GTEA 4AYBD 3S16C 1WQGA 3BUEA 4AYBL 3PO2K 4A93C 3LPXA 4A3DC 4A3IC 4G0VA 1XXAA 2XCRB 1SFOA 4A3KK 3T00A 3I4NK 4YFNA 2GSUA 5CJ9A 2NVQC 3GEIA 2E2IK 5FJ8K 1WOOA 3FKIA 4KMAA 4KDDA 2GAHC 5JFEA 3HOYC 1F7VA 1WQHA 2R93K 1TWHK 3PO3C 2JA7K 5CHPA 5C44K 4BY7K 3CQZC 5TMCA 1ZBSA 5IYDK 1XXBA 4P9SA 3GTOK 1JOEA 3RZDK 2E2IA 2JH3A 2NVXC 4WFNS 4G0WA 3HOZK 2R93A 2V6SA 1Y1WC 3AQOA 3S2DK 3TFHA 4Y52C 1I6HK 3GTOA 4A3LC 1IBAA 1F9NA 1G51A 4IO9S 5M3FK 5IYBC 4A3FK 4OIQA 1O2BA 4A3BC 4BY1C 3GEHA 3PO2C 1I6VA 5M5XK 1VRQC 3CAGA 4BBSC 5JVOA 3G4AA 2E2HA 4WCES 1WSRA 4J3NA 4A3GK 3S1QK 3BP3A 2VUMK 3I4NC 3S14K 3S1NK 3A8JA 3BP8C 3N0BA 1O26A 3MMLB 5DM7S 4KARA 5IP9K 4BLAA 2CFAB 2D6FC 2V6UA 2VUMA 5JVHS 1TWHC 2JA7C 4Q5SA 2R93C 2B63K 1EI6A 4BY7C 4G7ZA 1F93A 3K7AC 2ZJPS 1V5VA 4LJZA 3RZDC 2KXYA 1TWAK 3AQPA 2JA6K 5EGHA 5C4JK 3G4CA 2B63A 3HKZD 1O29A 3HOWK 3HKZL 3S2DC 3PIOS 1I6HC 3TFIA 2NVYK 3GTGK 1TWAA 3GDZA 5E68A 2JA6A 4LQYA 1HQMA 3WODA 2R92K 3L4KA 4A3EC 1WOSA 4LR2A 2NVYA 3GTGA 3OEPA 1IE0A 2GSOA 1IL2A 3LYWA 5JVGS 2JA5K 1O28A 1Y1VK 3HXAA 3RZOK 3ERED 4WJ3M 4A3GC 5C3EK 3S1QC 3A8IA 1WSVA 4C3IC 2VUMC 1HI9A 3GTPK 1O27A 3S1MK 3S1NC 1RU0A 4QIWD 2JA5A 4QIWL 1WCMC 1Y1VA 3ADAC 4WFBS 5IYCK 5IP9C 5M3MK 4GZYA 5IOTA 5HL7S 4OINA 4GTDA 1SFOK 3I4MK 3GTPA 2B63C 2ZJRS 4BXXC 4DDQA 4GTFA 3GTJC 3FKIK 3H3VD 2JA6C 2ZJQS 3H3VL 3L4JA 1J98A 1EH1A 5C4JC 1YNJA 3HOWC 4XLNA 2Y0SD 4OIPA 1ZVUA 1FEUA 2Y0SL 2NVYC 2ZUFA 2A6HA 2KQ1A 2R7ZA 1XZPA 4KATA 5IOQA 3FOFA 2R92C 3QX3A 3GTMA 3S2HC 1VH2A 3AD9C 4KMUA 2JA8K 2A6EA 3GSIA 2XCQA 2JA5C 1Y1VC 3RZOC 5D4DA 3M4OK 5C3EC 1XZQA 4KM8A 4MEYA 4X6AK 1GE9A 4GTBA 1EFWA 4ILDA 2PA8D 2PA8L 1XXCA 2E2HK 3S1RK 3HOVK 4KM9A 4IOAS 2O5IA 5IYCC 1INNA 1O2AA 4QJVB 3NUHA 4MEXA 2WB1D 1SFOC 1YNNA 3I4MC 2WB1L 1YCLA 1X31C 5M5WK 1K83K 2RGRA 3FKIC 3A8KA 4PAAA 1BJTA 1J6WA 4A3KC 1J6VA 4GTLA 3LAJA 2W7VA 1K83A 4XSZA 2E2IC 1B4AA 4KN4A 2EBBA 2RH6A 4C2MK 3GEEA 3FOEA 2WAQL 4KC6A 3H0GA 5C44C 5IYDC 5M5YK 3GTOC 4A3CK 4YFXA 3N3YA 1WIHA 1O2FB 2PMZD 2FQTA 1R9TK 2PMZL 3HOZC 4KB4A 4P5AA 3M4OC 5HL8A 3OPFA 4KB2A 3FHZA 1TWCK 4X6AC 3S16K 5EGEA 3IPJA 4Y7NK 4A3FC 4A3DK 2E2HC 1R9TA 1IW7A 3HOVC 5L46A 1L0WA 3CF5S 2KPUA 3AD7C 2ZUEA 2V6TA 1BGWA 1TWCA 3LAPA 2KWAA 1DD5A 3OREA 4YG2A 1IQ0A 1IS1A 4LK0A 1BDFA 2A68A 3AD8C 5C4XK 1PJ7A 2NVQK 1VGXA 1YX2A 4G0UA 4GFQA 3S14C 4Q4ZA 3HOYK 1XZQB 3M3YK 3CQZK 4WF9S
chains in the Genus database with same CATH topology
4C2MC 3GTQK 5M5XK 4KMUA 2JA8K 4BXXK 2CW0A 2A6EA 1I50K 1TWGK 4MQ9A 4BBSC 3GTJK 2A69A 3GTLC 4A3CC 1Y1WK 4OIRA 4LLGA 2JA5C 4XLPA 1TWAC 2R7ZK 1Y1VC 4A3GK 3S1QK 3RZOC 4A3JC 1K83C 5D4DA 3M4OK 1R9TC 3GTMK 2VUMK 2NVTC 5C3EC 3S15C 3I4NC 5FLMK 3S14K 1I3QC 4XSXA 2PPBA 3S1NK 3HOXC 4MEYA 4QJVA 4X6AK 4A3BK 1XPPA 2PA8D 2PA8L 3H0GC 3GTGC 1TWCC 2E2HK 3S1RK 5IP9K 3S2HK 4Y7NC 3HOVK 3GTKC 3PO3K 2YU9C 1SMYA 2O5IA 5IYCC 4G7HA 4QJVB 2R93C 1TWHC 2JA7C 4Q5SA 4NOIA 4MEXA 2B63K 2WB1D 4BBSK 1SFOC 1YNNA 1ZYRA 4G7ZA 3I4MC 4BBRC 4BY7C 2WB1L 3K7AC 4LJZA 1TWFK 2NVXK 3RZDC 4C3HK 2E2JC 1TWAK 3HOUC 2JA6K 5M5WK 1K83K 3S17C 5C4JK 3FKIC 4Y52K 3HKZD 3HOWK 4A3LK 4G7OA 3HKZL 4A3KC 3S2DC 4C3JC 1I6HC 5C4XC 4LK1A 2NVYK 5IYBK 5IP7K 3GTGK 3GTPC 4KN7A 2O5JA 4A3MK 3S1MC 4BY1K 4ZH4A 1HQMA 3DXJA 4XSZA 2E2IC 3WODA 4AYBD 4KN4A 3M3YC 3S16C 4AYBL 2R92K 4A93C 3PO2K 4C2MK 4A3EC 4A3DC 4A3IC 3K7AK 2WAQL 3GTQC 5C44C 3EQLA 5IYDC 5M5YK 1TWGC 1I50C 3GTLK 3GTOC 4A3CK 4YFXA 2JA5K 4YFKA 1Y1VK 4A3IK 3RZOK 4A3JK 4A3KK 2PMZD 2R7ZC 1R9TK 2PMZL 3HOZC 4A3GC 5C3EK 3S1QC 2NVTK 3I4NK 3S15K 1I3QK 4YFNA 3M4OC 3GTMC 4C3IC 2VUMC 3HOXK 3GTPK 5FLMC 3S1MK 2NVQC 4OIOA 3H0GK 3S1NC 5FJ8K 1TWCK 4X6AC 2E2IK 3S16K 4QIWD 4QIWL 1WCMC 4Y7NK 3GTKK 4A3EK 4A3FC 4JK1A 2BE5A 2YU9K 4A3DK 3HOYC 2E2HC 5IYCK 5IP9C 5M3MK 1IW7A 3HOVC 4GZYA 1TWHK 3PO3C 2JA7K 4OINA 2R93K 5C44K 1SFOK 3I4MK 3CQZC 5TMCA 4BY7K 4BBRK 5IYDK 2WAQD 2B63C 3GTOK 2JA8C 4BXXC 3RZDK 2E2JK 4YG2A 3HOUK 1TWFC 4LK0A 2NVXC 4C3HC 3GTJC 5TMFA 3S17K 3FKIK 3HOZK 1BDFA 3H3VD 2JA6C 3H3VL 1Y1WC 2A68A 5C4JC 1YNJA 4C3IK 3S2DK 4Y52C 4C3JK 5C4XK 1I6HK 3HOWC 4A3LC 2NVQK 4XLNA 2Y0SD 4OIPA 2Y0SL 1WCMK 5M3FK 2NVYC 5IYBC 5IP7C 3S14C 4A3FK 4OIQA 2A6HA 4Q4ZA 3HOYK 3M3YK 4A3BC 4BY1C 4A93K 4A3MC 2R92C 3CQZK 3PO2C 3S1RC 1I6VA 3S2HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2M C;  3GTQ K;  5M5X K;  4KMU A;  2JA8 K;  4BXX K;  2CW0 A;  2A6E A;  1I50 K;  1TWG K;  4MQ9 A;  4BBS C;  3GTJ K;  2A69 A;  3GTL C;  4A3C C;  1Y1W K;  4OIR A;  4LLG A;  2JA5 C;  4XLP A;  1TWA C;  2R7Z K;  1Y1V C;  4A3G K;  3S1Q K;  3RZO C;  4A3J C;  1K83 C;  5D4D A;  3M4O K;  1R9T C;  3GTM K;  2VUM K;  2NVT C;  5C3E C;  3S15 C;  3I4N C;  5FLM K;  3S14 K;  1I3Q C;  4XSX A;  2PPB A;  3S1N K;  3HOX C;  4MEY A;  4QJV A;  4X6A K;  4A3B K;  1XPP A;  2PA8 D;  2PA8 L;  3H0G C;  3GTG C;  1TWC C;  2E2H K;  3S1R K;  5IP9 K;  3S2H K;  4Y7N C;  3HOV K;  3GTK C;  3PO3 K;  2YU9 C;  1SMY A;  2O5I A;  5IYC C;  4G7H A;  4QJV B;  2R93 C;  1TWH C;  2JA7 C;  4Q5S A;  4NOI A;  4MEX A;  2B63 K;  2WB1 D;  4BBS K;  1SFO C;  1YNN A;  1ZYR A;  4G7Z A;  3I4M C;  4BBR C;  4BY7 C;  2WB1 L;  3K7A C;  4LJZ A;  1TWF K;  2NVX K;  3RZD C;  4C3H K;  2E2J C;  1TWA K;  3HOU C;  2JA6 K;  5M5W K;  1K83 K;  3S17 C;  5C4J K;  3FKI C;  4Y52 K;  3HKZ D;  3HOW K;  4A3L K;  4G7O A;  3HKZ L;  4A3K C;  3S2D C;  4C3J C;  1I6H C;  5C4X C;  4LK1 A;  2NVY K;  5IYB K;  5IP7 K;  3GTG K;  3GTP C;  4KN7 A;  2O5J A;  4A3M K;  3S1M C;  4BY1 K;  4ZH4 A;  1HQM A;  3DXJ A;  4XSZ A;  2E2I C;  3WOD A;  4AYB D;  4KN4 A;  3M3Y C;  3S16 C;  4AYB L;  2R92 K;  4A93 C;  3PO2 K;  4C2M K;  4A3E C;  4A3D C;  4A3I C;  3K7A K;  2WAQ L;  3GTQ C;  5C44 C;  3EQL A;  5IYD C;  5M5Y K;  1TWG C;  1I50 C;  3GTL K;  3GTO C;  4A3C K;  4YFX A;  2JA5 K;  4YFK A;  1Y1V K;  4A3I K;  3RZO K;  4A3J K;  4A3K K;  2PMZ D;  2R7Z C;  1R9T K;  2PMZ L;  3HOZ C;  4A3G C;  5C3E K;  3S1Q C;  2NVT K;  3I4N K;  3S15 K;  1I3Q K;  4YFN A;  3M4O C;  3GTM C;  4C3I C;  2VUM C;  3HOX K;  3GTP K;  5FLM C;  3S1M K;  2NVQ C;  4OIO A;  3H0G K;  3S1N C;  5FJ8 K;  1TWC K;  4X6A C;  2E2I K;  3S16 K;  4QIW D;  4QIW L;  1WCM C;  4Y7N K;  3GTK K;  4A3E K;  4A3F C;  4JK1 A;  2BE5 A;  2YU9 K;  4A3D K;  3HOY C;  2E2H C;  5IYC K;  5IP9 C;  5M3M K;  1IW7 A;  3HOV C;  4GZY A;  1TWH K;  3PO3 C;  2JA7 K;  4OIN A;  2R93 K;  5C44 K;  1SFO K;  3I4M K;  3CQZ C;  5TMC A;  4BY7 K;  4BBR K;  5IYD K;  2WAQ D;  2B63 C;  3GTO K;  2JA8 C;  4BXX C;  3RZD K;  2E2J K;  4YG2 A;  3HOU K;  1TWF C;  4LK0 A;  2NVX C;  4C3H C;  3GTJ C;  5TMF A;  3S17 K;  3FKI K;  3HOZ K;  1BDF A;  3H3V D;  2JA6 C;  3H3V L;  1Y1W C;  2A68 A;  5C4J C;  1YNJ A;  4C3I K;  3S2D K;  4Y52 C;  4C3J K;  5C4X K;  1I6H K;  3HOW C;  4A3L C;  2NVQ K;  4XLN A;  2Y0S D;  4OIP A;  2Y0S L;  1WCM K;  5M3F K;  2NVY C;  5IYB C;  5IP7 C;  3S14 C;  4A3F K;  4OIQ A;  2A6H A;  4Q4Z A;  3HOY K;  3M3Y K;  4A3B C;  4BY1 C;  4A93 K;  4A3M C;  2R92 C;  3CQZ K;  3PO2 C;  3S1R C;  1I6V A;  3S2H C; 
#chains in the Genus database with same CATH topology
 4C2M C;  3GTQ K;  2CW0 A;  4KMD A;  3T02 A;  1I50 K;  1TWG K;  2XCO A;  1DCH A;  4MQ9 A;  2GSN A;  1PJ5 A;  3SZY A;  4A3C C;  4KAS A;  1Y1W K;  3CQZ A;  2R7Z K;  1DCP A;  1TWA C;  3GTQ A;  1O25 A;  1R9T C;  3GTM K;  1TWG A;  1I50 A;  5FLM K;  4XSX A;  4A3B K;  1VLO A;  1PJ6 A;  1XPP A;  1Y1W A;  3GTG C;  1TWC C;  3VA7 A;  2L3U A;  3T01 A;  4Y7N C;  2FQO A;  1JQW A;  4BBS K;  4WJ4 A;  1ISE A;  1TWF K;  4C3H K;  4KAW X;  4M1X A;  4WIL A;  3TTG A;  4G7O A;  4RMF A;  1WQF A;  5IOS A;  5C4X C;  4LK1 A;  1TWF A;  5IP7 K;  3GIR A;  3SZZ A;  3GTP C;  2O5J A;  3PIP S;  3S1M C;  4LOW A;  4A3M K;  3M3Y C;  3Q3Q A;  4BKW A;  1C0A A;  3K7A K;  3GTQ C;  1EK8 A;  1B4B A;  3EQL A;  1TWG C;  1I50 C;  3GTL K;  1UV7 A;  1TWH A;  3V4G A;  2JA7 A;  4YFK A;  1USM A;  4GT9 A;  4A3J K;  4KMH A;  2Y3P A;  2R7Z C;  2NVT K;  3S15 K;  1I3Q K;  3JST A;  1JVI A;  3GTM C;  3HOX K;  5DM6 S;  5FLM C;  3GTL A;  4OIO A;  3H0G K;  1ZXO A;  1ZQ1 C;  1AB4 A;  3GTK K;  4A3E K;  4JK1 A;  2BE5 A;  5TJ3 A;  2YU9 K;  4BLB A;  1BS2 A;  1I3Q A;  4IOC S;  4C45 A;  2P8T A;  4BBR K;  2WAQ D;  2JA8 C;  2E2J K;  3GTK A;  3HOU K;  1TWF C;  4C3H C;  1DCO A;  2YU9 A;  5TMF A;  3S17 K;  4C3I K;  2ZFZ A;  4C3J K;  2GAG C;  1WCM K;  5IP7 C;  3DLL S;  4A93 K;  1USO A;  4A3M C;  1EQR A;  4U67 S;  4GTC A;  4A3I K;  3S1R C;  4BXX K;  1XZP B;  1WCM A;  2L5N A;  1WOR A;  2PHC B;  4GTA A;  4PAB A;  3GTJ K;  1O24 A;  4FZB A;  2A69 A;  3GTL C;  1VJE A;  1WOP A;  3AH5 A;  4OIR A;  4LLG A;  4XLP A;  4A3J C;  1K83 C;  1KQ4 A;  2NVT C;  2P5M A;  3S15 C;  1I3Q C;  2PPB A;  3GTJ A;  3HOX C;  4QJV A;  3S0X A;  5IOR A;  4WFA S;  3H0G C;  3S2H K;  3TFJ A;  3GTK C;  3PO3 K;  4P5B A;  2YU9 C;  1SMY A;  4G7H A;  5HQH A;  1F7U A;  4NOI A;  1ZYR A;  1J6X A;  4BBR C;  4O2D A;  4XCH A;  2NVX K;  2R92 A;  2E2J C;  3HOU C;  3N0C A;  3S17 C;  4Y52 K;  4AH6 A;  4A3L K;  4C3J C;  4FM9 A;  5IYB K;  2NVX A;  4KN7 A;  2CFA A;  4BY1 K;  4ZH4 A;  3DXJ A;  4GTE A;  4AYB D;  3S16 C;  1WQG A;  3BUE A;  4AYB L;  3PO2 K;  4A93 C;  3LPX A;  4A3D C;  4A3I C;  4G0V A;  1XXA A;  2XCR B;  1SFO A;  4A3K K;  3T00 A;  3I4N K;  4YFN A;  2GSU A;  5CJ9 A;  2NVQ C;  3GEI A;  2E2I K;  5FJ8 K;  1WOO A;  3FKI A;  4KMA A;  4KDD A;  2GAH C;  5JFE A;  3HOY C;  1F7V A;  1WQH A;  2R93 K;  1TWH K;  3PO3 C;  2JA7 K;  5CHP A;  5C44 K;  4BY7 K;  3CQZ C;  5TMC A;  1ZBS A;  5IYD K;  1XXB A;  4P9S A;  3GTO K;  1JOE A;  3RZD K;  2E2I A;  2JH3 A;  2NVX C;  4WFN S;  4G0W A;  3HOZ K;  2R93 A;  2V6S A;  1Y1W C;  3AQO A;  3S2D K;  3TFH A;  4Y52 C;  1I6H K;  3GTO A;  4A3L C;  1IBA A;  1F9N A;  1G51 A;  4IO9 S;  5M3F K;  5IYB C;  4A3F K;  4OIQ A;  1O2B A;  4A3B C;  4BY1 C;  3GEH A;  3PO2 C;  1I6V A;  5M5X K;  1VRQ C;  3CAG A;  4BBS C;  5JVO A;  3G4A A;  2E2H A;  4WCE S;  1WSR A;  4J3N A;  4A3G K;  3S1Q K;  3BP3 A;  2VUM K;  3I4N C;  3S14 K;  3S1N K;  3A8J A;  3BP8 C;  3N0B A;  1O26 A;  3MML B;  5DM7 S;  4KAR A;  5IP9 K;  4BLA A;  2CFA B;  2D6F C;  2V6U A;  2VUM A;  5JVH S;  1TWH C;  2JA7 C;  4Q5S A;  2R93 C;  2B63 K;  1EI6 A;  4BY7 C;  4G7Z A;  1F93 A;  3K7A C;  2ZJP S;  1V5V A;  4LJZ A;  3RZD C;  2KXY A;  1TWA K;  3AQP A;  2JA6 K;  5EGH A;  5C4J K;  3G4C A;  2B63 A;  3HKZ D;  1O29 A;  3HOW K;  3HKZ L;  3S2D C;  3PIO S;  1I6H C;  3TFI A;  2NVY K;  3GTG K;  1TWA A;  3GDZ A;  5E68 A;  2JA6 A;  4LQY A;  1HQM A;  3WOD A;  2R92 K;  3L4K A;  4A3E C;  1WOS A;  4LR2 A;  2NVY A;  3GTG A;  3OEP A;  1IE0 A;  2GSO A;  1IL2 A;  3LYW A;  5JVG S;  2JA5 K;  1O28 A;  1Y1V K;  3HXA A;  3RZO K;  3ERE D;  4WJ3 M;  4A3G C;  5C3E K;  3S1Q C;  3A8I A;  1WSV A;  4C3I C;  2VUM C;  1HI9 A;  3GTP K;  1O27 A;  3S1M K;  3S1N C;  1RU0 A;  4QIW D;  2JA5 A;  4QIW L;  1WCM C;  1Y1V A;  3ADA C;  4WFB S;  5IYC K;  5IP9 C;  5M3M K;  4GZY A;  5IOT A;  5HL7 S;  4OIN A;  4GTD A;  1SFO K;  3I4M K;  3GTP A;  2B63 C;  2ZJR S;  4BXX C;  4DDQ A;  4GTF A;  3GTJ C;  3FKI K;  3H3V D;  2JA6 C;  2ZJQ S;  3H3V L;  3L4J A;  1J98 A;  1EH1 A;  5C4J C;  1YNJ A;  3HOW C;  4XLN A;  2Y0S D;  4OIP A;  1ZVU A;  1FEU A;  2Y0S L;  2NVY C;  2ZUF A;  2A6H A;  2KQ1 A;  2R7Z A;  1XZP A;  4KAT A;  5IOQ A;  3FOF A;  2R92 C;  3QX3 A;  3GTM A;  3S2H C;  1VH2 A;  3AD9 C;  4KMU A;  2JA8 K;  2A6E A;  3GSI A;  2XCQ A;  2JA5 C;  1Y1V C;  3RZO C;  5D4D A;  3M4O K;  5C3E C;  1XZQ A;  4KM8 A;  4MEY A;  4X6A K;  1GE9 A;  4GTB A;  1EFW A;  4ILD A;  2PA8 D;  2PA8 L;  1XXC A;  2E2H K;  3S1R K;  3HOV K;  4KM9 A;  4IOA S;  2O5I A;  5IYC C;  1INN A;  1O2A A;  4QJV B;  3NUH A;  4MEX A;  2WB1 D;  1SFO C;  1YNN A;  3I4M C;  2WB1 L;  1YCL A;  1X31 C;  5M5W K;  1K83 K;  2RGR A;  3FKI C;  3A8K A;  4PAA A;  1BJT A;  1J6W A;  4A3K C;  1J6V A;  4GTL A;  3LAJ A;  2W7V A;  1K83 A;  4XSZ A;  2E2I C;  1B4A A;  4KN4 A;  2EBB A;  2RH6 A;  4C2M K;  3GEE A;  3FOE A;  2WAQ L;  4KC6 A;  3H0G A;  5C44 C;  5IYD C;  5M5Y K;  3GTO C;  4A3C K;  4YFX A;  3N3Y A;  1WIH A;  1O2F B;  2PMZ D;  2FQT A;  1R9T K;  2PMZ L;  3HOZ C;  4KB4 A;  4P5A A;  3M4O C;  5HL8 A;  3OPF A;  4KB2 A;  3FHZ A;  1TWC K;  4X6A C;  3S16 K;  5EGE A;  3IPJ A;  4Y7N K;  4A3F C;  4A3D K;  2E2H C;  1R9T A;  1IW7 A;  3HOV C;  5L46 A;  1L0W A;  3CF5 S;  2KPU A;  3AD7 C;  2ZUE A;  2V6T A;  1BGW A;  1TWC A;  3LAP A;  2KWA A;  1DD5 A;  3ORE A;  4YG2 A;  1IQ0 A;  1IS1 A;  4LK0 A;  1BDF A;  2A68 A;  3AD8 C;  5C4X K;  1PJ7 A;  2NVQ K;  1VGX A;  1YX2 A;  4G0U A;  4GFQ A;  3S14 C;  4Q4Z A;  3HOY K;  1XZQ B;  3M3Y K;  3CQZ K;  4WF9 S; 
#chains in the Genus database with same CATH homology
 4C2M C;  3GTQ K;  5M5X K;  4KMU A;  2JA8 K;  4BXX K;  2CW0 A;  2A6E A;  1I50 K;  1TWG K;  4MQ9 A;  4BBS C;  3GTJ K;  2A69 A;  3GTL C;  4A3C C;  1Y1W K;  4OIR A;  4LLG A;  2JA5 C;  4XLP A;  1TWA C;  2R7Z K;  1Y1V C;  4A3G K;  3S1Q K;  3RZO C;  4A3J C;  1K83 C;  5D4D A;  3M4O K;  1R9T C;  3GTM K;  2VUM K;  2NVT C;  5C3E C;  3S15 C;  3I4N C;  5FLM K;  3S14 K;  1I3Q C;  4XSX A;  2PPB A;  3S1N K;  3HOX C;  4MEY A;  4QJV A;  4X6A K;  4A3B K;  1XPP A;  2PA8 D;  2PA8 L;  3H0G C;  3GTG C;  1TWC C;  2E2H K;  3S1R K;  5IP9 K;  3S2H K;  4Y7N C;  3HOV K;  3GTK C;  3PO3 K;  2YU9 C;  1SMY A;  2O5I A;  5IYC C;  4G7H A;  4QJV B;  2R93 C;  1TWH C;  2JA7 C;  4Q5S A;  4NOI A;  4MEX A;  2B63 K;  2WB1 D;  4BBS K;  1SFO C;  1YNN A;  1ZYR A;  4G7Z A;  3I4M C;  4BBR C;  4BY7 C;  2WB1 L;  3K7A C;  4LJZ A;  1TWF K;  2NVX K;  3RZD C;  4C3H K;  2E2J C;  1TWA K;  3HOU C;  2JA6 K;  5M5W K;  1K83 K;  3S17 C;  5C4J K;  3FKI C;  4Y52 K;  3HKZ D;  3HOW K;  4A3L K;  4G7O A;  3HKZ L;  4A3K C;  3S2D C;  4C3J C;  1I6H C;  5C4X C;  4LK1 A;  2NVY K;  5IYB K;  5IP7 K;  3GTG K;  3GTP C;  4KN7 A;  2O5J A;  4A3M K;  3S1M C;  4BY1 K;  4ZH4 A;  1HQM A;  3DXJ A;  4XSZ A;  2E2I C;  3WOD A;  4AYB D;  4KN4 A;  3M3Y C;  3S16 C;  4AYB L;  2R92 K;  4A93 C;  3PO2 K;  4C2M K;  4A3E C;  4A3D C;  4A3I C;  3K7A K;  2WAQ L;  3GTQ C;  5C44 C;  3EQL A;  5IYD C;  5M5Y K;  1TWG C;  1I50 C;  3GTL K;  3GTO C;  4A3C K;  4YFX A;  2JA5 K;  4YFK A;  1Y1V K;  4A3I K;  3RZO K;  4A3J K;  4A3K K;  2PMZ D;  2R7Z C;  1R9T K;  2PMZ L;  3HOZ C;  4A3G C;  5C3E K;  3S1Q C;  2NVT K;  3I4N K;  3S15 K;  1I3Q K;  4YFN A;  3M4O C;  3GTM C;  4C3I C;  2VUM C;  3HOX K;  3GTP K;  5FLM C;  3S1M K;  2NVQ C;  4OIO A;  3H0G K;  3S1N C;  5FJ8 K;  1TWC K;  4X6A C;  2E2I K;  3S16 K;  4QIW D;  4QIW L;  1WCM C;  4Y7N K;  3GTK K;  4A3E K;  4A3F C;  4JK1 A;  2BE5 A;  2YU9 K;  4A3D K;  3HOY C;  2E2H C;  5IYC K;  5IP9 C;  5M3M K;  1IW7 A;  3HOV C;  4GZY A;  1TWH K;  3PO3 C;  2JA7 K;  4OIN A;  2R93 K;  5C44 K;  1SFO K;  3I4M K;  3CQZ C;  5TMC A;  4BY7 K;  4BBR K;  5IYD K;  2WAQ D;  2B63 C;  3GTO K;  2JA8 C;  4BXX C;  3RZD K;  2E2J K;  4YG2 A;  3HOU K;  1TWF C;  4LK0 A;  2NVX C;  4C3H C;  3GTJ C;  5TMF A;  3S17 K;  3FKI K;  3HOZ K;  1BDF A;  3H3V D;  2JA6 C;  3H3V L;  1Y1W C;  2A68 A;  5C4J C;  1YNJ A;  4C3I K;  3S2D K;  4Y52 C;  4C3J K;  5C4X K;  1I6H K;  3HOW C;  4A3L C;  2NVQ K;  4XLN A;  2Y0S D;  4OIP A;  2Y0S L;  1WCM K;  5M3F K;  2NVY C;  5IYB C;  5IP7 C;  3S14 C;  4A3F K;  4OIQ A;  2A6H A;  4Q4Z A;  3HOY K;  3M3Y K;  4A3B C;  4BY1 C;  4A93 K;  4A3M C;  2R92 C;  3CQZ K;  3PO2 C;  3S1R C;  1I6V A;  3S2H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...