1ZYRA

Structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic streptolydigin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation.
pubmed doi rcsb
molecule tags Transcription,transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 35
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1zyrA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1zyrA01
2WB1D 2NVTC 5M3MK 4LK1A 3GTJK 4A3FK 3H0GK 3HOXC 2JA7K 5IYCC 4A93K 4YG2A 3RZOC 4OIPA 4AYBL 5FLMC 4MEXA 4BBRC 1R9TK 4Y52K 1R9TC 4C3IK 3S2DK 1I50K 1YNNA 3H3VL 3S1MC 4A3LK 2NVYK 1TWAC 1TWCK 3K7AK 4ZH4A 4C3JK 3WODA 4X6AK 4MQ9A 3S2HC 4C3HK 4XSXA 4OIOA 5IYDC 5M3FK 4C2MC 1K83C 1I3QC 2O5IA 2VUMC 5C4JC 3S1RC 2YU9C 4G7OA 3S1RK 2YU9K 2VUMK 3CQZK 4A3CC 2R93C 5C4XC 2R93K 3S17C 2B63K 2PA8D 1TWFK 1HQMA 1TWFC 4A3DK 4LK0A 2JA5C 2WAQD 4BY1K 2A6HA 4BY1C 2JA5K 3DXJA 3I4MC 4XSZA 3GTQC 4QIWL 5IYBK 3S15K 4BBSK 3HOUK 3RZDC 5C44C 4OIRA 3FKIK 3FKIC 5C44K 3S16C 2WAQL 1I6VA 3EQLA 4LLGA 4A3EK 3I4NC 3GTOK 4A3EC 3GTOC 3HOWC 3HOWK 3I4NK 4NOIA 5FJ8K 4A3LC 1TWGC 3S1QK 5IP7C 1ZYRA 2A69A 1SFOK 4A93C 1SFOC 5IYCK 4YFXA 4KN4A 3H0GC 4A3FC 3HOXK 3GTMK 5FLMK 4A3BK 3HOVK 4A3GC 4Y52C 3HOVC 1K83K 4BBRK 4A3KK 1I6HK 4MEYA 4BXXC 3S2DC 4A3CK 2R7ZC 3S1NC 2E2HK 2E2HC 2Y0SL 3S1NK 2PMZD 2JA8C 1TWAK 4A3DC 2NVYC 1XPPA 2E2JK 3HKZD 4C3JC 4X6AC 3GTQK 3GTKC 4Q5SA 3GTLK 2E2IC 4JK1A 2A68A 3RZDK 5IYDK 4A3IK 1Y1WK 2NVQK 2NVQC 5C4JK 1I3QK 3GTPC 2B63C 5C4XK 3CQZC 1IW7A 2NVXC 3HOZC 2O5JA 4A3JK 5IP9K 5IP9C 3S1QC 2NVTK 4XLPA 3GTJC 4GZYA 2JA7C 3PO3K 3PO3C 3RZOK 5M5WK 4KMUA 4G7ZA 3S15C 4BBSC 4A3BC 5IYBC 4A3KC 3HOUC 4BXXK 3HOYC 3GTGK 3GTGC 3HOYK 2R7ZK 4YFNA 1I50C 2PPBA 4AYBD 2PA8L 2JA8K 4OINA 1WCMK 3S1MK 3M3YK 3M3YC 4YFKA 1TWGK 2R92C 2WB1L 5IP7K 3M4OC 1BDFA 2A6EA 5TMFA 3GTMC 3M4OK 5M5XK 5C3EC 4C3HC 2JA6C 5C3EK 5M5YK 2JA6K 4A3IC 1Y1WC 3S2HK 4A3GK 4QJVA 1I6HC 3HKZL 4C3IC 4BY7C 4BY7K 2NVXK 5TMCA 3HOZK 4OIQA 3PO2C 4XLNA 1YNJA 3PO2K 1SMYA 3H3VD 4QJVB 2E2JC 1TWCC 3K7AC 3I4MK 4LJZA 3GTLC 2BE5A 2E2IK 3GTKK 4Q4ZA 2CW0A 3S16K 4C2MK 4Y7NK 1Y1VK 4Y7NC 2R92K 1Y1VC 3S14C 3GTPK 3S14K 4G7HA 1TWHK 4A3JC 1TWHC 1WCMC 4QIWD 4A3MC 2Y0SD 4KN7A 4A3MK 2PMZL 3S17K 5D4DA
chains in the Genus database with same CATH superfamily
2WB1D 4LK1A 5FLMC 1PJ6A 3L4KA 4BBRC 1R9TC 4C3IK 4WCES 1I50K 4KM9A 3NUHA 1O2FB 3TFIA 3H3VL 2NVYK 3LYWA 1TWAC 3TFHA 3LAJA 3S2HC 4C3HK 2ZFZA 5M3FK 1IQ0A 1YX2A 5HL8A 2YU9K 5C4JC 3S1RC 1V5VA 5EGHA 3CQZK 5JVGS 2PA8D 1HQMA 4WFBS 4BY1K 4BY1C 4XSZA 3GTQC 1DCPA 1VLOA 4KASA 4QIWL 5JVOA 5IYBK 3GTPA 4BBSK 4OIRA 5C44K 4KMHA 3S16C 1I6VA 4LLGA 1AB4A 2KQ1A 3GTOC 2XCOA 2PHCB 3N3YA 1TWCA 1WORA 5CJ9A 5IP7C 2A69A 3HOXK 4KN4A 4KMAA 1USMA 4BBRK 4KAWX 2D6FC 4GTEA 2P5MA 4A3CK 2R7ZC 1TWFA 3IPJA 1B4BA 3LPXA 4KM8A 4A3DC 1XPPA 3L4JA 3V4GA 1ZVUA 3HKZD 4KATA 2GSNA 3GTQK 4Q5SA 1O28A 5IYDK 4A3IK 2NVQK 2NVQC 3GTQA 3GTPC 3GEIA 1WOPA 3OREA 3SZZA 3CQZC 3HOZC 3GTJC 4GZYA 2L3UA 3RZOK 5M5WK 3S15C 1TWAA 4A3BC 4IOAS 2VUMA 4LQYA 3HOUC 1O2BA 1XXCA 3AD8C 4PAAA 3HOYC 4DDQA 1C0AA 3HOYK 1I50C 1VRQC 2PPBA 1GE9A 4KB4A 1WCMK 3M3YK 1I50A 5IP7K 3M4OK 5M5XK 3GIRA 4A3GK 3T02A 4BY7K 3HOZK 1O29A 3Q3QA 1X31C 4Q4ZA 1IE0A 1EI6A 3S14K 1Y1VC 3AD7C 4WFAS 3G4AA 1VJEA 1TWHK 4A3JC 1WCMC 4QIWD 2B63C 1IW7A 4KN7A 1JVIA 2NVTC 5EGEA 3H0GK 3HOXC 5IYCC 4OIPA 4MEXA 4Y52K 1R9TK 4M1XA 1YNNA 1R9TA 1EQRA 2RH6A 4ZH4A 4C3JK 3GTJA 4X6AK 3GDZA 3ERED 4C2MC 3CF5S 2YU9C 1ZBSA 4C45A 5CHPA 4P5AA 3LAPA 3A8IA 3AD9C 4A3DK 2JA5C 3DXJA 3QX3A 2NVYA 1DD5A 1USOA 3FKIK 3TTGA 3JSTA 3FKIC 3EQLA 3HOWK 3HOWC 1FEUA 3PIOS 3S1QK 1XZQB 3N0BA 5IYCK 4BLBA 3H0GC 3GTMK 3BP8C 3HXAA 3CAGA 4KARA 3SZYA 5FLMK 4LOWA 4A3BK 3HOVC 1YCLA 1I6HK 4MEYA 2GAGC 4GTFA 5HQHA 2E2HK 3S1NK 2PMZD 2JA8C 1WSRA 4PABA 1ZQ1C 4C3JC 4X6AC 1XZPA 3RZDK 1JOEA 5C4JK 2E2IA 5C4XK 2O5JA 2NVXC 1O2AA 3FOFA 5IP9K 3T01A 3S1QC 2NVTK 2Y3PA 1J6VA 2JA7C 4GT9A 4XCHA 1K83A 4J3NA 1ZXOA 4WILA 3GTGC 4YFNA 2PA8L 4OINA 1PJ5A 1TWGK 2WB1L 4G0UA 1BDFA 5HL7S 1O24A 5C3EC 2JA6C 4WF9S 5C3EK 2JA6K 4A3IC 1I6HC 3DLLS 1XZQA 2JH3A 4BY7C 1BS2A 5IOQA 4XLNA 2GAHC 5JVHS 3H3VD 1WOSA 1J6XA 3I4MK 2BE5A 2E2IK 3GTKK 3GTGA 2R7ZA 2CW0A 4Y7NK 4Y7NC 3ADAC 2Y0SD 3S17K 2JA7K 4A3FK 2KPUA 1EK8A 3TFJA 4A93K 4YG2A 3RZOC 2R92A 5JFEA 3A8KA 3GSIA 2ZUEA 2JA6A 3S2DK 1TWGA 1SFOA 1G51A 3S1MC 2W7VA 4A3LK 2XCQA 1TWCK 3G4CA 3K7AK 4GTDA 3WODA 4KMDA 4MQ9A 5IYDC 3H0GA 4IOCS 2O5IA 2VUMK 3S1RK 3VA7A 4A3CC 2R93C 4BKWA 3S17C 2XCRB 1TWFK 1TWFC 3GTKA 2A6HA 5IORA 1BJTA 3S15K 3HOUK 5C44C 2V6UA 4RMFA 3FHZA 3GTOK 4U67S 4A3LC 1RU0A 3GTOA 2R92K 1ZYRA 1SFOK 2FQOA 4YFXA 1WQHA 5DM7S 2YU9A 1WSVA 4A3KK 4BXXC 3S2DC 4FZBA 3S1NC 3BUEA 2E2HC 2CFAA 3OEPA 1TWHA 3AQOA 3GTLK 1L0WA 4G0VA 1F7UA 5IOTA 5L46A 5DM6S 1I3QK 1WQGA 4A3JK 5IP9C 4LR2A 3GEEA 4KMUA 4G7ZA 4BBSC 1ISEA 3BP3A 4A3KC 4BXXK 4P9SA 2P8TA 2JA8K 3S1MK 2ZJPS 4YFKA 1J98A 4WJ4A 2R92C 1KQ4A 2A6EA 5TMFA 3GTMC 1INNA 5M5YK 1Y1WC 4QJVA 2GSOA 5TMCA 3PO2C 2ZJRS 3PO2K 3GTLA 4FM9A 2E2JC 3GTLC 2V6TA 3GEHA 1I3QA 4GTCA 3S16K 1Y1VK 2RGRA 3S14C 2B63A 1EFWA 2ZUFA 1TWHC 4BLAA 1Y1VA 5M3MK 3GTJK 2E2HA 1F9NA 4AYBL 2GSUA 1IS1A 3A8JA 3AH5A 4G0WA 2JA7A 4XSXA 4OIOA 4WFNS 1K83C 1I3QC 4G7OA 2VUMC 2R93A 1WCMA 1BGWA 1XZPB 4KDDA 5C4XC 2R93K 2B63K 2JA5A 1VGXA 4KC6A 1O25A 1XXBA 1IL2A 3GTMA 1VH2A 4LK0A 2WAQD 2JA5K 3I4MC 2ZJQS 1B4AA 4GTAA 3RZDC 4GTBA 1UV7A 2WAQL 3I4NK 4A3EK 3I4NC 4A3EC 4NOIA 2EBBA 5FJ8K 1TWGC 4A93C 1SFOC 4A3FC 4P5BA 2FQTA 1EH1A 4GFQA 4A3GC 4Y52C 3HOVK 1K83K 2L5NA 1O26A 1F7VA 3FOEA 2Y0SL 1JQWA 1WIHA 1TWAK 4AH6A 2NVYC 1WOOA 2E2JK 3GTKC 3FKIA 2E2IC 4JK1A 2A68A 2CFAB 3AQPA 1Y1WK 2NVXA 1DCOA 4ILDA 1J6WA 4O2DA 4XLPA 3PO3K 3PO3C 2KWAA 1PJ7A 5IOSA 4WJ3M 1WQFA 5IYBC 5E68A 2V6SA 3S0XA 1DCHA 3OPFA 3GTGK 1IBAA 2R7ZK 2KXYA 4AYBD 3M3YC 5TJ3A 3M4OC 4IO9S 4C3HC 3S2HK 3PIPS 3HKZL 4C3IC 1Y1WA 1F93A 2NVXK 4OIQA 4KB2A 3N0CA 1YNJA 3MMLB 1SMYA 4QJVB 1O27A 3CQZA 4GTLA 1XXAA 1TWCC 3K7AC 4LJZA 3T00A 1HI9A 4C2MK 3GTPK 4G7HA 4A3MK 4A3MC 2PMZL 5D4DA
chains in the Genus database with same CATH topology
2WB1D 2NVTC 5M3MK 4LK1A 3GTJK 4A3FK 3H0GK 3HOXC 2JA7K 5IYCC 4A93K 4YG2A 3RZOC 4OIPA 4AYBL 5FLMC 4MEXA 4BBRC 1R9TK 4Y52K 1R9TC 4C3IK 3S2DK 1I50K 1YNNA 3H3VL 3S1MC 4A3LK 2NVYK 1TWAC 1TWCK 3K7AK 4ZH4A 4C3JK 3WODA 4X6AK 4MQ9A 3S2HC 4C3HK 4XSXA 4OIOA 5IYDC 5M3FK 4C2MC 1K83C 1I3QC 2O5IA 2VUMC 5C4JC 3S1RC 2YU9C 4G7OA 3S1RK 2YU9K 2VUMK 3CQZK 4A3CC 2R93C 5C4XC 2R93K 3S17C 2B63K 2PA8D 1TWFK 1HQMA 1TWFC 4A3DK 4LK0A 2JA5C 2WAQD 4BY1K 2A6HA 4BY1C 2JA5K 3DXJA 3I4MC 4XSZA 3GTQC 4QIWL 5IYBK 3S15K 4BBSK 3HOUK 3RZDC 5C44C 4OIRA 3FKIK 3FKIC 5C44K 3S16C 2WAQL 1I6VA 3EQLA 4LLGA 4A3EK 3I4NC 3GTOK 4A3EC 3GTOC 3HOWC 3HOWK 3I4NK 4NOIA 5FJ8K 4A3LC 1TWGC 3S1QK 5IP7C 1ZYRA 2A69A 1SFOK 4A93C 1SFOC 5IYCK 4YFXA 4KN4A 3H0GC 4A3FC 3HOXK 3GTMK 5FLMK 4A3BK 3HOVK 4A3GC 4Y52C 3HOVC 1K83K 4BBRK 4A3KK 1I6HK 4MEYA 4BXXC 3S2DC 4A3CK 2R7ZC 3S1NC 2E2HK 2E2HC 2Y0SL 3S1NK 2PMZD 2JA8C 1TWAK 4A3DC 2NVYC 1XPPA 2E2JK 3HKZD 4C3JC 4X6AC 3GTQK 3GTKC 4Q5SA 3GTLK 2E2IC 4JK1A 2A68A 3RZDK 5IYDK 4A3IK 1Y1WK 2NVQK 2NVQC 5C4JK 1I3QK 3GTPC 2B63C 5C4XK 3CQZC 1IW7A 2NVXC 3HOZC 2O5JA 4A3JK 5IP9K 5IP9C 3S1QC 2NVTK 4XLPA 3GTJC 4GZYA 2JA7C 3PO3K 3PO3C 3RZOK 5M5WK 4KMUA 4G7ZA 3S15C 4BBSC 4A3BC 5IYBC 4A3KC 3HOUC 4BXXK 3HOYC 3GTGK 3GTGC 3HOYK 2R7ZK 4YFNA 1I50C 2PPBA 4AYBD 2PA8L 2JA8K 4OINA 1WCMK 3S1MK 3M3YK 3M3YC 4YFKA 1TWGK 2R92C 2WB1L 5IP7K 3M4OC 1BDFA 2A6EA 5TMFA 3GTMC 3M4OK 5M5XK 5C3EC 4C3HC 2JA6C 5C3EK 5M5YK 2JA6K 4A3IC 1Y1WC 3S2HK 4A3GK 4QJVA 1I6HC 3HKZL 4C3IC 4BY7C 4BY7K 2NVXK 5TMCA 3HOZK 4OIQA 3PO2C 4XLNA 1YNJA 3PO2K 1SMYA 3H3VD 4QJVB 2E2JC 1TWCC 3K7AC 3I4MK 4LJZA 3GTLC 2BE5A 2E2IK 3GTKK 4Q4ZA 2CW0A 3S16K 4C2MK 4Y7NK 1Y1VK 4Y7NC 2R92K 1Y1VC 3S14C 3GTPK 3S14K 4G7HA 1TWHK 4A3JC 1TWHC 1WCMC 4QIWD 4A3MC 2Y0SD 4KN7A 4A3MK 2PMZL 3S17K 5D4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 D;  2NVT C;  5M3M K;  4LK1 A;  3GTJ K;  4A3F K;  3H0G K;  3HOX C;  2JA7 K;  5IYC C;  4A93 K;  4YG2 A;  3RZO C;  4OIP A;  4AYB L;  5FLM C;  4MEX A;  4BBR C;  1R9T K;  4Y52 K;  1R9T C;  4C3I K;  3S2D K;  1I50 K;  1YNN A;  3H3V L;  3S1M C;  4A3L K;  2NVY K;  1TWA C;  1TWC K;  3K7A K;  4ZH4 A;  4C3J K;  3WOD A;  4X6A K;  4MQ9 A;  3S2H C;  4C3H K;  4XSX A;  4OIO A;  5IYD C;  5M3F K;  4C2M C;  1K83 C;  1I3Q C;  2O5I A;  2VUM C;  5C4J C;  3S1R C;  2YU9 C;  4G7O A;  3S1R K;  2YU9 K;  2VUM K;  3CQZ K;  4A3C C;  2R93 C;  5C4X C;  2R93 K;  3S17 C;  2B63 K;  2PA8 D;  1TWF K;  1HQM A;  1TWF C;  4A3D K;  4LK0 A;  2JA5 C;  2WAQ D;  4BY1 K;  2A6H A;  4BY1 C;  2JA5 K;  3DXJ A;  3I4M C;  4XSZ A;  3GTQ C;  4QIW L;  5IYB K;  3S15 K;  4BBS K;  3HOU K;  3RZD C;  5C44 C;  4OIR A;  3FKI K;  3FKI C;  5C44 K;  3S16 C;  2WAQ L;  1I6V A;  3EQL A;  4LLG A;  4A3E K;  3I4N C;  3GTO K;  4A3E C;  3GTO C;  3HOW C;  3HOW K;  3I4N K;  4NOI A;  5FJ8 K;  4A3L C;  1TWG C;  3S1Q K;  5IP7 C;  1ZYR A;  2A69 A;  1SFO K;  4A93 C;  1SFO C;  5IYC K;  4YFX A;  4KN4 A;  3H0G C;  4A3F C;  3HOX K;  3GTM K;  5FLM K;  4A3B K;  3HOV K;  4A3G C;  4Y52 C;  3HOV C;  1K83 K;  4BBR K;  4A3K K;  1I6H K;  4MEY A;  4BXX C;  3S2D C;  4A3C K;  2R7Z C;  3S1N C;  2E2H K;  2E2H C;  2Y0S L;  3S1N K;  2PMZ D;  2JA8 C;  1TWA K;  4A3D C;  2NVY C;  1XPP A;  2E2J K;  3HKZ D;  4C3J C;  4X6A C;  3GTQ K;  3GTK C;  4Q5S A;  3GTL K;  2E2I C;  4JK1 A;  2A68 A;  3RZD K;  5IYD K;  4A3I K;  1Y1W K;  2NVQ K;  2NVQ C;  5C4J K;  1I3Q K;  3GTP C;  2B63 C;  5C4X K;  3CQZ C;  1IW7 A;  2NVX C;  3HOZ C;  2O5J A;  4A3J K;  5IP9 K;  5IP9 C;  3S1Q C;  2NVT K;  4XLP A;  3GTJ C;  4GZY A;  2JA7 C;  3PO3 K;  3PO3 C;  3RZO K;  5M5W K;  4KMU A;  4G7Z A;  3S15 C;  4BBS C;  4A3B C;  5IYB C;  4A3K C;  3HOU C;  4BXX K;  3HOY C;  3GTG K;  3GTG C;  3HOY K;  2R7Z K;  4YFN A;  1I50 C;  2PPB A;  4AYB D;  2PA8 L;  2JA8 K;  4OIN A;  1WCM K;  3S1M K;  3M3Y K;  3M3Y C;  4YFK A;  1TWG K;  2R92 C;  2WB1 L;  5IP7 K;  3M4O C;  1BDF A;  2A6E A;  5TMF A;  3GTM C;  3M4O K;  5M5X K;  5C3E C;  4C3H C;  2JA6 C;  5C3E K;  5M5Y K;  2JA6 K;  4A3I C;  1Y1W C;  3S2H K;  4A3G K;  4QJV A;  1I6H C;  3HKZ L;  4C3I C;  4BY7 C;  4BY7 K;  2NVX K;  5TMC A;  3HOZ K;  4OIQ A;  3PO2 C;  4XLN A;  1YNJ A;  3PO2 K;  1SMY A;  3H3V D;  4QJV B;  2E2J C;  1TWC C;  3K7A C;  3I4M K;  4LJZ A;  3GTL C;  2BE5 A;  2E2I K;  3GTK K;  4Q4Z A;  2CW0 A;  3S16 K;  4C2M K;  4Y7N K;  1Y1V K;  4Y7N C;  2R92 K;  1Y1V C;  3S14 C;  3GTP K;  3S14 K;  4G7H A;  1TWH K;  4A3J C;  1TWH C;  1WCM C;  4QIW D;  4A3M C;  2Y0S D;  4KN7 A;  4A3M K;  2PMZ L;  3S17 K;  5D4D A; 
#chains in the Genus database with same CATH topology
 2WB1 D;  4LK1 A;  5FLM C;  1PJ6 A;  3L4K A;  4BBR C;  1R9T C;  4C3I K;  4WCE S;  1I50 K;  4KM9 A;  3NUH A;  1O2F B;  3TFI A;  3H3V L;  2NVY K;  3LYW A;  1TWA C;  3TFH A;  3LAJ A;  3S2H C;  4C3H K;  2ZFZ A;  5M3F K;  1IQ0 A;  1YX2 A;  5HL8 A;  2YU9 K;  5C4J C;  3S1R C;  1V5V A;  5EGH A;  3CQZ K;  5JVG S;  2PA8 D;  1HQM A;  4WFB S;  4BY1 K;  4BY1 C;  4XSZ A;  3GTQ C;  1DCP A;  1VLO A;  4KAS A;  4QIW L;  5JVO A;  5IYB K;  3GTP A;  4BBS K;  4OIR A;  5C44 K;  4KMH A;  3S16 C;  1I6V A;  4LLG A;  1AB4 A;  2KQ1 A;  3GTO C;  2XCO A;  2PHC B;  3N3Y A;  1TWC A;  1WOR A;  5CJ9 A;  5IP7 C;  2A69 A;  3HOX K;  4KN4 A;  4KMA A;  1USM A;  4BBR K;  4KAW X;  2D6F C;  4GTE A;  2P5M A;  4A3C K;  2R7Z C;  1TWF A;  3IPJ A;  1B4B A;  3LPX A;  4KM8 A;  4A3D C;  1XPP A;  3L4J A;  3V4G A;  1ZVU A;  3HKZ D;  4KAT A;  2GSN A;  3GTQ K;  4Q5S A;  1O28 A;  5IYD K;  4A3I K;  2NVQ K;  2NVQ C;  3GTQ A;  3GTP C;  3GEI A;  1WOP A;  3ORE A;  3SZZ A;  3CQZ C;  3HOZ C;  3GTJ C;  4GZY A;  2L3U A;  3RZO K;  5M5W K;  3S15 C;  1TWA A;  4A3B C;  4IOA S;  2VUM A;  4LQY A;  3HOU C;  1O2B A;  1XXC A;  3AD8 C;  4PAA A;  3HOY C;  4DDQ A;  1C0A A;  3HOY K;  1I50 C;  1VRQ C;  2PPB A;  1GE9 A;  4KB4 A;  1WCM K;  3M3Y K;  1I50 A;  5IP7 K;  3M4O K;  5M5X K;  3GIR A;  4A3G K;  3T02 A;  4BY7 K;  3HOZ K;  1O29 A;  3Q3Q A;  1X31 C;  4Q4Z A;  1IE0 A;  1EI6 A;  3S14 K;  1Y1V C;  3AD7 C;  4WFA S;  3G4A A;  1VJE A;  1TWH K;  4A3J C;  1WCM C;  4QIW D;  2B63 C;  1IW7 A;  4KN7 A;  1JVI A;  2NVT C;  5EGE A;  3H0G K;  3HOX C;  5IYC C;  4OIP A;  4MEX A;  4Y52 K;  1R9T K;  4M1X A;  1YNN A;  1R9T A;  1EQR A;  2RH6 A;  4ZH4 A;  4C3J K;  3GTJ A;  4X6A K;  3GDZ A;  3ERE D;  4C2M C;  3CF5 S;  2YU9 C;  1ZBS A;  4C45 A;  5CHP A;  4P5A A;  3LAP A;  3A8I A;  3AD9 C;  4A3D K;  2JA5 C;  3DXJ A;  3QX3 A;  2NVY A;  1DD5 A;  1USO A;  3FKI K;  3TTG A;  3JST A;  3FKI C;  3EQL A;  3HOW K;  3HOW C;  1FEU A;  3PIO S;  3S1Q K;  1XZQ B;  3N0B A;  5IYC K;  4BLB A;  3H0G C;  3GTM K;  3BP8 C;  3HXA A;  3CAG A;  4KAR A;  3SZY A;  5FLM K;  4LOW A;  4A3B K;  3HOV C;  1YCL A;  1I6H K;  4MEY A;  2GAG C;  4GTF A;  5HQH A;  2E2H K;  3S1N K;  2PMZ D;  2JA8 C;  1WSR A;  4PAB A;  1ZQ1 C;  4C3J C;  4X6A C;  1XZP A;  3RZD K;  1JOE A;  5C4J K;  2E2I A;  5C4X K;  2O5J A;  2NVX C;  1O2A A;  3FOF A;  5IP9 K;  3T01 A;  3S1Q C;  2NVT K;  2Y3P A;  1J6V A;  2JA7 C;  4GT9 A;  4XCH A;  1K83 A;  4J3N A;  1ZXO A;  4WIL A;  3GTG C;  4YFN A;  2PA8 L;  4OIN A;  1PJ5 A;  1TWG K;  2WB1 L;  4G0U A;  1BDF A;  5HL7 S;  1O24 A;  5C3E C;  2JA6 C;  4WF9 S;  5C3E K;  2JA6 K;  4A3I C;  1I6H C;  3DLL S;  1XZQ A;  2JH3 A;  4BY7 C;  1BS2 A;  5IOQ A;  4XLN A;  2GAH C;  5JVH S;  3H3V D;  1WOS A;  1J6X A;  3I4M K;  2BE5 A;  2E2I K;  3GTK K;  3GTG A;  2R7Z A;  2CW0 A;  4Y7N K;  4Y7N C;  3ADA C;  2Y0S D;  3S17 K;  2JA7 K;  4A3F K;  2KPU A;  1EK8 A;  3TFJ A;  4A93 K;  4YG2 A;  3RZO C;  2R92 A;  5JFE A;  3A8K A;  3GSI A;  2ZUE A;  2JA6 A;  3S2D K;  1TWG A;  1SFO A;  1G51 A;  3S1M C;  2W7V A;  4A3L K;  2XCQ A;  1TWC K;  3G4C A;  3K7A K;  4GTD A;  3WOD A;  4KMD A;  4MQ9 A;  5IYD C;  3H0G A;  4IOC S;  2O5I A;  2VUM K;  3S1R K;  3VA7 A;  4A3C C;  2R93 C;  4BKW A;  3S17 C;  2XCR B;  1TWF K;  1TWF C;  3GTK A;  2A6H A;  5IOR A;  1BJT A;  3S15 K;  3HOU K;  5C44 C;  2V6U A;  4RMF A;  3FHZ A;  3GTO K;  4U67 S;  4A3L C;  1RU0 A;  3GTO A;  2R92 K;  1ZYR A;  1SFO K;  2FQO A;  4YFX A;  1WQH A;  5DM7 S;  2YU9 A;  1WSV A;  4A3K K;  4BXX C;  3S2D C;  4FZB A;  3S1N C;  3BUE A;  2E2H C;  2CFA A;  3OEP A;  1TWH A;  3AQO A;  3GTL K;  1L0W A;  4G0V A;  1F7U A;  5IOT A;  5L46 A;  5DM6 S;  1I3Q K;  1WQG A;  4A3J K;  5IP9 C;  4LR2 A;  3GEE A;  4KMU A;  4G7Z A;  4BBS C;  1ISE A;  3BP3 A;  4A3K C;  4BXX K;  4P9S A;  2P8T A;  2JA8 K;  3S1M K;  2ZJP S;  4YFK A;  1J98 A;  4WJ4 A;  2R92 C;  1KQ4 A;  2A6E A;  5TMF A;  3GTM C;  1INN A;  5M5Y K;  1Y1W C;  4QJV A;  2GSO A;  5TMC A;  3PO2 C;  2ZJR S;  3PO2 K;  3GTL A;  4FM9 A;  2E2J C;  3GTL C;  2V6T A;  3GEH A;  1I3Q A;  4GTC A;  3S16 K;  1Y1V K;  2RGR A;  3S14 C;  2B63 A;  1EFW A;  2ZUF A;  1TWH C;  4BLA A;  1Y1V A;  5M3M K;  3GTJ K;  2E2H A;  1F9N A;  4AYB L;  2GSU A;  1IS1 A;  3A8J A;  3AH5 A;  4G0W A;  2JA7 A;  4XSX A;  4OIO A;  4WFN S;  1K83 C;  1I3Q C;  4G7O A;  2VUM C;  2R93 A;  1WCM A;  1BGW A;  1XZP B;  4KDD A;  5C4X C;  2R93 K;  2B63 K;  2JA5 A;  1VGX A;  4KC6 A;  1O25 A;  1XXB A;  1IL2 A;  3GTM A;  1VH2 A;  4LK0 A;  2WAQ D;  2JA5 K;  3I4M C;  2ZJQ S;  1B4A A;  4GTA A;  3RZD C;  4GTB A;  1UV7 A;  2WAQ L;  3I4N K;  4A3E K;  3I4N C;  4A3E C;  4NOI A;  2EBB A;  5FJ8 K;  1TWG C;  4A93 C;  1SFO C;  4A3F C;  4P5B A;  2FQT A;  1EH1 A;  4GFQ A;  4A3G C;  4Y52 C;  3HOV K;  1K83 K;  2L5N A;  1O26 A;  1F7V A;  3FOE A;  2Y0S L;  1JQW A;  1WIH A;  1TWA K;  4AH6 A;  2NVY C;  1WOO A;  2E2J K;  3GTK C;  3FKI A;  2E2I C;  4JK1 A;  2A68 A;  2CFA B;  3AQP A;  1Y1W K;  2NVX A;  1DCO A;  4ILD A;  1J6W A;  4O2D A;  4XLP A;  3PO3 K;  3PO3 C;  2KWA A;  1PJ7 A;  5IOS A;  4WJ3 M;  1WQF A;  5IYB C;  5E68 A;  2V6S A;  3S0X A;  1DCH A;  3OPF A;  3GTG K;  1IBA A;  2R7Z K;  2KXY A;  4AYB D;  3M3Y C;  5TJ3 A;  3M4O C;  4IO9 S;  4C3H C;  3S2H K;  3PIP S;  3HKZ L;  4C3I C;  1Y1W A;  1F93 A;  2NVX K;  4OIQ A;  4KB2 A;  3N0C A;  1YNJ A;  3MML B;  1SMY A;  4QJV B;  1O27 A;  3CQZ A;  4GTL A;  1XXA A;  1TWC C;  3K7A C;  4LJZ A;  3T00 A;  1HI9 A;  4C2M K;  3GTP K;  4G7H A;  4A3M K;  4A3M C;  2PMZ L;  5D4D A; 
#chains in the Genus database with same CATH homology
 2WB1 D;  2NVT C;  5M3M K;  4LK1 A;  3GTJ K;  4A3F K;  3H0G K;  3HOX C;  2JA7 K;  5IYC C;  4A93 K;  4YG2 A;  3RZO C;  4OIP A;  4AYB L;  5FLM C;  4MEX A;  4BBR C;  1R9T K;  4Y52 K;  1R9T C;  4C3I K;  3S2D K;  1I50 K;  1YNN A;  3H3V L;  3S1M C;  4A3L K;  2NVY K;  1TWA C;  1TWC K;  3K7A K;  4ZH4 A;  4C3J K;  3WOD A;  4X6A K;  4MQ9 A;  3S2H C;  4C3H K;  4XSX A;  4OIO A;  5IYD C;  5M3F K;  4C2M C;  1K83 C;  1I3Q C;  2O5I A;  2VUM C;  5C4J C;  3S1R C;  2YU9 C;  4G7O A;  3S1R K;  2YU9 K;  2VUM K;  3CQZ K;  4A3C C;  2R93 C;  5C4X C;  2R93 K;  3S17 C;  2B63 K;  2PA8 D;  1TWF K;  1HQM A;  1TWF C;  4A3D K;  4LK0 A;  2JA5 C;  2WAQ D;  4BY1 K;  2A6H A;  4BY1 C;  2JA5 K;  3DXJ A;  3I4M C;  4XSZ A;  3GTQ C;  4QIW L;  5IYB K;  3S15 K;  4BBS K;  3HOU K;  3RZD C;  5C44 C;  4OIR A;  3FKI K;  3FKI C;  5C44 K;  3S16 C;  2WAQ L;  1I6V A;  3EQL A;  4LLG A;  4A3E K;  3I4N C;  3GTO K;  4A3E C;  3GTO C;  3HOW C;  3HOW K;  3I4N K;  4NOI A;  5FJ8 K;  4A3L C;  1TWG C;  3S1Q K;  5IP7 C;  1ZYR A;  2A69 A;  1SFO K;  4A93 C;  1SFO C;  5IYC K;  4YFX A;  4KN4 A;  3H0G C;  4A3F C;  3HOX K;  3GTM K;  5FLM K;  4A3B K;  3HOV K;  4A3G C;  4Y52 C;  3HOV C;  1K83 K;  4BBR K;  4A3K K;  1I6H K;  4MEY A;  4BXX C;  3S2D C;  4A3C K;  2R7Z C;  3S1N C;  2E2H K;  2E2H C;  2Y0S L;  3S1N K;  2PMZ D;  2JA8 C;  1TWA K;  4A3D C;  2NVY C;  1XPP A;  2E2J K;  3HKZ D;  4C3J C;  4X6A C;  3GTQ K;  3GTK C;  4Q5S A;  3GTL K;  2E2I C;  4JK1 A;  2A68 A;  3RZD K;  5IYD K;  4A3I K;  1Y1W K;  2NVQ K;  2NVQ C;  5C4J K;  1I3Q K;  3GTP C;  2B63 C;  5C4X K;  3CQZ C;  1IW7 A;  2NVX C;  3HOZ C;  2O5J A;  4A3J K;  5IP9 K;  5IP9 C;  3S1Q C;  2NVT K;  4XLP A;  3GTJ C;  4GZY A;  2JA7 C;  3PO3 K;  3PO3 C;  3RZO K;  5M5W K;  4KMU A;  4G7Z A;  3S15 C;  4BBS C;  4A3B C;  5IYB C;  4A3K C;  3HOU C;  4BXX K;  3HOY C;  3GTG K;  3GTG C;  3HOY K;  2R7Z K;  4YFN A;  1I50 C;  2PPB A;  4AYB D;  2PA8 L;  2JA8 K;  4OIN A;  1WCM K;  3S1M K;  3M3Y K;  3M3Y C;  4YFK A;  1TWG K;  2R92 C;  2WB1 L;  5IP7 K;  3M4O C;  1BDF A;  2A6E A;  5TMF A;  3GTM C;  3M4O K;  5M5X K;  5C3E C;  4C3H C;  2JA6 C;  5C3E K;  5M5Y K;  2JA6 K;  4A3I C;  1Y1W C;  3S2H K;  4A3G K;  4QJV A;  1I6H C;  3HKZ L;  4C3I C;  4BY7 C;  4BY7 K;  2NVX K;  5TMC A;  3HOZ K;  4OIQ A;  3PO2 C;  4XLN A;  1YNJ A;  3PO2 K;  1SMY A;  3H3V D;  4QJV B;  2E2J C;  1TWC C;  3K7A C;  3I4M K;  4LJZ A;  3GTL C;  2BE5 A;  2E2I K;  3GTK K;  4Q4Z A;  2CW0 A;  3S16 K;  4C2M K;  4Y7N K;  1Y1V K;  4Y7N C;  2R92 K;  1Y1V C;  3S14 C;  3GTP K;  3S14 K;  4G7H A;  1TWH K;  4A3J C;  1TWH C;  1WCM C;  4QIW D;  4A3M C;  2Y0S D;  4KN7 A;  4A3M K;  2PMZ L;  3S17 K;  5D4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...