1ZYRA

Structure of thermus thermophilus rna polymerase holoenzyme in complex with the antibiotic streptolydigin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation.
pubmed doi rcsb
molecule tags Transcription,transferase
total genus 35
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1zyrA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1zyrA01
4MEXA 1YNJA 4Y7NK 2R92K 4OINA 4QJVA 1ZYRA 3S14C 5FJ8K 3S15C 3I4MK 4XLNA 2NVQC 3M4OK 4C2MK 2E2HK 4BBSC 2VUMK 1I6HK 3RZDK 3M3YC 3S2DC 5C3EK 5C44K 3HOVC 3DXJA 3S1NC 2NVXC 5IYBK 2NVYC 3RZOC 2JA8K 3S1MK 3HKZD 4QIWD 4Q5SA 1TWCK 3CQZK 3HOUK 3S2HK 2JA6K 5IP7C 4A3LC 4A3KK 2R7ZK 5C4XC 5M5XK 4OIRA 1I50K 4G7ZA 4XSXA 5FLMC 1I3QK 4BY7K 2JA7K 2WAQD 3GTGK 2NVTC 5IYDK 3GTKC 4Y7NC 4XSZA 2R92C 2JA5K 4MQ9A 1Y1WC 4C3JK 3PO2K 3S1QC 2BE5A 3M4OC 4XLPA 2O5JA 3S1RK 4C2MC 2E2HC 2VUMC 4KMUA 1I6HC 3RZDC 4A3EK 5C3EC 4AYBD 4NOIA 5C44C 5M3FK 2Y0SD 4Y52K 5IYBC 1TWFK 4BY1K 1TWGK 4KN7A 2PMZL 3S1MC 2NVTK 1TWCC 3CQZC 3HOUC 3S2HC 3H3VL 2JA6C 4A3KC 2R7ZC 3S17K 2R93K 1I6VA 1I50C 4QJVB 5TMFA 1Y1VK 1I3QC 4BY7C 2JA7C 3GTJC 3GTGC 5IYCK 5IYDC 3HKZL 4QIWL 3S16K 3GTPK 3PO3K 2JA5C 4BBRK 1SMYA 4C3JC 3PO2C 3FKIK 3HOZK 4KN4A 4G7HA 3S1RC 2PA8D 1R9TK 2WAQL 4A3EC 3GTOK 4A3FK 4A93K 1SFOK 4OIOA 4A3GK 1TWHK 3HOXK 3I4MC 4Y52C 2A6HA 1TWFC 1YNNA 4BY1C 4A3IK 2A68A 1TWGC 4X6AK 4A3DK 4A3CK 2R93C 3S17C 4AYBL 4C3IK 1TWAK 1XPPA 1Y1VC 2Y0SL 3GTMK 5IYCC 2JA8C 4C3HK 3PO3C 3S16C 3GTPC 4BBRC 2E2IK 5IP9K 3GTQK 3FKIC 3HOZC 2WB1D 1R9TC 4A3JK 2O5IA 5D4DA 3GTOC 4A93C 1SFOC 3GTLK 4YFNA 4YG2A 2NVXK 4OIQA 4A3GC 3H0GK 1TWHC 3K7AK 3HOXC 5IP7K 4A3IC 2PA8L 2E2JK 4X6AC 5C4XK 4A3DC 4A3CC 4BXXK 4YFXA 3HOWK 4A3BK 4LJZA 4C3IC 1TWAC 3GTMC 5M5YK 5C4JK 3HOYK 2YU9C 1Y1WK 1WCMK 3S1QK 4LK1A 4C3HC 4OIPA 3I4NK 2PMZD 2B63K 2E2IC 4G7OA 5IP9C 3GTQC 1K83K 3H3VD 4A3MK 5M3MK 2YU9K 4LK0A 4A3JC 1HQMA 2A69A 3GTLC 3S14K 3S15K 3H0GC 2NVQK 1IW7A 3K7AC 4Q4ZA 1BDFA 4GZYA 4BBSK 3M3YK 4YFKA 2WB1L 3S2DK 3EQLA 5TMCA 2E2JC 4MEYA 4ZH4A 4BXXC 4A3FC 3HOVK 2CW0A 3S1NK 3WODA 5M5WK 3GTJK 3HOWC 4A3BC 2NVYK 3RZOK 2PPBA 5C4JC 3HOYC 1WCMC 2A6EA 4JK1A 4A3LK 3I4NC 2B63C 5FLMK 1K83C 4A3MC 4LLGA 3GTKK
chains in the Genus database with same CATH superfamily
1WORA 3S14C 5FJ8K 3I4MK 3M4OK 1RU0A 2E2HK 4BBSC 2RGRA 5C3EK 1X31C 3JSTA 2NVXC 1ZBSA 2NVYC 5IOSA 4QIWD 4Q5SA 2JA6K 2R7ZK 2GSOA 3TTGA 3GTJA 1I3QK 4BY7K 2JA7K 4LQYA 3GTGK 1BS2A 1VGXA 2JA5K 3SZZA 4C3JK 3S1QC 2BE5A 4XLPA 1JQWA 4C2MC 2VUMC 3L4KA 3GTKA 3RZDC 2FQOA 1O2BA 2V6UA 1G51A 1PJ5A 5IYBC 1TWFK 1BJTA 2E2HA 1TWCC 3CQZC 3HOUC 4A3KC 3GDZA 5IORA 1I50C 2KWAA 4QJVB 1Y1VK 3GTJC 5IYCK 5IYDC 1VLOA 3HKZL 1HI9A 3S16K 2JA6A 2R7ZA 1SMYA 4P9SA 3IPJA 3OEPA 1IL2A 1O2FB 1I3QA 3S1RC 2JA7A 2PA8D 3GTGA 2XCQA 3GIRA 1R9TK 3GTOK 4A3FK 1EFWA 2JA5A 1F93A 4OIOA 4A3GK 4KB2A 3HOXK 3I4MC 3AD8C 4P5AA 4KARA 4A3CK 3LPXA 4C3IK 1PJ6A 3GEHA 1TWFA 3FOFA 3PO3C 3GTPC 1VJEA 2E2IK 3GTQK 3FKIC 1Y1VA 1EI6A 3GTLK 4YFNA 4GTEA 3H0GK 1AB4A 1O25A 4G0UA 3PIPS 5IP7K 4A3IC 1R9TA 4A3DC 3GTOA 4BXXK 4KASA 4LOWA 4YFXA 5JVHS 3HOWK 3GTMC 5C4JK 3HOYK 1Y1WK 4C3HC 5CHPA 4OIPA 3N3YA 2B63K 5IP9C 5M3MK 3SZYA 3L4JA 4A3JC 3S14K 3CF5S 2E2IA 3GTQA 4BBSK 4YFKA 2WB1L 3EQLA 3GTLA 5CJ9A 4A3FC 3H0GA 3WODA 4A3BC 2NVYK 3ERED 1WCMC 3V4GA 4O2DA 1K83C 5EGEA 2YU9C 1V5VA 4MEXA 1Y1WA 1GE9A 1FEUA 4QJVA 2NVQC 2B63A 4C2MK 2VUMK 3RZDK 3GEIA 1O24A 3HOVC 3T02A 4IO9S 2GSNA 3S0XA 5IYBK 2KQ1A 5DM6S 4AH6A 1TWCK 1ZXOA 3ADAC 3CQZK 3HOUK 5IP7C 4A3KK 4GTBA 1USMA 4P5BA 1I50K 1XXAA 2NVXA 2NVYA 1ZQ1C 5IYDK 4Y7NC 4MQ9A 1Y1WC 1WOPA 3AD9C 3AH5A 2W7VA 3S1RK 1ZVUA 4KMUA 1I6HC 5EGHA 4GFQA 5C44C 5JVGS 2Y0SD 2V6SA 1YCLA 4KMAA 2VUMA 4J3NA 4BKWA 3H3VL 4KATA 4PAAA 1TWCA 3CQZA 3PO3K 2RH6A 3AQOA 3GTPK 1XZQB 1I50A 3FKIK 4KN4A 2WAQL 4Y52C 1F9NA 4A3IK 1TWGC 4WCES 4A3DK 5JVOA 4WFNS 3S17C 4AYBL 4KMDA 1WOOA 1XPPA 3GTMK 4KC6A 4C3HK 4BBRC 4IOCS 1WIHA 1XZPB 5IP9K 4A3JK 5D4DA 4A93C 3GTPA 4YG2A 4KAWX 4OIQA 1XXBA 1JVIA 3FKIA 3MMLB 4RMFA 5C4XK 1EK8A 2Y3PA 3GEEA 1C0AA 4A3BK 4IOAS 5IOQA 1B4AA 1WCMK 3PIOS 3HXAA 1K83K 3H3VD 2YU9K 3GTMA 1WQGA 4LK0A 1HQMA 2A69A 2NVQK 1IW7A 4KM8A 2GSUA 1BDFA 1J6XA 2EBBA 2E2JC 2ZJRS 4MEYA 4GTFA 3HOVK 4PABA 5M5WK 1B4BA 4WJ3M 2ZUFA 3I4NC 1IBAA 5JFEA 3CAGA 4Y7NK 1WCMA 1WQFA 3S15C 1K83A 2YU9A 1I6HK 4WFAS 1XZQA 5C44K 3LAPA 1EQRA 3S1NC 3RZOC 3HKZD 2CFAB 5C4XC 5TJ3A 4XSXA 2NVTC 1F7VA 2R92C 1KQ4A 1INNA 5HQHA 2KPUA 4GTLA 3QX3A 4NOIA 1O26A 4Y52K 1TWGK 4KN7A 2PMZL 3S1MC 2ZFZA 3S2HC 3S17K 5DM7S 3N0BA 3FOEA 4QIWL 4WF9S 4BBRK 3PO2C 3DLLS 1IQ0A 4G7HA 1DCOA 1J6WA 4A3EC 4A93K 2L3UA 1L0WA 4BY1C 2R93C 4GT9A 3N0CA 3T00A 3G4AA 1TWGA 1DD5A 3NUHA 1BGWA 3TFJA 3HOZC 4XCHA 2WB1D 4WILA 1PJ7A 1SFOC 2GAGC 1TWHC 4G0VA 1IE0A 2PA8L 2E2JK 4X6AC 5E68A 4LJZA 1TWAC 1VH2A 3T01A 1DCPA 3I4NK 4BLAA 2PMZD 4GTDA 2XCOA 3A8IA 3BP3A 4ILDA 2ZJQS 3FHZA 2CFAA 3S15K 3K7AC 4ZH4A 2D6FC 1F7UA 2CW0A 3S1NK 3RZOK 1O28A 3AQPA 4LR2A 2A6EA 1EH1A 4A3MC 2NVTK 1YNJA 2R92K 4OINA 5HL8A 1ZYRA 4XLNA 1DCHA 1ISEA 4DDQA 4KMHA 3M3YC 3S2DC 5L46A 1USOA 3DXJA 2JA8K 3S1MK 3S2HK 4C45A 4A3LC 2KXYA 5M5XK 4OIRA 4G7ZA 4M1XA 5FLMC 1WQHA 2WAQD 3GTKC 4XSZA 4BLBA 1YX2A 3PO2K 3M4OC 2O5JA 1O2AA 2E2HC 2ZJPS 4A3EK 1VRQC 1J6VA 1IS1A 2R92A 5C3EC 4AYBD 2L5NA 5M3FK 4BY1K 2R93K 3LYWA 2JA6C 2R7ZC 1WSRA 3GSIA 4FZBA 1XXCA 1I6VA 5TMFA 1I3QC 4BY7C 2JA7C 3GTGC 2XCRB 4G0WA 2JA5C 4C3JC 2V6TA 3A8KA 3HOZK 3LAJA 1SFOK 1TWHK 2P8TA 2A6HA 1TWFC 1YNNA 2A68A 3TFHA 3OREA 3OPFA 4X6AK 2JH3A 1XZPA 3BP8C 1TWAK 1WSVA 1Y1VC 2Y0SL 5IYCC 1O29A 2JA8C 3A8JA 3VA7A 3S16C 2R93A 4WFBS 1JOEA 2PHCB 1R9TC 2O5IA 3GTOC 2NVXK 4U67S 4A3GC 4KDDA 3K7AK 3HOXC 4A3CC 1SFOA 2P5MA 1TWHA 3TFIA 4C3IC 2GAHC 5M5YK 1O27A 3S1QK 4LK1A 2ZUEA 1J98A 3AD7C 2E2IC 4G7OA 3GTQC 4A3MK 1TWAA 3GTLC 4KM9A 3H0GC 4KB4A 2FQTA 3G4CA 4Q4ZA 4GZYA 3M3YK 3S2DK 4FM9A 5TMCA 4WJ4A 4GTAA 1UV7A 4BXXC 4GTCA 3GTJK 3HOWC 2PPBA 5C4JC 3HOYC 3Q3QA 4JK1A 4A3LK 5HL7S 1WOSA 2B63C 5IOTA 5FLMK 3BUEA 4LLGA 3GTKK
chains in the Genus database with same CATH topology
4MEXA 1YNJA 4Y7NK 2R92K 4OINA 4QJVA 1ZYRA 3S14C 5FJ8K 3S15C 3I4MK 4XLNA 2NVQC 3M4OK 4C2MK 2E2HK 4BBSC 2VUMK 1I6HK 3RZDK 3M3YC 3S2DC 5C3EK 5C44K 3HOVC 3DXJA 3S1NC 2NVXC 5IYBK 2NVYC 3RZOC 2JA8K 3S1MK 3HKZD 4QIWD 4Q5SA 1TWCK 3CQZK 3HOUK 3S2HK 2JA6K 5IP7C 4A3LC 4A3KK 2R7ZK 5C4XC 5M5XK 4OIRA 1I50K 4G7ZA 4XSXA 5FLMC 1I3QK 4BY7K 2JA7K 2WAQD 3GTGK 2NVTC 5IYDK 3GTKC 4Y7NC 4XSZA 2R92C 2JA5K 4MQ9A 1Y1WC 4C3JK 3PO2K 3S1QC 2BE5A 3M4OC 4XLPA 2O5JA 3S1RK 4C2MC 2E2HC 2VUMC 4KMUA 1I6HC 3RZDC 4A3EK 5C3EC 4AYBD 4NOIA 5C44C 5M3FK 2Y0SD 4Y52K 5IYBC 1TWFK 4BY1K 1TWGK 4KN7A 2PMZL 3S1MC 2NVTK 1TWCC 3CQZC 3HOUC 3S2HC 3H3VL 2JA6C 4A3KC 2R7ZC 3S17K 2R93K 1I6VA 1I50C 4QJVB 5TMFA 1Y1VK 1I3QC 4BY7C 2JA7C 3GTJC 3GTGC 5IYCK 5IYDC 3HKZL 4QIWL 3S16K 3GTPK 3PO3K 2JA5C 4BBRK 1SMYA 4C3JC 3PO2C 3FKIK 3HOZK 4KN4A 4G7HA 3S1RC 2PA8D 1R9TK 2WAQL 4A3EC 3GTOK 4A3FK 4A93K 1SFOK 4OIOA 4A3GK 1TWHK 3HOXK 3I4MC 4Y52C 2A6HA 1TWFC 1YNNA 4BY1C 4A3IK 2A68A 1TWGC 4X6AK 4A3DK 4A3CK 2R93C 3S17C 4AYBL 4C3IK 1TWAK 1XPPA 1Y1VC 2Y0SL 3GTMK 5IYCC 2JA8C 4C3HK 3PO3C 3S16C 3GTPC 4BBRC 2E2IK 5IP9K 3GTQK 3FKIC 3HOZC 2WB1D 1R9TC 4A3JK 2O5IA 5D4DA 3GTOC 4A93C 1SFOC 3GTLK 4YFNA 4YG2A 2NVXK 4OIQA 4A3GC 3H0GK 1TWHC 3K7AK 3HOXC 5IP7K 4A3IC 2PA8L 2E2JK 4X6AC 5C4XK 4A3DC 4A3CC 4BXXK 4YFXA 3HOWK 4A3BK 4LJZA 4C3IC 1TWAC 3GTMC 5M5YK 5C4JK 3HOYK 2YU9C 1Y1WK 1WCMK 3S1QK 4LK1A 4C3HC 4OIPA 3I4NK 2PMZD 2B63K 2E2IC 4G7OA 5IP9C 3GTQC 1K83K 3H3VD 4A3MK 5M3MK 2YU9K 4LK0A 4A3JC 1HQMA 2A69A 3GTLC 3S14K 3S15K 3H0GC 2NVQK 1IW7A 3K7AC 4Q4ZA 1BDFA 4GZYA 4BBSK 3M3YK 4YFKA 2WB1L 3S2DK 3EQLA 5TMCA 2E2JC 4MEYA 4ZH4A 4BXXC 4A3FC 3HOVK 2CW0A 3S1NK 3WODA 5M5WK 3GTJK 3HOWC 4A3BC 2NVYK 3RZOK 2PPBA 5C4JC 3HOYC 1WCMC 2A6EA 4JK1A 4A3LK 3I4NC 2B63C 5FLMK 1K83C 4A3MC 4LLGA 3GTKK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEX A;  1YNJ A;  4Y7N K;  2R92 K;  4OIN A;  4QJV A;  1ZYR A;  3S14 C;  5FJ8 K;  3S15 C;  3I4M K;  4XLN A;  2NVQ C;  3M4O K;  4C2M K;  2E2H K;  4BBS C;  2VUM K;  1I6H K;  3RZD K;  3M3Y C;  3S2D C;  5C3E K;  5C44 K;  3HOV C;  3DXJ A;  3S1N C;  2NVX C;  5IYB K;  2NVY C;  3RZO C;  2JA8 K;  3S1M K;  3HKZ D;  4QIW D;  4Q5S A;  1TWC K;  3CQZ K;  3HOU K;  3S2H K;  2JA6 K;  5IP7 C;  4A3L C;  4A3K K;  2R7Z K;  5C4X C;  5M5X K;  4OIR A;  1I50 K;  4G7Z A;  4XSX A;  5FLM C;  1I3Q K;  4BY7 K;  2JA7 K;  2WAQ D;  3GTG K;  2NVT C;  5IYD K;  3GTK C;  4Y7N C;  4XSZ A;  2R92 C;  2JA5 K;  4MQ9 A;  1Y1W C;  4C3J K;  3PO2 K;  3S1Q C;  2BE5 A;  3M4O C;  4XLP A;  2O5J A;  3S1R K;  4C2M C;  2E2H C;  2VUM C;  4KMU A;  1I6H C;  3RZD C;  4A3E K;  5C3E C;  4AYB D;  4NOI A;  5C44 C;  5M3F K;  2Y0S D;  4Y52 K;  5IYB C;  1TWF K;  4BY1 K;  1TWG K;  4KN7 A;  2PMZ L;  3S1M C;  2NVT K;  1TWC C;  3CQZ C;  3HOU C;  3S2H C;  3H3V L;  2JA6 C;  4A3K C;  2R7Z C;  3S17 K;  2R93 K;  1I6V A;  1I50 C;  4QJV B;  5TMF A;  1Y1V K;  1I3Q C;  4BY7 C;  2JA7 C;  3GTJ C;  3GTG C;  5IYC K;  5IYD C;  3HKZ L;  4QIW L;  3S16 K;  3GTP K;  3PO3 K;  2JA5 C;  4BBR K;  1SMY A;  4C3J C;  3PO2 C;  3FKI K;  3HOZ K;  4KN4 A;  4G7H A;  3S1R C;  2PA8 D;  1R9T K;  2WAQ L;  4A3E C;  3GTO K;  4A3F K;  4A93 K;  1SFO K;  4OIO A;  4A3G K;  1TWH K;  3HOX K;  3I4M C;  4Y52 C;  2A6H A;  1TWF C;  1YNN A;  4BY1 C;  4A3I K;  2A68 A;  1TWG C;  4X6A K;  4A3D K;  4A3C K;  2R93 C;  3S17 C;  4AYB L;  4C3I K;  1TWA K;  1XPP A;  1Y1V C;  2Y0S L;  3GTM K;  5IYC C;  2JA8 C;  4C3H K;  3PO3 C;  3S16 C;  3GTP C;  4BBR C;  2E2I K;  5IP9 K;  3GTQ K;  3FKI C;  3HOZ C;  2WB1 D;  1R9T C;  4A3J K;  2O5I A;  5D4D A;  3GTO C;  4A93 C;  1SFO C;  3GTL K;  4YFN A;  4YG2 A;  2NVX K;  4OIQ A;  4A3G C;  3H0G K;  1TWH C;  3K7A K;  3HOX C;  5IP7 K;  4A3I C;  2PA8 L;  2E2J K;  4X6A C;  5C4X K;  4A3D C;  4A3C C;  4BXX K;  4YFX A;  3HOW K;  4A3B K;  4LJZ A;  4C3I C;  1TWA C;  3GTM C;  5M5Y K;  5C4J K;  3HOY K;  2YU9 C;  1Y1W K;  1WCM K;  3S1Q K;  4LK1 A;  4C3H C;  4OIP A;  3I4N K;  2PMZ D;  2B63 K;  2E2I C;  4G7O A;  5IP9 C;  3GTQ C;  1K83 K;  3H3V D;  4A3M K;  5M3M K;  2YU9 K;  4LK0 A;  4A3J C;  1HQM A;  2A69 A;  3GTL C;  3S14 K;  3S15 K;  3H0G C;  2NVQ K;  1IW7 A;  3K7A C;  4Q4Z A;  1BDF A;  4GZY A;  4BBS K;  3M3Y K;  4YFK A;  2WB1 L;  3S2D K;  3EQL A;  5TMC A;  2E2J C;  4MEY A;  4ZH4 A;  4BXX C;  4A3F C;  3HOV K;  2CW0 A;  3S1N K;  3WOD A;  5M5W K;  3GTJ K;  3HOW C;  4A3B C;  2NVY K;  3RZO K;  2PPB A;  5C4J C;  3HOY C;  1WCM C;  2A6E A;  4JK1 A;  4A3L K;  3I4N C;  2B63 C;  5FLM K;  1K83 C;  4A3M C;  4LLG A;  3GTK K; 
#chains in the Genus database with same CATH topology
 1WOR A;  3S14 C;  5FJ8 K;  3I4M K;  3M4O K;  1RU0 A;  2E2H K;  4BBS C;  2RGR A;  5C3E K;  1X31 C;  3JST A;  2NVX C;  1ZBS A;  2NVY C;  5IOS A;  4QIW D;  4Q5S A;  2JA6 K;  2R7Z K;  2GSO A;  3TTG A;  3GTJ A;  1I3Q K;  4BY7 K;  2JA7 K;  4LQY A;  3GTG K;  1BS2 A;  1VGX A;  2JA5 K;  3SZZ A;  4C3J K;  3S1Q C;  2BE5 A;  4XLP A;  1JQW A;  4C2M C;  2VUM C;  3L4K A;  3GTK A;  3RZD C;  2FQO A;  1O2B A;  2V6U A;  1G51 A;  1PJ5 A;  5IYB C;  1TWF K;  1BJT A;  2E2H A;  1TWC C;  3CQZ C;  3HOU C;  4A3K C;  3GDZ A;  5IOR A;  1I50 C;  2KWA A;  4QJV B;  1Y1V K;  3GTJ C;  5IYC K;  5IYD C;  1VLO A;  3HKZ L;  1HI9 A;  3S16 K;  2JA6 A;  2R7Z A;  1SMY A;  4P9S A;  3IPJ A;  3OEP A;  1IL2 A;  1O2F B;  1I3Q A;  3S1R C;  2JA7 A;  2PA8 D;  3GTG A;  2XCQ A;  3GIR A;  1R9T K;  3GTO K;  4A3F K;  1EFW A;  2JA5 A;  1F93 A;  4OIO A;  4A3G K;  4KB2 A;  3HOX K;  3I4M C;  3AD8 C;  4P5A A;  4KAR A;  4A3C K;  3LPX A;  4C3I K;  1PJ6 A;  3GEH A;  1TWF A;  3FOF A;  3PO3 C;  3GTP C;  1VJE A;  2E2I K;  3GTQ K;  3FKI C;  1Y1V A;  1EI6 A;  3GTL K;  4YFN A;  4GTE A;  3H0G K;  1AB4 A;  1O25 A;  4G0U A;  3PIP S;  5IP7 K;  4A3I C;  1R9T A;  4A3D C;  3GTO A;  4BXX K;  4KAS A;  4LOW A;  4YFX A;  5JVH S;  3HOW K;  3GTM C;  5C4J K;  3HOY K;  1Y1W K;  4C3H C;  5CHP A;  4OIP A;  3N3Y A;  2B63 K;  5IP9 C;  5M3M K;  3SZY A;  3L4J A;  4A3J C;  3S14 K;  3CF5 S;  2E2I A;  3GTQ A;  4BBS K;  4YFK A;  2WB1 L;  3EQL A;  3GTL A;  5CJ9 A;  4A3F C;  3H0G A;  3WOD A;  4A3B C;  2NVY K;  3ERE D;  1WCM C;  3V4G A;  4O2D A;  1K83 C;  5EGE A;  2YU9 C;  1V5V A;  4MEX A;  1Y1W A;  1GE9 A;  1FEU A;  4QJV A;  2NVQ C;  2B63 A;  4C2M K;  2VUM K;  3RZD K;  3GEI A;  1O24 A;  3HOV C;  3T02 A;  4IO9 S;  2GSN A;  3S0X A;  5IYB K;  2KQ1 A;  5DM6 S;  4AH6 A;  1TWC K;  1ZXO A;  3ADA C;  3CQZ K;  3HOU K;  5IP7 C;  4A3K K;  4GTB A;  1USM A;  4P5B A;  1I50 K;  1XXA A;  2NVX A;  2NVY A;  1ZQ1 C;  5IYD K;  4Y7N C;  4MQ9 A;  1Y1W C;  1WOP A;  3AD9 C;  3AH5 A;  2W7V A;  3S1R K;  1ZVU A;  4KMU A;  1I6H C;  5EGH A;  4GFQ A;  5C44 C;  5JVG S;  2Y0S D;  2V6S A;  1YCL A;  4KMA A;  2VUM A;  4J3N A;  4BKW A;  3H3V L;  4KAT A;  4PAA A;  1TWC A;  3CQZ A;  3PO3 K;  2RH6 A;  3AQO A;  3GTP K;  1XZQ B;  1I50 A;  3FKI K;  4KN4 A;  2WAQ L;  4Y52 C;  1F9N A;  4A3I K;  1TWG C;  4WCE S;  4A3D K;  5JVO A;  4WFN S;  3S17 C;  4AYB L;  4KMD A;  1WOO A;  1XPP A;  3GTM K;  4KC6 A;  4C3H K;  4BBR C;  4IOC S;  1WIH A;  1XZP B;  5IP9 K;  4A3J K;  5D4D A;  4A93 C;  3GTP A;  4YG2 A;  4KAW X;  4OIQ A;  1XXB A;  1JVI A;  3FKI A;  3MML B;  4RMF A;  5C4X K;  1EK8 A;  2Y3P A;  3GEE A;  1C0A A;  4A3B K;  4IOA S;  5IOQ A;  1B4A A;  1WCM K;  3PIO S;  3HXA A;  1K83 K;  3H3V D;  2YU9 K;  3GTM A;  1WQG A;  4LK0 A;  1HQM A;  2A69 A;  2NVQ K;  1IW7 A;  4KM8 A;  2GSU A;  1BDF A;  1J6X A;  2EBB A;  2E2J C;  2ZJR S;  4MEY A;  4GTF A;  3HOV K;  4PAB A;  5M5W K;  1B4B A;  4WJ3 M;  2ZUF A;  3I4N C;  1IBA A;  5JFE A;  3CAG A;  4Y7N K;  1WCM A;  1WQF A;  3S15 C;  1K83 A;  2YU9 A;  1I6H K;  4WFA S;  1XZQ A;  5C44 K;  3LAP A;  1EQR A;  3S1N C;  3RZO C;  3HKZ D;  2CFA B;  5C4X C;  5TJ3 A;  4XSX A;  2NVT C;  1F7V A;  2R92 C;  1KQ4 A;  1INN A;  5HQH A;  2KPU A;  4GTL A;  3QX3 A;  4NOI A;  1O26 A;  4Y52 K;  1TWG K;  4KN7 A;  2PMZ L;  3S1M C;  2ZFZ A;  3S2H C;  3S17 K;  5DM7 S;  3N0B A;  3FOE A;  4QIW L;  4WF9 S;  4BBR K;  3PO2 C;  3DLL S;  1IQ0 A;  4G7H A;  1DCO A;  1J6W A;  4A3E C;  4A93 K;  2L3U A;  1L0W A;  4BY1 C;  2R93 C;  4GT9 A;  3N0C A;  3T00 A;  3G4A A;  1TWG A;  1DD5 A;  3NUH A;  1BGW A;  3TFJ A;  3HOZ C;  4XCH A;  2WB1 D;  4WIL A;  1PJ7 A;  1SFO C;  2GAG C;  1TWH C;  4G0V A;  1IE0 A;  2PA8 L;  2E2J K;  4X6A C;  5E68 A;  4LJZ A;  1TWA C;  1VH2 A;  3T01 A;  1DCP A;  3I4N K;  4BLA A;  2PMZ D;  4GTD A;  2XCO A;  3A8I A;  3BP3 A;  4ILD A;  2ZJQ S;  3FHZ A;  2CFA A;  3S15 K;  3K7A C;  4ZH4 A;  2D6F C;  1F7U A;  2CW0 A;  3S1N K;  3RZO K;  1O28 A;  3AQP A;  4LR2 A;  2A6E A;  1EH1 A;  4A3M C;  2NVT K;  1YNJ A;  2R92 K;  4OIN A;  5HL8 A;  1ZYR A;  4XLN A;  1DCH A;  1ISE A;  4DDQ A;  4KMH A;  3M3Y C;  3S2D C;  5L46 A;  1USO A;  3DXJ A;  2JA8 K;  3S1M K;  3S2H K;  4C45 A;  4A3L C;  2KXY A;  5M5X K;  4OIR A;  4G7Z A;  4M1X A;  5FLM C;  1WQH A;  2WAQ D;  3GTK C;  4XSZ A;  4BLB A;  1YX2 A;  3PO2 K;  3M4O C;  2O5J A;  1O2A A;  2E2H C;  2ZJP S;  4A3E K;  1VRQ C;  1J6V A;  1IS1 A;  2R92 A;  5C3E C;  4AYB D;  2L5N A;  5M3F K;  4BY1 K;  2R93 K;  3LYW A;  2JA6 C;  2R7Z C;  1WSR A;  3GSI A;  4FZB A;  1XXC A;  1I6V A;  5TMF A;  1I3Q C;  4BY7 C;  2JA7 C;  3GTG C;  2XCR B;  4G0W A;  2JA5 C;  4C3J C;  2V6T A;  3A8K A;  3HOZ K;  3LAJ A;  1SFO K;  1TWH K;  2P8T A;  2A6H A;  1TWF C;  1YNN A;  2A68 A;  3TFH A;  3ORE A;  3OPF A;  4X6A K;  2JH3 A;  1XZP A;  3BP8 C;  1TWA K;  1WSV A;  1Y1V C;  2Y0S L;  5IYC C;  1O29 A;  2JA8 C;  3A8J A;  3VA7 A;  3S16 C;  2R93 A;  4WFB S;  1JOE A;  2PHC B;  1R9T C;  2O5I A;  3GTO C;  2NVX K;  4U67 S;  4A3G C;  4KDD A;  3K7A K;  3HOX C;  4A3C C;  1SFO A;  2P5M A;  1TWH A;  3TFI A;  4C3I C;  2GAH C;  5M5Y K;  1O27 A;  3S1Q K;  4LK1 A;  2ZUE A;  1J98 A;  3AD7 C;  2E2I C;  4G7O A;  3GTQ C;  4A3M K;  1TWA A;  3GTL C;  4KM9 A;  3H0G C;  4KB4 A;  2FQT A;  3G4C A;  4Q4Z A;  4GZY A;  3M3Y K;  3S2D K;  4FM9 A;  5TMC A;  4WJ4 A;  4GTA A;  1UV7 A;  4BXX C;  4GTC A;  3GTJ K;  3HOW C;  2PPB A;  5C4J C;  3HOY C;  3Q3Q A;  4JK1 A;  4A3L K;  5HL7 S;  1WOS A;  2B63 C;  5IOT A;  5FLM K;  3BUE A;  4LLG A;  3GTK K; 
#chains in the Genus database with same CATH homology
 4MEX A;  1YNJ A;  4Y7N K;  2R92 K;  4OIN A;  4QJV A;  1ZYR A;  3S14 C;  5FJ8 K;  3S15 C;  3I4M K;  4XLN A;  2NVQ C;  3M4O K;  4C2M K;  2E2H K;  4BBS C;  2VUM K;  1I6H K;  3RZD K;  3M3Y C;  3S2D C;  5C3E K;  5C44 K;  3HOV C;  3DXJ A;  3S1N C;  2NVX C;  5IYB K;  2NVY C;  3RZO C;  2JA8 K;  3S1M K;  3HKZ D;  4QIW D;  4Q5S A;  1TWC K;  3CQZ K;  3HOU K;  3S2H K;  2JA6 K;  5IP7 C;  4A3L C;  4A3K K;  2R7Z K;  5C4X C;  5M5X K;  4OIR A;  1I50 K;  4G7Z A;  4XSX A;  5FLM C;  1I3Q K;  4BY7 K;  2JA7 K;  2WAQ D;  3GTG K;  2NVT C;  5IYD K;  3GTK C;  4Y7N C;  4XSZ A;  2R92 C;  2JA5 K;  4MQ9 A;  1Y1W C;  4C3J K;  3PO2 K;  3S1Q C;  2BE5 A;  3M4O C;  4XLP A;  2O5J A;  3S1R K;  4C2M C;  2E2H C;  2VUM C;  4KMU A;  1I6H C;  3RZD C;  4A3E K;  5C3E C;  4AYB D;  4NOI A;  5C44 C;  5M3F K;  2Y0S D;  4Y52 K;  5IYB C;  1TWF K;  4BY1 K;  1TWG K;  4KN7 A;  2PMZ L;  3S1M C;  2NVT K;  1TWC C;  3CQZ C;  3HOU C;  3S2H C;  3H3V L;  2JA6 C;  4A3K C;  2R7Z C;  3S17 K;  2R93 K;  1I6V A;  1I50 C;  4QJV B;  5TMF A;  1Y1V K;  1I3Q C;  4BY7 C;  2JA7 C;  3GTJ C;  3GTG C;  5IYC K;  5IYD C;  3HKZ L;  4QIW L;  3S16 K;  3GTP K;  3PO3 K;  2JA5 C;  4BBR K;  1SMY A;  4C3J C;  3PO2 C;  3FKI K;  3HOZ K;  4KN4 A;  4G7H A;  3S1R C;  2PA8 D;  1R9T K;  2WAQ L;  4A3E C;  3GTO K;  4A3F K;  4A93 K;  1SFO K;  4OIO A;  4A3G K;  1TWH K;  3HOX K;  3I4M C;  4Y52 C;  2A6H A;  1TWF C;  1YNN A;  4BY1 C;  4A3I K;  2A68 A;  1TWG C;  4X6A K;  4A3D K;  4A3C K;  2R93 C;  3S17 C;  4AYB L;  4C3I K;  1TWA K;  1XPP A;  1Y1V C;  2Y0S L;  3GTM K;  5IYC C;  2JA8 C;  4C3H K;  3PO3 C;  3S16 C;  3GTP C;  4BBR C;  2E2I K;  5IP9 K;  3GTQ K;  3FKI C;  3HOZ C;  2WB1 D;  1R9T C;  4A3J K;  2O5I A;  5D4D A;  3GTO C;  4A93 C;  1SFO C;  3GTL K;  4YFN A;  4YG2 A;  2NVX K;  4OIQ A;  4A3G C;  3H0G K;  1TWH C;  3K7A K;  3HOX C;  5IP7 K;  4A3I C;  2PA8 L;  2E2J K;  4X6A C;  5C4X K;  4A3D C;  4A3C C;  4BXX K;  4YFX A;  3HOW K;  4A3B K;  4LJZ A;  4C3I C;  1TWA C;  3GTM C;  5M5Y K;  5C4J K;  3HOY K;  2YU9 C;  1Y1W K;  1WCM K;  3S1Q K;  4LK1 A;  4C3H C;  4OIP A;  3I4N K;  2PMZ D;  2B63 K;  2E2I C;  4G7O A;  5IP9 C;  3GTQ C;  1K83 K;  3H3V D;  4A3M K;  5M3M K;  2YU9 K;  4LK0 A;  4A3J C;  1HQM A;  2A69 A;  3GTL C;  3S14 K;  3S15 K;  3H0G C;  2NVQ K;  1IW7 A;  3K7A C;  4Q4Z A;  1BDF A;  4GZY A;  4BBS K;  3M3Y K;  4YFK A;  2WB1 L;  3S2D K;  3EQL A;  5TMC A;  2E2J C;  4MEY A;  4ZH4 A;  4BXX C;  4A3F C;  3HOV K;  2CW0 A;  3S1N K;  3WOD A;  5M5W K;  3GTJ K;  3HOW C;  4A3B C;  2NVY K;  3RZO K;  2PPB A;  5C4J C;  3HOY C;  1WCM C;  2A6E A;  4JK1 A;  4A3L K;  3I4N C;  2B63 C;  5FLM K;  1K83 C;  4A3M C;  4LLG A;  3GTK K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...