1ZYUA

Crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and amppcp at 2.85 angstrom resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
168
structure length
168
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mycobacterium tuberculosis Shikimate Kinase in Complex with Shikimic Acid and an ATP Analogue
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Siganling protein,transferase
molecule keywords Shikimate kinase
total genus 51
structure length 168
sequence length 168
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2005-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zyuA00
1GKYA 4HAXA 1X1RA 2AN9A 4F4JA 4HAYA 4CEJB 2V7QA 2VHUA 2GRJA 3Q9LA 2BIFA 3AP2A 4GMDA 1TX4B 2NO9A 2J7KA 5HCIA 3CPEA 1SVMA 1CBUA 5EXPA 3OAAA 2AD5A 3U5ZB 3IHWA 4KYIB 1EESA 4PQRA 4BLTA 1OXXK 3W6NA 3QG1A 1Z83A 3TQCA 1CRPA 3SDZA 1NN0A 5B2ZA 1W4BA 2ECKA 3AF1A 3N2EA 3NH6A 4DB4A 4JLKA 1NVWQ 1TQ2A 1TQDA 2CHVA 3IBGA 3REFA 1GUAA 2QTHA 1N6KA 4IJMA 3SYKA 1T8TA 2XZLA 1SXJA 3T5GA 1XZQA 4OL0A 3R7WA 4PPQA 2OUKA 3GJ3A 2I1QA 1EFUA 5ELXA 1AK2A 3K9HA 4I1UA 3TAUA 2Q21A 4QJ3A 5JLJA 3KQKA 3FVQA 1UBEA 1DG3A 2V6IA 4PPFA 1N0VC 5D3MB 4RFSB 3RS2A 2RHDA 1Y3AA 2R6CA 3LQRA 2X2EA 3KQNA 421PA 2C9YA 1XXHA 2IHYA 1IONA 4EPYA 1WBBA 4W7SA 4A9AA 4A82A 3ZZ0A 4NYIR 3PIRA 2PT7A 1YR6A 4OI1A 4GRAA 5SZIA 4Q1FA 4AIIA 521PA 1U8AA 4MUAA 1QHIA 3A58B 1E6CA 1KI7A 1HTWA 4AD8A 1DADA 1HYQA 1TF2A 2NO6A 1W0JA 4MRNA 5FUYA 1QZXA 1S2MA 4WOPA 5HZHA 4LJ8A 3UMSA 5FOTA 2VBCA 2NQ2C 4DIEA 2E1RA 1KI6A 3LH5A 3QSYA 3ZVNA 2A30A 4MDEA 3A4NA 1PJRA 3TLXA 1L8QA 3VR6A 5B30A 1OV4A 1XCPA 4B47A 2XB2A 2CEAA 3DZDA 4DCVA 1EFHA 2IS1A 2OILA 3LW8A 4PXAA 4DKXA 4QNMA 3FE2A 3DVLA 2ODBA 3P32A 1J99A 4Q7KA 2GAOA 2DFLA 1OHHA 2X2FA 1WMSA 2PLFA 3AP1A 5L3SB 3CF6R 3GLFB 1G17A 3EPHA 1DE0A 3CM0A 1FTNA 5DGXA 3M6AA 3T1TA 1KK0A 3LBHA 1EFRA 4GT1A 2GZAA 2IYWA 3MG9A 2R6GA 1QF9A 1R0XA 1TU3A 2ORVA 4XVRA 4P33A 4ZDWA 2O8FA 2ZJOA 4C0BA 4BPBA 1X8LA 4DSNA 2AWOA 2KBEA 4TMTA 1Z6YA 2HUPA 4ZKEA 1BYIA 2BMFA 2H7VA 2VTKA 1VKJA 4YMWA 3B1XA 2OAP1 3KQLA 2GCPA 1U81A 1DAFA 3GEHA 5KTYA 3VKGA 2MMGA 3MCAA 1XZPA 3RDPA 3T1OA 1T0JB 5EE3A 2ONJA 4KITB 2YYZA 1UPTA 3RC8A 2W2VA 5EQTA 4V0MA 1TMKA 4NYJQ 1Z0JA 4O2RA 5KU1A 3P4YA 1R4AA 3A6PC 3PENA 4D4KA 5A5GA 2XB4A 1AA9A 1OFUX 1HE1C 3K0AA 4Q7LA 3M4YA 3NBFA 3DZ8A 3T12A 1VG0B 3HPRA 5EZ6B 3QXCA 3EIEA 3KTAA 3TJZA 1E1QA 4OK3A 5FPKA 2ZAOA 3U44A 3KFXA 5TARA 5JI3E 1R7RA 5CYOA 1HT1E 1K5DA 4FINA 4HSEA 4O2LA 4NYMQ 1TUIA 5CK4A 3SBDA 3ZD6A 4DB2A 2G1KA 5DLQC 2GTPA 2YC4C 2I3BA 1S8FA 4JVMA 1DO2A 4Q4HA 3QUSA 3ZS8A 3A1SA 4B6EA 2V4ZA 4V0KA 4BQSA 3IEVA 1KZ7B 2GJ8A 4P4SB 3N2IA 3K0AB 1P62B 4IRUB 5F9HA 1JJ7A 2PZGA 4IDPA 1J8YF 3SHFA 4KHZA 4ACAA 1T91A 3KKOA 1FNMA 4CGZA 4U02A 2PX3A 1ZD8A 2D3WA 1YJ5A 3KXKA 4LYHA 3VR5A 3Q72A 5EE0A 1KI9A 2P6NA 1S96A 2ZR0A 1NVXQ 3KKQA 2AK2A 4NHOA 4EFLA 2CNWA 4DCTA 3NBXX 1JEDA 5JBQA 1IN6A 4B33A 4IDOA 3SR0A 1W46A 2IUTA 2C96A 3FPAA 2OFOA 4D2IA 3B9QA 3LX8A 1BO6A 3LY5A 1H8ED 3FMPB 2J45A 3OE7D 3B2EA 1W48A 2X8AA 1NJGA 2IBMA 1L2TA 1AQYA 3KZ1E 4HAVA 4OKSA 3RRMA 4A6PA 1YU9A 5EJEA 1LFDB 3LDAA 4QGFA 4BRWA 3ZD7A 5GJBA 4Z54A 4GOXA 3FMFA 1EG7A 3RC3A 5IK2D 5JEDA 3SQXA 5DI3A 1ELOA 4U5XA 5FOVA 4IVQA 4QG7A 3TW4A 5CDFE 2J0SA 1FZQA 1M34E 1U90A 1XP8A 3TIFA 1KK2A 4NTZA 3ND8A 3R8CA 4JLMA 2GKSA 3DL0A 3B1YA 3DHWC 4NKRA 1EWRA 2ERXA 3IIKA 5JCPA 5JHHB 2ZRGA 4ITRC 4JLNA 4LV8B 4KLZA 3QIAA 2QE7D 3R8FA 4MYHA 1D2EA 2QA5A 1TF7A 3GLHB 2EFDB 4KV9A 3CWZA 2HEIA 2OE2A 3K0FA 4UJ3A 1U94A 3VQTA 1XXHB 3K70D 2A5YB 2OESA 2VRWA 3RRNA 3QPWA 1Z8FA 2JDIA 1XDBA 4ZO4A 5E3HA 1R6BX 3QXSA 1N0WA 2OG2A 4MUBA 3K8YA 5JHGB 1KNXA 4JJZA 1XPRA 3IHLA 2LKCA 2QAGA 2J9RA 1F2TA 1IM2A 4YMUA 3R20A 5FI1B 3CW2A 4G5SA 4DLVA 1KMHB 1E99A 4X8HA 4LJ9A 3SYNA 2ZRNA 3RRYA 3KJGA 4PFSA 4CVNA 4XVQA 1DPFA 2GZHA 2F9LA 4AY2A 4F92B 4CEHA 2CBZA 5AR1A 4BFTA 3CF2A 3RRZA 2CE2X 2W6ID 4FMDF 1BIFA 3OEHA 1GNQA 3BFXA 3VHXA 2FSFA 1W5TA 4DVGA 3AVXA 1XEFA 2ZSBA 5FR2A 4ARZA 4DRZA 5FBVB 5K8IA 3X1ZA 4MYCA 4MRVA 4BEBA 4HYYA 3AUXA 1VG9B 1KI8A 4QNRA 2IS4A 2PCLA 2L0XA 3KFVA 2EU8A 2G77B 1XTRA 2EWVA 2C95A 2NTYC 2VO1A 2Z4RA 3ZS9A 2EFHB 3K9NA 2N46A 2A5GA 2JJ2D 1Q0UA 4DLWA 2O8BB 3LX5A 4GZMA 4B74A 1UAAA 4HEJA 3TK1A 3Q3JB 4PZYA 2JASA 1H65A 4JSYA 3OESA 4JZKA 2WWYA 2F6RA 3CPJB 4AKEA 2RGNC 4CF7A 2ZANA 3U3JA 1IN8A 3R7WB 3B1WA 2VYFA 4C0LA 2FFQA 2WV9A 3B82A 3I73A 1KSGA 2BWJA 1KY2A 2D2FA 3R9WA 1YRAA 4QBHA 1RRCA 2IYYA 2ZVQX 3CNLA 1F2UA 1K5GA 2BVNA 4EPXA 4ZI2A 1NVVQ 1GNPA 2IF2A 3J81k 2NIPA 4AKIA 1NBMD 3L0PA 2VHTA 1CJMA 2J5XA 2WAXA 3R9IA 4TQ9A 5J47A 2WKRA 3CRQA 5GJVC 1BYUA 5DSZA 2B6HA 3AF4A 4TWZA 3A1TA 2KI5A 4PSKA 4N0DA 2PL3A 2BBSA 2P65A 1VPLA 1WP9A 1NF3A 4MDFA 4A92A 4IDQA 4M8NE 2W2XA 2Z5FA 1ZC3A 3TQFA 3UK6A 3GQBA 2ZRCA 4KODA 4NYMR 5M04A 4URUR 1KSFX 5FPTA 5DHFA 2OZEA 4PHTA 3EW9A 2ATXA 2R6FA 1HA3A 1II0A 3UWOA 4TQAA 3WY9A 4DEYA 3NDBB 4R7ZA 3MLEA 3AQ4A 4KYUA 2F1HA 2V1XA 4TYNA 1BOFA 1JECA 1SGWA 3U3OA 1E69A 1EFCA 2C8VA 2DPXA 2G3YA 2IYLD 1DARA 2UVQA 3D6TB 3I4LA 1BMFD 1TL7C 1V5WA 4C0SA 2B8TA 4P31A 2XTNA 4C0KA 5J40A 1J90A 1KKMA 2GETA 2A7QA 2ZRPA 1SQ5A 2XNDD 4ABYA 1W4CA 3HU3A 2X19A 2YWEA 3MSXA 1Z22A 1XJQA 1A4RA 1CKEA 4RZXA 2F3RA 2JLZA 2EFCB 3L2OB 1P75A 5DO9A 3DMDA 1COWA 1KDPA 4F4IA 1G41A 1UADA 4PHFA 4XD7A 3HYTA 1UDXA 4JJKA 2WSSD 1UBFA 4JMPA 4WVFA 1NSTA 3BE4A 4QC2A 1NLZA 1FTSA 1YZTA 1ZM3A 2NOAA 4QBGB 3UIEA 3KX2A 4GP6A 1MO4A 5KOYA 3W5JA 1OFIA 1OIXA 3SEAA 2DR3A 4WBSA 1ODFA 3F3YA 4O3MA 1E79D 3KJHA 4B3GA 1IXSB 4HDQB 1TAGA 3H1TA 4POAA 1R8SA 2H17A 5FL7D 2QROA 1Z0FA 1QG2A 2KSQA 4G5RA 3CWQA 1AIPA 3GMTA 1MKYA 4N3NA 3OIWA 4D25A 2ZJ5A 2WTUA 4URWR 2ZE5A 3QF4A 3DOEA 1XFAA 1BKDR 2XEXA 3O8DA 4UJ5A 3PEYA 4B3DA 3QOFA 4WXPA 3A37A 4IOLA 3U7EB 1NY6A 2CLSA 4YXWA 1NG1A 3KB2A 4PO8A 1D9XA 5IK2A 2ZITA 3M1IA 4MGYR 1QHHA 3OFNA 5GJCA 1NIPA 1FOEB 2ODWA 2QRNA 4DWJA 4GBMA 1B23P 5CM9C 5FTKA 4TMKA 2LCFA 2RGCA 3SYLA 2ZEJA 1XPUA 2ZSAA 3UATA 3QENA 4E5UA 1ZNYA 4HB0A 4KO8A 3I1FA 1D8TA 2YWHA 1KJYA 5FTLA 2FGKA 2P67A 3C8UA 1N6RA 1M8PA 2J59A 1AKYA 4HB3A 5BQ5A 1Z3IX 3AGPA 4DSOA 3AVWA 3JZMA 1R0ZA 5DISB 5F3WB 4DSTA 1UJ2A 2Z4SA 3V00A 1I4DD 5HKKA 3A8TA 4TTPA 1P72A 2CLCX 3EWAA 4G1UC 1KOFA 4YDHB 4DHEA 4PSAA 1CJUC 4WXRA 5LPNA 3BS4A 3ZJYA 4LJYA 3EPKA 4CT5A 4B76A 1XMVA 4D81A 1NKTA 2QPTA 1U9IA 2O0JA 2R9VA 2KWIA 3FFAA 3GJ8A 1KO8A 2BBWA 1W4AA 2HT6A 2VEDA 3I8SA 3K09C 1WRBA 2PEZA 3KDSE 4P4UA 4B2LA 4ESHA 4DDWA 3DOFA 3K0CC 4A0HA 4TL9A 4Q9KA 2KBFA 2HCJB 5FFMA 4C7OA 1XEXA 5E7JA 1MOZA 2ZJ8A 2HYDA 5AK0A 1GP2A 1Q57A 1Z0AA 5KPJA 4D4MA 1W0JD 3JVVA 2SHKA 1NI3A 4ASUD 2W6IA 4LYJA 4JIMA 5HE9A 5IT5A 1ZC4A 2BC9A 2XNSA 3ZYCA 4X8LA 1FQKA 4GL2A 2ZYWX 2FZLA 4D4LA 4MGZR 3EARA 4EDHA 5KUTA 3KXIA 2QP3A 5E4FA 1RZ3A 3EZFA 4UNQA 1OB5A 3AVQA 5DI9A 3BERA 1IY1A 1GOTA 4R9UC 2QT1A 4NPHA 3RS5A 2D4HA 2WJHA 5FL3A 1E2NA 2QPOA 1VYVA 3BAFA 4LV5B 1E98A 4ZIRA 1DEKA 3I3SR 4TT3D 5JSZA 1G4AE 1GL7A 4PZZA 5SZKB 2P3SA 5JS8A 3GLHA 4UKDA 2WPDA 4D80A 1G5TA 4Q4AB 5FBLB 1W5SA 1VIYA 2F9MA 3B13B 3GEIA 2JCSA 2JAQA 2WSMA 4JLJA 3S1AA 3BD9A 2GILA 2H18A 4RD3A 3CNOA 2FSHA 2IYXA 2C04A 2IK8A 4OHVA 3FFBA 1Z29A 5L3RA 3C7KA 3QKSB 1E9SA 4OQXA 1W49A 4HDOB 1HQYE 2NZ8A 2GXUA 4M2LA 3BGWA 3K70B 3GLHE 3N5CA 2BMJA 1OKKA 2GF0A 4M21A 1ZM4A 3Q5DA 3U7HB 2JJ8A 2VP9A 1CJVC 1W0KA 1VG1A 4ERNA 1GM5A 2RMKA 3C15C 3H4MA 1G7RA 2ZSFA 1DAMA 2MSCB 2XZPA 1JQJC 1E3MA 4GFDA 2XSZA 5HTKA 1NLYA 2DWQA 4IVRA 4D6PA 3BH7A 1G3QA 1VCIA 4GP7A 3FWYA 1JAIA 3OZXA 5FOSA 3LWNA 1KO4A 4LBWA 3VR1A 2PCJA 4RKEA 2J41A 1MT0A 2CHQA 3CUEF 1VIAA 2AWNA 2BM1A 3MUFA 4XH9B 1E9DA 2CMKA 4QBIA 3A4LA 2W0SA 1G1MA 4QGGA 4DDVA 5L3QB 2JLXA 2GXAA 3LLMA 4NCJA 4V02A 1OXTA 4YQFA 1Z6AA 3KKMA 3THWB 2ZRHA 3PCRB 1NMXA 1Z08A 2QEQA 4IOJA 3EZ7A 2BEJA 2REOA 3NC0C 1J8MF 2C2HA 3EZ6A 3PUWA 4US2R 5GADl 2IT1A 4DJTA 1KTVA 1YR9A 3DEFA 1RW4A 1L4UA 4B3FX 1CJKC 1AM4D 4Q4AA 4LC0A 3RWMB 2ZROA 3CRMA 1RRPA 2ZI3A 4WAUA 1JXMA 3OIUA 1M6NA 4MRPA 1VYUA 5L8VA 1M74A 4ZDIA 3ZQ6A 4XWKA 3IQXA 3UKDA 3C14C 3GLGA 1VCNA 4US1R 1VDZA 2QBYA 4H1VA 1KK3A 2ZRJA 1DAIA 2QUZA 5DHAA 3K0CA 1KY3A 1A1VA 3PQCA 2O8CA 3B1VA 2FOLA 4HATA 3THWA 4R98A 3VKHA 4PC3A 4B3BA 5FTJA 1W7AA 4A2WA 2R2AA 1P9NA 4KAXA 1X3SA 1MO5A 4A1FA 1U9IC 3CH4B 5CB6A 1EFRD 1CS4C 1SXJD 4GOKA 3TSWA 1YZGA 4KJZA 4JLBA 3W8RA 5LD2C 4Z51A 1MRNA 1HV8A 4DLXA 3NHAA 3DKVA 1ZW6A 1HUQA 3UWKA 1IXRC 2OHFA 5BW8A 4F7WA 1NN1A 2OV2A 3HWSA 1S9DA 2ZAMA 2AKAB 3IKJA 1I2MA 2ZTSA 1UEIA 1GL6A 3M0EA 1M2OB 5DN6A 4ASUA 3ZDQA 5FBQB 1X8KA 3G5UA 1PV4A 4EQ6B 1GAJA 2W0MA 4HDCA 4LZZA 2O52A 2GHIA 4LGMA 5H8WA 1KKLA 1II9A 1KO7A 4JT4A 2GEUA 4P4SA 1MO6A 3QPVA 4DT1B 2BBTA 1ZM2A 4URXR 3IILA 4DLUA 1E1RA 3KKNA 4XTCS 1XPOA 1E0JA 1E9BA 2NO0A 5EXXA 3GJXC 1I4LD 4KSBA 3I5YA 5LDDC 1YHNA 3MJHA 4RFVA 2ZPTX 4M1MA 3X1DA 4TN1A 4D0NA 4IXMA 821PA 5EP3A 3ECCA 3TNFA 3AVUA 1KIMA 1M1YE 2QENA 5E7IA 4YONB 3L8ZA 2K5UA 4TLAA 5AJVB 2EVWX 3BFKA 3SQWA 1WB9A 1IN4A 2NO7A 4PR0A 2QMOA 3BJIC 5E95A 4C30A 4LPSA 2JLQA 4UNSA 3A1WA 4NZYA 3A36A 4Z1MA 4JL6A 2FEMA 4FCVA 4YLGA 1NL3A 3GCGA 1OKKD 4GMXA 3CBQA 2DCUA 3TUJC 1AS0A 5DI3B 5EXTA 1R8QA 1NSFA 5HE8A 1ZUIA 5CITA 2AKYA 4YMTA 4MITA 3SFVA 2VP6A 2ZI6A 4LBVA 3LA6A 3THXA 1N6HA 1ZYUA 3AB3A 3A4MA 4MKFA 2ZUBA 4RZ2A 4RZ3A 4TL6A 2J1LA 2FN4A 2VHCA 2QY9A 5TV2A 4XJXA 2IXEA 4HUQB 1W1WA 2OXCA 4IKEA 5G53C 3EPJA 3EZ9A 3BC1A 3IUYA 2G1JA 4HAWA 1CLUA 1LTQA 4TT3A 1G3UA 3C5HA 1CP2A 1NLFA 2IS2A 3TSZA 2BKEA 4DBLC 4DLSA 2QORA 2HV8A 3GPLA 3ICQB 4L9WA 3K9LA 4QGHA 3HU2A 3W8NA 5BYKA 3ZVMA 1G8PA 2J0UA 3EG5A 4HLCA 4Q48A 5EE9A 3ETLA 3BBPA 4DLYA 1OH8A 4U00A 2VSOA 5E7MA 1HEIA 3L82B 4NONA 3LV8A 4Q4HB 3TVDA 4P4TA 2ORIA 4Q9JA 1G5RA 3MWLA 5A4JA 1BMFA 1HT2E 2QN6A 2P6UA 3CX8A 3QF7A 4GPTA 1E9CA 1RVDA 2CXXA 1UDWA 3I8XA 4RVCA 1C9KA 3WRXC 2XXAA 4JVLA 3FKQA 1MABB 3GJ0A 4LBZA 2IS6A 1UKEA 3C16C 2RAPA 4LRWA 4AYTA 4KVAA 2VP0A 4MRSA 5KSPA 4O25A 2H1LA 1NKSA 2OCBA 2ZR9A 3WMFA 3LRPA 1ONBA 4TYQA 4AC9A 4DCNA 1ZAKA 2CJWB 4ZCIA 1US8A 4RJLA 2PBRA 4JVSB 2VLIA 1JXOA 1SVWA 2DBYA 2QAJA 4LJ4A 2CL6X 4B32A 3UPUA 3TVTA 4BE7B 1E2DA 5KSYA 5GVRA 4M4SA 2RGNA 4CW7A 1NG9A 3H86A 2OXRA 4V0LA 3EIQA 1JR6A 1KJZA 4TYPA 3GFPA 3AKEA 4LV6A 4V03A 2QMEA 4MYUA 2EWWA 2WIAA 3RYTC 3LXRA 4QJ5A 2H16A 2XTZA 2ZYUX 4IVPA 4TLDA 1G7CA 1FNNA 2DFKB 4Q01A 5EUQB 3OE7A 4AKGA 4AI6A 3NDPA 1GFIA 1W4RA 1XWIA 2OFWA 2NG1A 4A4DA 3DMNA 4BGDA 5JCZA 1T8UA 1AZSC 4II7A 4HB4A 4QHSA 4B3CA 1AS2A 1G64A 2J0UB 3G82C 5DNYB 2I1VB 1IN7A 2XOKD 1UM8A 2FEOA 2QQ0A 3FB4A 2JJ2A 3ONWA 1W47A 3K53A 4Q02A 2DY1A 2B7CA 2GK7A 4FMCB 5FL7A 4KLNA 2HJGA 1RE0A 2WKPA 1IOZA 4GNKA 4Q9LA 3CONA 2QSZA 4H9GA 4QKQA 1YZLA 3SE0A 1RYFA 1KDRA 2VIIA 2Q0HA 3BH0A 3X1XA 4YMVA 3RANA 2RH5A 3JZAA 3ASYA 3ZGXA 1UBCA 3W5IA 2BKUA 1XRJA 2GJKA 2W6JA 4QHYA 5FH9A 1GITA 3GJ7A 1OH5A 4M0LA 4XOIA 3QVVA 1Z0KA 4URZR 3RS4A 2J3EA 4Q1DA 5K8TA 3BK7A 2C99A 4M9SA 1G6OA 2Q6TA 3BWDD 2PX0A 1T4GA 4BFUA 4BUJA 3U3RA 3QI2A 1GVNB 1MRSA 2JGNA 3WYAA 1Q22A 2IUUA 4CT4B 2GVDC 1S9HA 2V3CC 1SHKA 2ZR7A 3LLUA 5IDVA 3W9YA 4YC7A 1DOAA 5JWOA 2CVHA 3GEEA 4JSTA 4ZCLA 5G41A 1ZCBA 4RD0A 5EP1A 2OCPA 2D74A 1N6NA 1QHSA 2DFNA 2FFHA 2GNOA 1D9ZA 3OIVA 721PA 1CXZA 3MWJA 4M1WA 4DC9A 4US0R 1KI1A 2OCAA 2VL7A 1GZSA 1G5PA 2CCKA 3ADKA 1RIFA 3ADCA 2R65A 1DAGA 1L7VC 2Q9AA 5IHPA 3U3MA 4B35A 4CEIB 2O0KA 2IWRA 3TKLA 1KMQA 2YVUA 5FBWB 2AX4A 2OLKA 2XITA 3GLFE 1KSHA 1SHZA 3B6EA 2O8EB 2QP4A 1RYHA 1DTSA 4NCKA 4JT2A 2CLDX 5FR1A 4TZ0A 5C1BA 3I92A 1WXQA 4PPNA 2XJ9A 3RVBA 5J4HA 2GJ9A 5AUPB 3OEEA 4TLBA 5KDLA 1G8YA 1ZBDA 5DH9A 2B92A 1CU1A 4PAMA 1T5IA 1LV7A 1YQTA 5JS7A 4H1UA 1XX6A 1II8B 1NJFA 4BLSA 3T5DA 3CR8A 4BFVA 3TGPA 4L9SA 4W9MC 2RHMA 2OO7A 3LFUA 3QXXA 3AVYA 5C4MA 3Q7PA 2YWFA 2ZJYA 3U61B 1ZCAA 1XMIA 3NXSA 5CIWA 3NBYC 3V4RA 1OFHA 3QVUA 4TZ6A 1YZUA 5GJWC 4LC1A 1C4OA 1JI0A 1YKSA 2MSDB 1ZM9A 3LBNA 3QNUA 1Q3HA 4JKIA 2LWIA 5KYKA 1SULA 4HLQB 3N70A 5G40A 2CHGA 4OI2A 4NCNA 1P2VA 3AP3A 5KDDA 3BIFA 4UXJA 3E5HA 4LHZA 4XWAA 4TQUS 1F6BA 1JJVA 3IDQA 1XEWY 3CZQA 1U99A 1OFTA 2A5DA 5J4KA 1OB2A 3X1WA 4QM6A 4D4JA 1RJ9A 3X1YA 5EUMA 3THYA 1DAEA 2GXSA 4M22A 2BDTA 3FTQA 1XNJA 1VCMA 1Z47A 1J70A 3KB1A 3TE6A 3AGQA 3LVRE 2WWIA 5JWRA 1G4UR 2GAAA 4M9XA 1ANKA 4HAUA 3ZH9B 2O8CB 5JJLA 3E70C 3VAAA 2QM7A 1ZU4A 3CRRA 5CM8B 3F0TA 2F43B 4NP6A 1TEVA 3K09A 3PUVA 5EE5B 1RRFA 5JI2E 1E96A 4LOAA 2A2ZA 2VF8A 2JIZD 4PO9A 2Y8EA 4XWOA 1Z07A 2C9CA 3DKPA 4BFSA 5FPHA 5CLLA 3O8RA 2IA5A 121PA 1LNZA 3RWOA 3TH5A 3UANA 4L5BA 2QRZA 4BLPA 1R5NA 2AXNA 2OBNA 2PJRA 4BLOA 4A0FA 1K6MA 3CIOA 2N42A 2F1IA 3NBZC 4Q4JA 4WZ6A 1S0UA 1DS6A 4OJKA 1V43A 1SKYE 5FI0B 1LY1A 1KI4A 1U2RA 2V8OA 4C0QC 3CKLA 2XAUA 3U7FB 1UBGA 3L0OA 1TADA 2R62A 1S3GA 3V4FA 2UZ3A 3TR5A 1E2FA 4G5OA 1NBME 5KDOA 1MR3F 2ORWA 5LD2B 4Q5IA 4V0ME 5JWHA 2DB3A 4PAOA 1P5ZB 1Z28A 3VU9B 3EC1A 4B75A 4G3XA 3TRFA 2B8WA 4MH0R 3VR2A 4A8JB 3KJIA 2A5JA 5H1YA 1JAHA 3SJCA 1ZIPA 1GRQA 3B85A 4OK6A 1ZUHA 3WHKA 3P4XA 1E2PA 4P32A 1P3JA 2ODNA 4HZIA 5F2EA 2PMKA 1FX0B 1D2MA 3PR1A 1TUEA 3ZIAD 2AK3A 4EPVA 1FQJA 1G3MA 2XXAB 5FUVA 4Q9HA 4KFSA 4B2PA 5J4VA 1KJWA 4CZ2A 3U6KA 4FXPA 1TU4A 1XBTA 3NTUA 4G01B 4PANA 5D3QA 1M7HA 4Q1CA 5HKKD 2NO1A 3ZIAA 1GWNA 4Q1AA 4JS0A 4K46A 3OF5A 2R44A 4NU0A 4PHHA 2GEDA 2A78A 1N6OA 3ADBA 3AVTA 4NBSA 3RLFA 1FFHA 3KXLA 3PUXA 2G83A 2PT5A 3GLGE 1SXJC 2ZS9A 2PH1A 1W0KD 1ESMA 5FPSA 1R2QA 4ZIRB 5JSZB 5KPDA 3EX7C 1M7GA 1N0UA 1QBKC 1KSJA 1VHLA 2W00A 3AF2A 1A5TA 2EYQA 2N1BA 3SS8A 2WKQA 4AYXA 2ZYTX 3S1AB 1A82A 1N25A 1Z0DA 1VG8A 2QP9X 1ZD1A 4LJ6A 3P20A 3BOSA 3RABA 2XTMA 1XEWX 2BMDA 3W90A 1NP6A 3L8YA 1XTKA 2DWPA 4QFMA 4B34A 2VHJA 4FMBB 4YXWD 3IIJA 3PVSA 4ZPXA 2QGZA 2GWHA 1IJFA 1S4QA 1ETUA 1Z6GA 5FTMA 2VPPA 1XJ0A 3TMKA 3NHBA 4KU4A 1JBKA 2ERYA 1T6NA 5AJWA 1E2IA 1XTJA 3FHTA 1G8FA 2PZFA 2J0VA 1SKQA 4EPTA 4DLZA 1MABA 4AWXA 1XD9A 1HY3A 2FPKA 2WWFA 2QBYB 3WNDA 2ZXUA 2FU5C 2EYUA 2BJVA 2BMEA 4OHZA 4D0LB 1XTIA 2QT0A 2OFXA 3FMIA 1XD2A 2ZYVX 2KE5A 2WWHA 4JLVA 2RB4A 2EFEB 3WBJA 1YE8A 4DUGD 2GESA 3AUYA 2GJSA 3KJEA 2ZJAA 4UQOA 2AFHE 1GNRA 5JJKA 4CEHB 1YRBA 1F60A 4LJAA 2QG6A 2YKGA 1T5LA 4IFBA 4Q47A 2JLWA 5KHOC 3VX4A 1KI3A 4OI0A 4IXNA 4CDGA 2GZDA 2P2LA 3THYB 1FMJA 1VMAA 4B43A 1C1YA 4PC1A 2YHSA 2QNRA 1HQCA 1Q1BA 4I1SA 4JLPA 1OXSC 2F7SA 1Q12A 4LJ5A 1P2SA 1ZUNB 4DCUA 3FYHA 2GF9A 1NIJA 2YINC 1OIVA 2WMNB 3GLFA 3AVPA 4W5WA 1EK0A 2QU8A 5HCNA 4CEIA 3DO6A 2JLUA 4L16A 2GA8A 3SU8A 1TPZA 2BJWA 1GILA 1I4TD 2QTVB 2V1UA 1E0KA 3THOA 2ZRMA 5L3SA 1R0WA 3HR8A 4FMDB 4RD6A 4YMSA 4EPWA 1OIWA 1KHTA 3PFIA 4MGIR 2CE7A 1OH7A 1SZPA 1T3LA 1AKEA 2WAYA 3KQHA 1AJEA 2AXPA 2CDNA 1MO3A 1P6XA 4TMWA 2O8FB 1R10A 5FPYA 2QTFA 5CLQA 1JPNA 2TMKA 3QEJA 1E79A 4EPRA 1G3IA 1UEJA 1HURA 2QAGC 2Q9CA 4FN5A 5ANRB 2ZJ2A 1FPMA 1VHTA 2GXQA 2BHRA 1CTQA 4Q9IA 5LB2A 4NMMA 5KNBA 2XX3A 3MFYA 1KK1A 4UNPA 3UMRA 2WJIA 4LHVA 2HXYA 4QL3A 2HLDA 4RCZA 3TW8B 2J0QA 1Q20A 2IYZA 4G5QA 2DYKA 4HUQA 4M1OA 4QM7A 2C9OA 2WHXA 4I99A 3GP8A 2ZUDA 2KJQA 2F55A 4RKFA 2WICA 1E9EA 3SJBA 1KO1A 1OYWA 3PUZA 4LYAA 3W6OA 1JALA 4NYIQ 4PZLA 1Q21A 3WYGA 5J4YA 5TMPA 3QPUA 4Q00A 5DIFA 2IXGA 1RRGA 3U44B 4TTQA 2WZQA 4RCYA 3P1JA 4M1KA 2IYSA 2IXFA 2W6JD 1LS1A 2YOHA 1O3YA 4NH0A 3QXHA 4RSGA 1IBRA 2YV5A 1Q44A 2BEKA 2Q3FA 2BBOA 4R2IA 1P2TA 4FWIB 2JEOA 2FG5A 2GBLC 4M1TA 1JB1A 2ZETA 1A7JA 4TYYA 2JLRA 2VP4A 1QHXA 4DLTA 5JRJA 3D8BA 3HJNA 4C2TA 4EJSB 5GVSA 1E9FA 2YOGA 3SJZA 1US8B 1XXHE 2IL1A 4PX9A 1WCV1 1VTKA 2IC5A 4C2UA 1GDDA 4S2EA 1G18A 2VSFA 5JECA 3VNVA 1X1SA 1EX6A 3MD0A 1G21E 5AUOB 4XIGS 3BB4A 2GDJA 2YC2C 1W36D 2R6DA 2CK3A 3DPUA 2XJ4A 3LQQA 2FSIA 4QHTA 4QBFA 2BOVA 2O8DA 5C18A 1JEEA 3CX6A 1LF0A 3D3QA 2H57A 3LXXA 5DYIA 5G3YA 1WBDA 2KB0A 2FPLA 1OYYA 4EJSC 2D62A 2H5EA 2ZI5A 1NVUQ 2IF0A 1WF3A 1UKVY 4I1OA 5LBIA 2ZRLA 4IW3B 3DM5A 1ZP6A 3O8CA 1CIPA 1E2QA 2C98A 4NDZA 3U60B 4BFWA 4MKHA 1IJEA 1F2UB 4LY6A 2B7BA 2GVZC 2OCYC 2ZRFA 5BYJA 3R9XA 3GFTA 2FWRA 2ZUCA 3CPHA 3QQ5A 3O8BA 2JLYA 3VU9A 3VKWA 3H84A 4PSVA 2FFBA 4MYTA 1E2KA 3AM1A 1ZVQA 2WOJA 3QJYA 1AGRA 3VTKA 1R5OA 1YZNA 2WOOA 5BN4A 2RGGA 1Z6TA 4TLCA 1RFLA 3UG6A 4QRHA 2FFAA 1AQUA 1Z5ZA 2V7QD 2W2TA 4MKGA 1W36C 4R71A 1UF9A 2PJZA 1E9AA 5C46F 3L0IB 3OAAD 1LS6A 2AD1A 3FMOB 1M7BA 4DEXA 5JRZA 3LO5A 2OM2A 3A1VA 1AGPA 2ZJBA 1A2KC 3SOPA 2HF8A 4GSYA 2FA9A 5DN6D 1U0JA 2QAGB 1IY0A 1YZQA 3MWYW 2ZREA 3CO5A 1RPZA 4EFMA 4HLUA 1XMJA 2J7PA 2YNMA 2H8KA 1D2NA 2V9PA 1P9RA 4MKIA 3WMGA 4BECA 5K8LA 3VNUA 5J4LA 3U7GA 4RY2A 4FCWA 4PC6A 2GCOA 2QMUA 3MGCA 1RJ9B 1VECA 1E32A 1SXJE 4KCGA 2G0TA 3TR0A 1G16A 2W58A 1KNQA 4FW9A 3T1QA 1XJCA 3HP1A 3QE0A 1OJLA 2RGDA 1D6JA 3HR7A 4LHXA 4WA7A 4MQBA 1K8RA 3IPYA 4JBXA 2FNAA 4KXFB 4RZUA 4DDUA 3KQUA 2DHRA 4DZZA 3PEWA 4OHYA 2G0NA 2F3TA 3T06B 3GLIA 4KI0A 2O8BA 2JJ1A 3W3ZB 2JDID 1T0HB 2BCJQ 1NRJB 4OQNA 3D31A 5EP2A 2GCNA 3V9PA 5AJZA 3AKYA 4F4CA 5B64A 1R5BA 3H2YA 4Z1MD 2ZRIA 1KO5A 1DELA 2MSEB 4LUCA 4IEIA 4Q7MB 2GCOB 2WJYA 1WE2A 2WBLC 3P27A 4CIDA 4L4UA 2EW1A 1N5KA 2FV8A 1DAKA 3C5CA 2A9KA 2B21A 2XOKA 3AVOA 3I72A 4WW0A 3TUIC 5CB8A 3EPLA 2XGJA 3L0SA 2QMHA 3KKPA 1AN0A 4A2QA 2ODEA 1J2JA 2AHOA 3QY0A 5BWMA 4PO1A 4GOJA 4BFYA 3E2IA 2H92A 3AEZA 1JR3A 1YR7A 1Z06A 3BRWD 1QVAA 4TSFA 1GKIA 1YZKA 1G7SA 4M1YA 1NN3A 2VQSA 4MRRA 4JVNA 4OBEA 4EFNA 2D2EA 4TMXA 2AL7A 2J46A 2ONKA 2NPIA 2HF9A 2C78A 4I4LA 5AUNB 2D7DA 2YZ2A 3OEHD 2UKDA 1S1MA 4DIDA 3RS0A 4F93B 4A36A 2QPAA 5JJIA 4FI3C 5FBRB 4EAQA 4GZLA 4M9QA 1LW7A 3QG5A 4HLDA 3Q8XB 3D7MA 2UZIR 2Z6VA 2GEVA 2QQEA 2IYVA 1OLOA 1EFTA 1KAGA 4M9ZA 1NMYA 4IOMA 2Z83A 3PUYA 4PQYA 1Z2AA 2MMCA 3FOZA 4IDNA 3PJRA 5CDFA 3B8HA 2QSYA 2ZU0C 4L15A 4JBYA 1G6HA 4QOSA 3SJAA 1Y63A 2CCJA 5B57C 1N5IA 3EASA 3WMEA 1SVKA 3HDTA 1FL9A 2HDNB 2PMDA 4O0MA 3PG5A 3CNNA 4FCTA 5EP4A 1E0SA 5AJXA 1WA5A 5D3MA 3GLGB 2WWWA 3KL4A 1BH2A 1NNEA 1CRQA 3ZZTA 5L3QA 4X8MA 4P3YA 4C7OB 2O8EA 1H8HD 2P5SA 3QKTA 1GRNA 3Q7QA 1FUKA 2FF7A 2CVFA 1KDOA 2ZSDA 5AJYA 4Y0AA 2CCGA 4PQFA 2OAQ1 2IHBA 4C0AC 6Q21A 1HE8B 3HPQA 1KAOA 1RKBA 2V55B 3BORA 4TMVA 1W44A 3TSOA 2ZRBA 3AVVA 5F9FA 2RGEA 1WQ1R 1SXJB 4Q03A 4WZAE 2O0HA 5J5CA 2CL0X 3MJRA 1XTSA 1NBMA 1Z0IA 2WMOB 5K8UA 4E07A 3CR7A 1GG2A 2E9SA 2HJVA 4MGKR 3U6BA 1CJTC 3DDCA 2OSBA 621PA 4XSGA 4TL8A 3IPXA 5FOXA 2QM8A 3CF0A 4IHQA 3B1ZA 4JYBA 4IDHA 1VYTA 3FGNA 2P0EA 2RGAA 4Q1EA 4EIWA 3QBVA 1E2HA 1ZNZA 5DYGA 5HZKA 1WDTA 2RGBA 4A8JC 3PEVA 2J7PD 1TF5A 5P21A 1B0UA 5EE1A 3Q85A 3T15A 5C2JB 3I61A 2WPDD 2JLSA 4KBGA 4EUNA 5B58C 1ZJ6A 1G8GA 4KFUA 2AR7A 4FD2A 1OW3B 1OHHD 1ZD9A 1II8A 4EQ6A 1TQ6A 3B5JA 4D26A 4AG6A 2GJAA 4NL4H 3AKCA 2OLJA 1KI2A 1X8JA 1SVIA 3LD9A 2VF7A 2I4IA 3FKSA 4JL8A 3RAPR 2ZI7A 2ZI9A 1N6PA 4Q1BA 2CL7X 3EZ2A 2ZI4A 4F91B 1HH4A 2ZVPX 2JA1A 1E2JA 1W2GA 4PC7A 4A8JA 1Z6XA 4LX0A 3LW7A 3RSLA 3SFZA 1H8EA 2EFGA 4CRWB 8OHMA 4HZUA 3PXGA 1OF1A 5SZJA 1D5CA 1ZRHA 5L3VA 1DBSA 2FX3A 4DDTA 1FP6A 3JVUA 3T61A 1E2MA 1E2LA 1IY2A 1NY5A 2HLDD 4C0HA 1P60A 2YWGA 3KUDA 5BXQC 4TSFD 4E22A 1G20E 4P0TA 1ZM7A 3FKSD 3HU1A 4DUGA 4ZV4A 4JLDA 4LCBA 3IO3A 1OSNA 3WXMA 1GL9B 2X1VA 4JLOA 4KFRA 2WM9B 3NVAA 1KGDA 2ZS7A 1QHYA 1E4YA 5JZVA 2RGXA 1PZNA 4Q18A 1OE0A 4QGAA 2G9NA 3RS7A 2ANCA 4K81B 2BCGY 4L8GA 3P26A 1XEXB 3IGFA 5FUWA 4OJQA 3CZPA 3B7GA 2V54A 2VH5R 2EQBA 3MMPA 1CEEA 2F43A 3UXMA 4S35A 4JBWA 4W5JA 4ZDJA 1CR4A 3TBKA 1EWQA 5DE3A 3IBYA 3K9GA 3K0FB 3DM9B 2DFTA 1E94E 1SVSA 2Z43A 4M1SA 3NH9A 3KUCA 5CJ2A 3WP0A 3UMFA 1ZNWA 3C4JA 3LNCA 3WNCA 4G5GA 2ZM5A 2YOFA 2WJGA 1U8ZA 3AV0B 3WYFA 1XB2A 3ZLJA 3EWSA 3NIBA 2OBLA 2QZ4A 5AUQA 3GD7A 5IF9A 4UXIA 4G0NA 1F2TB 2JJ1D 3QKRB 3ZZUA 2WWGA 3B9PA 3I62A 1E0AA 1UKZA 2RKOA 3QKRA 4LDJA 2CNWD 2FGJA 5HPYB 4A0RA 1IAQA 3ICEA 4BRUA 4N1AA 3CLVA 4RFSA 3GJ5A 3SI7A 3U2QA 4TL7A 1OPXA 3VR3A 4B73A 1N3BA 4DXAA 4Y0VA 3REGA 4B71A 1ZU5A 3HYRA 2Q3MA 1XMSA 3NWJA 2JLVA 1KDTA 2X77A 4HI0E 1YR8A 1COWD 3G0HA 3WHLA 1KZGB 3QKSA 1NN5A 2G6BA 3CRVA 4A2PA 2P5TB 1J7KA 2E87A 4FMCF 3ZVLA 4LWZA 2IYQA 2NMVA 1P73A 1QDEA 3IO5A 3TAHA 4JYCA 4Q19A 1ESNA 2YJTD 3OHMA 2F1JA 3RNLA 4RD2A 2V6JA 5FTNA 3T34A 3EXAA 5TB5A 4BLRA 2ZRAA 2WJVA 5HR5A 3SN6A 4ESVA 4JLAA 5FOWA 2VSXA 4Q7JB 4QJ4A 5CIQA 2ASEA 4URVR 4Z8YA 4F38A 4LI0A 4AURA 2IW3A 2HT1A 3T35A 1AS3A 1P7CA 3GJ6A 4X8OA 2NPFA 3LVQE 1FP7A 4TTRA 1XF9A 4AKHA 1W2HA 1SVOA 5EZ5A 1PVOA 1QG4A 2ZRKA 3FDIA 1XCGB 4PHGA 4GDFA 4TYWA 3SNHA 4ACBA 1PUIA 2JIZA 1NVVR 5CK5A 2REBA 5AWFC 1GIAA 2VHQA 1ZINA 2QI9C 3B78A 4HLUC 2WJJA 4LK2A 2G88A 5H68A 2JATA 5KNCA 1P4SA 4URYR 2VA8A 2FZ4A 3SZRA 2IEZA 1P9WA 2FSGA 1ZIOA 1PLKA 4HUTA 4C3ZA 4BLQA 1XCMA 2PLRA 1KMHA 1R0YA 4DCSA 4PC2A 3ASZA 1F48A 5FOUA 2CK3D 3RS3A 4E09A 2ZIAA 2ZE7A 3IIMA 1FUUA 4XTRA 4ON9A 4ZDKA 2R8RA 3MWKA 3Q5EA 4OQFA 1OXVA 3NEJA 1Z2CA 4CYMA 3BB1A 1F3OA 4I1VA 4ARZB 1P61B 3CX7A 4OYHA 2XSZD 1U8YA 4DT1A 5TY0A 4BZPA 1N6IA 4ZI3A 3SC3A 2Z0MA 3I5XA 4XSHA 4YDSA 3ND9A 3VFDA 1U0HC 1XD2B 3T1VA 5F98A 1MH1A 2XNDA 4XD7D 3GLIB 1GKUB 1G9XA 4MA4A 4LSGA 3LAWA 4OQLA 1CULC 3ZQJA 1LB1B 4D82A 4EJSA 1ZNXA 4ZKDA 2C5LA 1G291 1N6LA 2A3RA 3IEUA 1G8HA 1N2CE 3IQWA 1TEXA 4JL5A 3VR4A 3I32A 1FMLA 4NCHA 1LVGA 1XU4A 1IN5A 4PPGA 1PUJA 3H0KA 5IRCD 3E1SA 1KYIA 1T3HA 3AH8A 2ZQ5A 4BWYA 2QGNA 3K0EA 4B44A 5A0FA 4BEJA 1DO0A 4DLRA 3PEUA 2PEYA 4IEEA 1X86B 3NKVA 4B6FA 3ZVRA 1EGAA 2RCNA 1MV5A 1N5LA 3GJ4A 2REXB 2Q3HA 4R2HA 3VHLB 221PA 3OFND 3PITA 1BS1A 3EIHA 2D06A 3EAQA 3NEYA 1OXUA 3QBTA 3W3AA 5CYPA 3RSOA 2QE7A 1XTQA 3THXB 1GTVA 3U4QA 3VMFA 1W36B 4LHYA 2C03A 2GBLA 2GK6A 2O8DB 2FE4A 1JPJA 1S3SA 2ZRDA 5SZHB 1X6VA 4V0OA 3ADDA 4BFZA 1DVRA 4J0QA 4B48A 1YVDA 1A2BA 4LBYA 2HXSA 5JMTA 3K0SA 1JNYA 2WIBA 4FIDA 3LBIA 1CR2A 1QHGA 1GSIA 4PTLA 2IX3A 3FHCB 3VX3A 1G3RA 2WVJA 5CJPA 2J87A 2WSSA 1H8HA 3L43A 4WIAA 5KNDA 1DG1G 1TQ4A 1OH6A 3MAAC 1QRAA 4OHWA 4NCIA 3RHFA 4IFEA 2A5FA 2ZS8A 3WBKA 1CR0A 3NG1A 1XD8A 5TVKA 4C0JA 1CF4A 1KI6B 2ZSEA 4Q4LA 1E4VA 4LJ7A 4TMZA 4LHWA 4UNNA 1FW6A 4B2IA 4E03A 4K8OA 1U0LA 1L4YA 3U4QB 4DSUA 3F8TA 5KSZA 2D7CA 1Q1QA 2FJUA 4HAZA 2VP5A 3F5FA 4BZQA 3QEOA 4IOKA 2QL6A 4V0NA 4BZXA 4A15A 2VP2A 4NE2A 1E1RD 3FHOA 3X2SA 4HZUB 1T9HA 4GI7A 2NGRA 1PLLA 5TDHA 4ILEA 1Z63A 1Q1ZA 1O87A 5H70A 1AZTA 1U98A 2ATVA 2LKDA 5G3ZA 1VCOA 1JR3E 5JEEA 4HB2A 2R6AA 4KVGA 4XVUA 2BV3A 1JR3D 3GLIE 3MRSA 2W83A 3SHWA 5UKDA 4OK5A 4BASA 5BN5A 1E1QD 1LF5A 3QF4B 3U3KA 4TLEA 3W34A 2FMXA 1F5NA 2IYTA 1T3SA 4A6XA 2IYRA 1CR1A 4OQMA 1TTTA 3AF0A 2NZJA 4C4PA 1G19A 2FH5B 3QXJA 1SVLA 4UNRA 1RC8A 4OI4A 2F1RA 1SKYB 4B3XA 4RD1A 4AG5A 1TNDA 2ANBA 3AF3A 1NMZA 4Q4JB 2CJWA 3EC2A 3K1JA 3NC1C 4CEJA 1ZMXA 1PLJA 4N0EA 4Z8XA 4EKDA 1DAHA 3W6PA 2OEPA 2ZJZA 4PAQA 1Q1EA 3GFOA 3PV0A 4Q21A 3WP1B 1QHHB 3QKUA 4KSCA 2P6RA 2ZU6A 3SBEA 4QXAA 3WNBA 1Q3TA 3CRW1 5KO2A 3BH6A 4NYJR 2Q9BA 2OBMA 4D0GA 5JFGA 1P2UA 3EA0A 1E9RA 2IEYA 5C4GB 2IWHA 3EA5A 3KTAB 3OEED 2HCBA 4I81A 1QVRA 3WRYC 4FWTA 1EX7A 1EXMA 1OT3A 4A0GA 5FUXA 4BFXA 3CB4A 4LPKA 2XZOA 2WWXA 4M53A 4ZCMA 2C77A 2IUSA 1E2EA 5LB4A 3BXZA 1S1CA 4JKYA 4C9BA 1I2DA 4Q66C 4RD4A 2O5VA 3AKDA 1JQLB 4WZBE 3B60A 2DWOA 2ZE6A 3A1UA 3CH5A 3UG7A 3K70C 3O47A 4KFTA 1QHNA 1IQPA 1N5JA 2ZE8A 4AYWA 1G7TA 4U7DA 2AFIE 4OHXA 4UXHA 3OIYA 5TXGA 4KBFA 2OT3B 3BB3A 3BFVA 4AK9A 2HYIC 1UKYA 1UFQA 2BM0A 1IXZA 1IHUA 1GRRA 4W5HA 5KSOA 5BN3A 1E2GA 2FPMA 2FDCA 2PZEA 1FX0A 5EXSA 4LYFA 2IYUA 3TUZC 3C41J
chains in the Genus database with same CATH superfamily
2W2MA 4F4JA 2Q6LA 1X15A 1WTAA 5AHXA 5H80A 5JQGB 4C3UA 2GRJA 3SYMA 5BSUA 5A2QA 2B61A 2NO9A 3IDZA 3ND5A 4RXUA 2YY6A 3UOWA 4TV9A 4EVSA 1TVKA 3CPEA 1GU7A 4G85A 5JVDB 3LLVA 2EW8A 1SVMA 3NC4A 5GZ6A 2NADA 1TM3E 5KNLA 4LE1A 2RONA 5EQJB 1IPHA 3H04A 1Z4LA 4BLTA 3DE3X 3GYGA 1SBCA 4D8YA 1ZH4A 1HI9A 1OXXK 1NTRA 4EO9A 1UP4A 1Z83A 4WOBA 3SDZA 3ZJVA 1NN0A 5ALFA 1AURA 2XQVA 1W4BA 3GEPA 4R8LA 5D1HA 3IJ5A 3ROEA 1JFLA 1NVWQ 1TQ2A 4PG8A 1TQDA 2CHVA 3PQ7A 2WJ6A 4UZFA 3ROGA 3V1LA 1DQSA 4G4GA 1V1JA 4IJMA 3BGOS 4FDUA 4IDCA 3RRXA 2H51A 4B6PA 5EEGA 5HTOA 1AHNA 3L07A 4JODA 1NRIA 2OUKA 2I55A 2FJPA 2O4UX 5ELXA 1YB2A 1CUBA 3E8MA 3H05A 4RL4A 3SICE 2P8JA 3ET5A 3FM9A 4CKWB 3H5RA 4UUAA 5C8XA 3OOSA 3W9SA 2V6IA 3DXXA 1XZBA 3FHLA 3R0XA 1N0VC 3DWGA 4PPFA 4PS0A 3DVQX 5AD1A 1ZRMA 1PR4A 4BN0A 4EX7A 3ZOKA 1U2DA 2IHYA 1IONA 2ZBGA 1HNZB 3S28A 3HY4A 3BIJA 4A82A 3ZZ0A 1C0LA 2QB5A 3PIRA 4RJTA 1NQUA 2VC2B 4B7UA 2PTHA 4Y1RA 4AIIA 5EESA 1PUXA 3RJ9A 2QHXA 2YZ7A 4F6RA 1Q3KA 1QHIA 1I3CA 4Q3DA 1N3LA 1E6CA 3OD5A 4XE5A 5BQOA 4CN9A 2OV8A 1HTWA 5IKPA 3VOBA 3WK8A 1L1EA 5G0UA 2FWAA 3PC8A 4IL5A 1DWUA 4Y8VA 5JSQA 5E3JA 1PNQA 2H65A 3SVLA 1Q17A 3FWNA 4LJ8A 4ZQEA 5HQ3B 4PRKA 1N2XA 2IU3A 3QSYA 2OORA 2BH2A 2PS9A 4DLAA 4MDEA 5JTUA 3T0FA 5FNZA 3ZTTA 4EMTA 2YDXA 3K4QA 1VE3A 2QW0X 2RH8A 3UKJA 2IHNA 2R47A 3HN6A 3LT0A 4LOIA 3VR6A 4B47A 2CLIB 5CVVA 3PPVA 3DZDA 1TQHA 2FLVA 4HYQA 1HWYA 1CHNA 2ICAA 4PNEA 3S2EA 3U3ZA 5ED4A 3LW8A 3E9NA 3LHIA 2PUFA 3JVIA 1YZHA 2FY8A 2I54A 3G2PA 4QNMA 5DBIA 4K1XA 1UEXC 2IYNA 3M4XA 3P32A 4Q7KA 4UMEA 4BO3A 3FWHA 3JD1A 2WHPB 2QX6A 1YUNA 4BAZA 2R0QC 4R81A 2CV2A 5CEJA 2WR8A 1VMDA 3DWFA 2FETA 1PYGA 1G17A 1ZG3A 3S2UA 1DE0A 3CM0A 5DGXA 1KDVA 4C6HA 3TECE 3LBHA 2Q29A 3KVYA 3VMMA 5JZMA 2QQ5A 3KHSA 1DLIA 1IDOA 1EVJA 1QF9A 1R0XA 1TU3A 2ORVA 2YNMC 3A3NA 3LY8A 1U1GA 1ZI6A 2H7YA 2ZJOA 3OVMA 2D4AA 4NMLA 5KOJA 4BPBA 2KBEA 2Q5IA 2X0JA 5AXCA 2H1OA 4M88A 2JI6A 2Z1DA 3BF7A 2FJ0A 5TT1A 2EP5A 1VKJA 3ESRA 2M2IA 3NZEA 5COQA 1PL8A 2ZYDA 1JDPA 5FWDA 4WE3A 5A9RA 5EIXA 4ARCA 3CB2A 3K96A 3T1OA 1FYXA 4X63A 5FQOA 5BUZA 4GYWA 4WZBA 3UFXA 3OZRA 3RC8A 2WZBA 3HCAA 2BEUA 1N77A 2QRJA 1NVEA 2BFDB 5EQTA 1K6XA 3TX6A 4YP5A 2TS1A 3AILA 4YT5A 5I8PA 4HXEB 3OJ0A 1CR6A 5IASA 1RAEA 4HQFA 2PX4A 3EXHC 1OFUX 2E6UX 2HNKA 2OK8A 1ULHA 2YFQA 4ZEWA 1KOLA 1NLUA 4WV3A 1FJ2A 5TMBA 4Q16A 3T12A 3HPRA 2GO7A 3PWKA 3B38A 1GTMA 3BWXA 3F7NA 3EIEA 3QXCA 4BQEA 3RAGA 4AO6A 4CKWA 4PZAA 1CUYA 1I0IA 3SS7X 1RNLA 5HDBB 2IDJA 2ZAOA 3KFXA 5TARA 5JXIA 3L41A 4RSHA 3GFGA 3T54A 2UDPA 1HT1E 1Y80A 4D8TA 3DEHA 3SBDA 1TUIA 4HC4A 4JC4A 3W2TA 4ZYLA 1G6Q1 2YC4C 3H9CA 2CYAA 2PKEA 1JH9A 1T5SA 2G7ZA 3QUSA 4LJKA 4BQSA 3QA9A 1U7XA 2PUHA 5GZ1A 3IEVA 1JBEA 1SBTA 3I6MA 1TZCA 1P62B 4UTNA 2PD4A 5F9HA 5TF4A 1U7ZA 5TMDA 4ACAA 4KHZA 1Z7EA 1EYZA 3FPGA 1NUTA 1UT6A 3WK9A 1VXOA 3A26A 2GM9A 4YCBA 1YJ5A 3GBVA 3DAPA 1GPBA 3Q72A 4RTSA 2P6NA 1S96A 3TQHA 2ZR0A 1OXKB 3CVJA 3KKQA 1K3UB 1QTIA 2CNWA 3M34A 4TXHA 4DCTA 1JEDA 3RPEA 3MWGA 3WSVA 3QJGA 2HK8A 4OXYA 4GC5A 1THZA 2GBFA 2NAFA 2VG8A 4CKCB 1NYQA 2X9NA 3FPAA 3C39A 3DF7A 3WGQA 3JR3A 4ENRA 1JIUA 3VR3D 3B9QA 3LX8A 1DHRA 1C7JA 1GU1A 1Y5MA 4KN8A 1CW2B 1K92A 2EC5A 1H2EA 3AW9A 3A3PA 3JSXA 4H1WA 2G5GX 1Y1LA 2J45A 3EIOA 2IBMA 1IZ0A 1YU9A 1J5EB 1ISMA 1GR1A 5GJBA 5A02A 3TSAA 4Z54A 1CY0A 3D3EA 5BSVA 1Z13A 3FNGA 4K86A 3FMFA 2H06A 3I2HA 1VE7A 1Z73A 3JQFA 3KYCA 4QULA 4RDHA 5JEDA 1VHWA 2AFRA 2WEKA 2BE7A 4ZVSA 1I24A 4OYRA 1FYVA 4HP8A 1ELOA 5HF5A 2ACWA 2V6FA 4H6VA 1YJCA 3OBIA 5CDFE 2J0SA 3JSAA 4IHJF 3TIFA 2IPNA 3CS3A 1KK2A 3PHCA 2HNBA 4XDYA 4IZ6A 1Q7RA 2B94A 3IMFA 4JKOA 1VHQA 1KZ1A 4NKRA 1U2EA 4HQ6A 3O2QB 3V1MA 2ERXA 4OLJA 4UM7A 1BX3A 3IIKA 3KPVA 3QSGA 4HNQA 1KTIA 2QJRA 2FZKA 2OC4A 1L0BA 3IALA 3BGSA 4NMWA 1M6YA 5EFOA 1K0UA 2WG0A 5HUQA 3PVZA 4HS4A 1TF7A 1HKUA 3GLHB 1QIKA 2C59A 2MSLA 3CWZA 3OQPA 1B2RA 3UK7A 5AW4A 4UJ3A 4WKPA 3VQTA 3K70D 1NVAA 4QYIB 4S1NA 5A05A 2HQRA 5K7SA 4ZOAA 2OESA 3GGJA 1ZONA 3RRNA 4MQFB 3QPWA 4L4YA 1QIMA 2XNCA 2VA9A 1XDBA 3WO1A 3WGVA 3W1EA 2ZLBA 1N0WA 4UMFA 3K8YA 1KNXA 2FPIB 1H93A 1GGMA 2J8ZA 3KR9A 4MQUA 4RHEA 4HD8A 1XPRA 3NWEA 3IHLA 5C5EA 5AVUA 1U0RA 2VXYA 1WXEA 1RYZA 3KU4A 1IM2A 4KIFA 3NV9A 1WWKA 4M0DA 1RSZA 4QFDA 4CMEC 2R97A 4EJMA 2JCVA 5HW0A 1DX9A 3JQ8B 2A35A 1GSOA 2ZRNA 3OCVA 1FY2A 4LJ9A 3M5CA 4KQ1A 4MV4A 3SYNA 4CVNA 1X1AA 1O58A 1BFUA 1DIGA 2OY0A 3VYVA 1G66A 2BHSA 1PWHA 2F9LA 3N86A 4P5EA 5CDTA 4H4CA 4YDQA 3EZXA 3NFRA 3ODGA 3C8ZA 4X1IB 5AR1A 4N47A 4BFTA 1Y6JA 2C2KA 2OXTA 3RRZA 1ZK2A 2CE2X 3NO4A 4YJ2B 1OYVA 2AQHA 1BIFA 3ABOB 2CY0A 2BR5A 4WUVA 4LWQA 5EIOA 1HE2A 1W5TA 2BTEA 1AUOA 4DBVO 4NG4A 5CH3A 5K8IA 2NTJA 5AW8A 1SUAA 3VPCA 3VR4H 3X1ZA 1FDOA 3D5EA 3F96A 2O05A 3WLSA 1WZUA 5EJ8A 1G4HA 4QNRA 5J5VA 4C4OA 2RGRA 2IS4A 2PCLA 2L0XA 3CUTA 1O97D 3NEAA 5HA5A 3TD9A 2EXXA 1DBWA 1CY1A 2C95A 1Q84A 2NTYC 3S40A 4YVFA 4YYEA 1Q1AA 4FKMA 2QN7A 3DZIA 1UWCA 1CVIA 1P1JA 1JU9A 3WZMA 4HDSB 1JT9A 3Q3JB 1E64A 3UYLA 1H22A 4HYTA 1J25A 4DKJA 2P30A 5K0EA 1SN7A 2WWYA 3OESA 3N07A 3IEPA 5ILGA 1JI3A 1Q92A 2RJOA 1YHYA 3CPJB 3E7DA 1QM5A 3ROZA 3SHQA 3ZDAA 1XDUA 1TIPA 4J0IA 1KP3A 2PV7A 4IR7A 4I3HA 3ZHCA 3E3OA 3H16A 3B82A 3NHFA 1JHOA 4YJKA 3DR3A 2H4XA 5AKGA 3EF0A 3RUDA 1IULA 4K40A 2RJNA 1ZIYA 4MRMB 1KY2A 4O8CA 4ETNA 3R9WA 2VK1A 2IYYA 1EDDA 3PHBE 1NC3A 2BVNA 2Y2VA 3A4YA 3OE4A 3I05A 3LC1O 4ZI2A 1SZJG 2FK8A 2Y1EA 4IIDA 3J81k 1QGED 3NS7A 2DHQA 3C3KA 4FONA 3HL4A 1PZHA 5GWXA 3GUUA 3KD2A 2WAXA 1CJMA 1FFAA 2C2YA 4N5DA 4TQ9A 2QYHA 3JAMA 3CRQA 3F8SA 4Z4HA 3Q1LA 4GMFA 1RJEA 5F2KA 4EF5A 3TKYA 2X8BA 4G89A 2PL3A 2BBSA 3ESXA 1LJLA 1LLQA 2Z9CA 5A5DA 3FVRA 5JSHA 4MDFA 3UMCA 1CZNA 2W2XA 1ULSA 3T3DA 4BOYA 5LOVB 1ITZA 2R1VA 1SHTX 3RSZA 4AN0A 3UC5A 3L7AA 1ZH2A 3SX0A 16PKA 5LP6C 2KHZA 1K63A 1XN1A 2ZIUB 3PTLA 2ATXA 5TLSA 6NULA 3RNOA 1II0A 2O06A 4XIJA 4DEYA 1EIWA 3FCYA 3NDBB 4GG1A 1TMYA 3GNQA 3UHJA 3QM1A 1JECA 3IVCA 1T9AA 2ISCA 2IYLD 2XVXA 3A1DA 3C5EA 3HRKA 3ORSA 4DILA 1BMFD 4YPOA 1V5WA 1VJ5A 1MPTA 3FUCA 3R6WA 4TRMA 5KTMA 4KQ2A 2QR2A 2XUGA 3A27A 4L5YA 3N2GA 4GYYA 4RH1A 1SCUB 3V34A 1Y8RB 4I4IA 4GIBA 1Y5RA 1NVKA 4JITA 4EB8A 3Q6MA 3COYA 2XNDD 2NX2A 3O03A 2QMYA 4RZXA 3N3AC 1XJQA 1GUBA 2F3RA 1WVMA 3HABA 1S6YA 4JNKA 4ZAFA 3TRIA 4AJKA 3VJLA 1JFFB 3LMKA 4NJEA 1CQZA 1RYDA 3T0IA 1DJOA 3HBAA 3L1UA 4UE6A 2I8CA 2Z5VA 5EMJA 3B6IA 4PHFA 1NI4A 2Z95A 3VU8A 2HR1A 3NRCA 1UBFA 4GEGA 4INJA 4QPCA 4IIHA 3TZ6A 1JHUA 1W59A 2PS1A 2AEEA 4RM2A 4Z4QA 4GP6A 1MO4A 3W5JA 1OFIA 2XKAA 5EJ5A 1KQFA 2JZNA 1OIXA 5TPZD 3IVAA 3CGWA 3F3YA 3L8DA 4ZZ3A 1RP1A 1BKYA 1CD5A 1E79D 1SD2A 2HM7A 4OGLA 4O3MA 1LI4A 4B3GA 1TAGA 2E85A 2PD6A 3H1TA 2H17A 4POAA 3CZ5A 1CP3A 5BQPA 3U49A 4W5TA 1T9GS 1Z0FA 4R8KA 1QG2A 2KSQA 4PLPA 1AIPA 5ESDA 2VF4X 3UB4A 5HK9A 1SUFA 5IZCA 5CGQB 4BCCA 2PX8A 2XEXA 3PEYA 2VJCA 1L5SA 5BUQA 3FYUB 4B3DA 5H7XA 4DLPA 1DPGA 3U7EB 4O4LB 2CLSA 4MW5A 3ZN2A 5IK2A 2JFVA 4NFLA 3M1IA 1GXSB 2DH5A 1QAQA 1ACMA 3K1YA 4EB6B 3MCZA 1X0VA 1YZYA 4QZVA 1GO2A 1KH1A 1Z88A 1TLFA 5CM9C 1B43A 4KFCA 3PQ3A 2LCFA 3NBKA 3AHGA 4FOTA 2RGCA 1UBUS 2VDPB 3OHPA 3SYLA 4EELA 1R6UA 3GVIA 1IU9A 2ZSAA 3FPSA 3HZRA 1PKEA 1ZNYA 4XJTA 3M6MD 4BGVA 4HB0A 2O1XA 4JEUA 4KO8A 5DM0A 3RU2A 3JWJA 1U8EA 2YWHA 4FI3F 2VDJA 2VT3A 4TWAA 4XAQA 3AFOA 2FGKA 4QU8A 5IT4A 2J32A 4GWGA 2FN9A 3HCFA 1U7DA 4OFWA 5A1JA 4Q15A 5B3JA 3AGPA 2O3RA 1N9GA 3AVWA 3FZQA 3CF4G 3M49A 3V00A 3TWOA 5CH8A 5HF8A 3JTMA 1EG2A 1DCFA 4TTPA 2CLCX 5GOTA 3OU6A 2BI7A 4Z9BA 1XZGA 5AVXA 1AD2A 3PR2B 3QFTA 1CJUC 4IUYA 4WXRA 5I9MA 5LPNA 4QUIA 3WLJA 2QKYA 5DJ5A 1RM3A 5HGXA 1OR8A 3SIXA 2Z6UA 4ALMA 1A95A 3WRVA 4D81A 4U7HA 1NKTA 3AHDA 6GPBA 1DNPA 3D9QX 4Q1VA 2H54A 2WSYB 2Y9MB 3GJ8A 2XYQA 3F67A 3I8SA 3NATA 2VEDA 4P4UA 1RQ7A 2QLNA 1WRBA 1ONOA 2X40A 3K09C 3KDSE 3S70A 4YACA 3WIDA 1ZKMA 3TO5A 1WD5A 4BJ5A 4A0HA 4TL9A 3RVNA 4Q9KA 3UJAA 3EGWA 1F7VA 5EC8A 1XEXA 1ZZGA 2PMBA 4TZTA 2HYDA 3G89A 1Z0AA 3I3OA 1TGVA 5AK0A 1H0KA 5KX5A 5KPJA 2MSKA 3ZK9A 2MJLA 3JASA 2BEUB 1KHHA 1RI2A 3N05A 2PO7A 5A6SB 2BSXA 4K7JA 1P0FA 3LUHA 4L0DA 4N9WA 5KOHB 3G8YA 2XNSA 5EIBC 2PBFA 1JJFA 4BVGA 4BV8A 2LUOA 5B4TA 2FZLA 4LXHA 4F5ZA 3PXUA 2IPAB 3GG2A 4MWSA 4R0NA 5KUTA 3FJOA 4MR8B 3FI0A 3OT4A 2PZKA 3F6PA 4HNHA 2AQIA 5AI5A 3BERA 4CDNA 1GOTA 2PMWB 4QUBA 4XDZA 3S44A 2XR1A 5AJUA 2GKOA 3E53A 5E1DA 2PD3A 2WJHA 2QPOA 1JAXA 1VYVA 1W94A 2Q1XA 3BAFA 5C5CA 2ZBVA 1DEKA 1B0ZA 1YKFA 3I3SR 4QU0A 1GL7A 2G36A 1KAMA 2YQZA 2W98A 5EYPB 2HCTA 3VSBA 1AV7A 4UKDA 3WGMA 1KMCA 4ARIA 2OFPA 1D1QA 1W5SA 1ZEJA 3GEDA 1VIYA 5FBLB 3V5NA 5C7OO 3LOUA 3VUEA 3Q7IA 1JDJA 3RU9A 1ZXBA 3D6FA 4HX2A 1SQ0A 1I3KA 2HFJA 4H4DA 2C04A 2IK8A 3F71A 4WASA 2RH4A 2XLBA 1KC3A 5L3RA 4GPEA 4OQXA 1X77A 3UAXA 4IH9A 2NZ8A 4N7RA 4KRFA 3BGWA 3KFLA 1JG7A 1YBHA 4M21A 1ZM4A 1EK2A 1ST2A 3BMNB 4U2BA 3U7HB 2VRCA 3BMQB 4H1HA 5JH7A 5REQB 5C32A 1EE1A 3L8GA 4DYHA 5J58A 3FAKA 4QDKA 4QOEA 1GM5A 3C15C 2ZDGA 1KEZA 1E3MA 1DAMA 2XZPA 3MELA 1PWYE 3NHUA 2Q49A 5EYPA 1ZD5A 4MVJM 5FLKA 4ZVQA 1EA7A 2XSZA 1DRVA 4G9GA 4IGFA 3BH7A 1B6SA 3E7XA 1JR2A 1V5FA 4NZNA 1U0TA 5AI0A 2XKBA 3TDNA 4E6PA 1AUPA 1TVEA 5T6BA 1WEHA 3FWYA 3OZXA 4HWPA 5FUQA 4DLLA 2GBCA 3K8OE 3N0VA 4BB5A 2GI4A 1MAWA 4LS3A 4RKEA 1SU6A 3MINB 4OU4A 2GGSA 2J41A 1MT0A 2CHQA 3CUEF 1F6DA 3TW6A 1T3ZA 1VIAA 2DC1A 1Y1QA 2AWNA 4V3BA 4B3JA 2CMKA 3OTGA 1JFFA 2B1JA 1Y33E 1QCDA 2W0SA 2PLWA 2W43A 2Z1NA 5D7BA 1JKMA 2Q62A 4DDVA 2GXAA 1F0KA 1ZXLA 4BIIA 1OXTA 1VJRA 3HKCA 2P90A 3KKMA 1RHQA 1LBTA 2ZRHA 3IP8A 4GW3A 3NIWA 4KWIA 1Z08A 4D99A 1B8VA 2D2XA 2REOA 4US2R 5JANA 3EZ6A 1VKOA 5G4KB 5GADl 1O6FA 3OQJA 1RW4A 2IDMA 3PRJA 4KIWA 1CJKC 1R4NB 1RMTA 4W8OA 3HJRA 2P2ZA 1C4XA 2HZ7A 3C3YA 4RF2A 4CL2A 5IDQA 3B36A 2ZI3A 3FZYA 4GI5A 4QARA 3NRJA 3FOFC 2XCUA 1JXMA 2YXDA 3OIUA 1M6NA 4MRPA 4K9NA 2CYCA 2NSLA 4KDRA 2IUFA 3JATB 4EGAA 4HX9A 5HMMA 1JG2A 3IQXA 3RHTA 1L4NA 4L5IA 5H16A 3UKDA 4DV5B 1K27A 1A76A 2OKGA 3MRVA 3GLGA 4WNYA 4JI8B 4XCVA 1KEPA 1Y6QA 2I7TA 4H1VA 4JI3B 2YDYA 3VZPA 1NRXA 3K4PA 2O20A 1UPFA 2P27A 2QUZA 1FSSA 4P7KA 3H0EA 2E0IA 4BLUA 3P19A 4ZOBA 2O0LA 5CURA 3U26A 1KZYC 3F97A 2A94A 2FOLA 1QVVA 4ND2A 4HATA 4NDNE 3HBMA 4EGJA 1D1PA 3E1GA 1V8BA 3BZUA 1M6VA 2G08A 2QR3A 1U9IC 3CH4B 3L7LA 2FDXA 5CB6A 3QU9A 5GONA 3ZXSA 5F78A 5LZ4A 4NARA 1GPNA 4Q9AA 4KIJA 1MRNA 3KAKA 4YRNA 5HIJA 1P19A 1UPAA 2QVXX 1GPJA 2CC2A 3L6RA 4QQ8A 4RF3A 3U37A 5FLXA 1LEHA 1U3WA 1ZIXA 4B4VA 1HUQA 5HVNA 2UVDA 2OHFA 3C6MA 1NN1A 2OV2A 1ZK3A 3ADOA 2IIPA 5E4JA 3OTHA 5I01A 2O3JA 1RI5A 4HR7A 1UKCA 4I8DA 1XVVA 3FTPA 1UEIA 5DNDA 4JROA 4QJIA 3VYUB 3U3DA 5DN6A 3KR0A 3OLCX 3G5UA 3OP4A 2E2WA 3ESQA 4P54A 1PV4A 2WJ4A 3AHCA 2XVZA 3OQNA 1XZJA 3IQFA 1EP2B 2GTIA 1P5JA 3QY9A 4XJSA 4R69A 2K2WA 4XGIA 2R2GA 1KO7A 3FNIA 3I76A 3VJKA 2GKGA 2VTBA 4J1SA 4HQRA 2ACKA 2FW9A 3F5QA 5A62A 4ZVVA 3E84A 4WECA 1EMDA 2B98A 1Z4PX 2L2QA 2YVLA 4EENA 1ZM2A 4OSOA 8ATCA 2FOXA 5F33A 1BCSB 2KYRA 2Z56A 3PFFA 4PPYA 4XTCS 3VISA 3LM8A 4ZAWA 4KR6A 4L95C 3RVDA 2O2YA 1UP7A 1XTUA 3GJXC 3HSKA 4FVTA 4KSBA 4AUNA 2CGEA 2EJBA 4XARA 5FBHA 3AESB 2BZ0A 4RFVA 1FTYA 4HKTA 3X1DA 1NDUA 4TN1A 3CVWA 4IXMA 3MT8A 1C30B 2ZYSA 3T7EA 3BRCA 4H6XA 5A6SA 2EX1A 2BFWA 1HEYA 3L8ZA 2K5UA 4EG7A 5AJVB 2EVWX 3BFKA 2HMUA 2ZUVA 2CUTA 3GFRA 4D41A 4AP9A 1JFRA 2QMOA 1QHFA 3DCYA 4PLWA 5TEWA 1DZ3A 2WJZB 4LPSA 4UNSA 1P1FA 4C30A 4CETA 1KRXA 1NMQA 1RCUA 2CXSA 4M0PA 4NZYA 4UTXA 1RWBA 2WFZA 5HFAA 3TTWA 3WGLA 4CQMA 5CXQA 1GJRA 1QH0A 1OKKD 1KZ4A 2EBUA 4U4AA 3RU3A 3TUJC 3SG0A 4DPMA 5KTOA 2ID9A 3DEYX 5EXTA 2X9GA 4GO1A 4DWVA 1Y1TA 3KCNA 1NSFA 4M36A 1ZUIA 2XQKA 1T6BY 1JLRA 3B3AA 1WB4A 2P1ZA 4YMTA 2OPBA 3MTJA 2ZI6A 2B3DA 4OGFA 3L8HA 1UZAA 1WSBA 4LY3A 4MKFA 4NEQA 4RZ2A 4TL6A 2VHCA 2XMPA 4E3WA 1VLZA 5AESA 3DLBA 3GOHA 2OXCA 3EPJA 2WUVA 3PQ8A 2LBPA 3EZ9A 3IUYA 2G1JA 4KBYA 4MW7A 4TN5A 4BMNA 2XUKA 1XO1A 1JDSA 1M2HA 1FQWA 1OV6A 3DTVB 4CU5A 3N8KA 4L9WA 4DABA 3K9LA 3TR6A 3GIDA 2Y0EA 3L1VA 3R7SA 4QGHA 1RQXA 4R5MA 1V6SA 1IZ7A 5IT9A 4WY8A 2H59A 3OF3A 4HLCA 4LXYA 1OH8A 1ZY2A 1O4VA 3RV3A 3O4RA 1J8QA 1H9AA 3E4DA 3OECA 2D1YA 2VSOA 5LVAA 1JYSA 1EE9A 3GUVA 5E9JA 1HX7A 3AEXA 3EJWA 3MFQA 3HI4A 4TV9F 4S1TA 1EP9A 3LV8A 1C2TA 2ORIA 4DQKA 1SUEA 2ZZKA 3OFJA 5JDCA 2D5AA 2PMFA 5A4JA 5JV5A 2ECOA 1DRKA 3USES 5CFQA 2IELA 5KBYA 4JUIA 4Y2JA 5FA5A 4BE9A 1NDHA 2H0QA 4G1MB 4RVCA 3R7DA 1ONPA 1G38A 4MJXA 2WINI 2R48A 1V45E 1YRLA 1QZZA 4ER5A 2IS6A 1V41E 2W6ZA 1P1KA 3WC4A 4Y6RA 3SYTA 3OEYA 3REOA 3RGWS 1YVUA 4KVAA 4AYTA 4MRSA 3PRKE 1U1CA 5TJHA 3TXYA 3TLGA 3LRPA 1WZCA 4TYQA 4GECA 5IUKC 4E2WA 2CJWB 2E5LB 2E55A 3NW9A 4OPMA 5AOBA 3PJFA 1QQTA 3IBTA 5DU2A 2AV6A 2VLIA 4LJ4A 2EP8A 2CL6X 1U1EA 4B32A 1J0CA 4MUNA 4HVLA 3O8NA 1AF4A 2CB9A 3RT7A 2JGAA 2RGNA 4M4SA 3IESA 1HFJA 2EZUA 2VNSA 1NE2A 2CBGA 3OCYA 2OXRA 2V98A 3SLKA 3HCDA 2C0QA 5DEIA 2OQVA 5FIUA 2NTVA 1BW9B 5CGZA 2CXOA 1KJZA 4MHTA 2FQWA 4P86A 3ZGLA 1RYBA 4DJJA 4LGVA 2FRXA 1DI0A 3WIUA 1O94A 1XPJA 4RHFA 1C1XB 1NR1A 3KLBA 4DW8A 5L51A 1QU2A 3L1HA 2ZIGA 5EZQA 1XU7A 2DECA 2NAPA 2VATA 3DCNA 3QWIA 4BATA 3ZY3A 4EW6A 3NKFA 2ZYUX 1J49A 3KYBA 2GUWA 1MGPA 4IXWA 2DFKB 4Q01A 4RZSA 4TLDA 2EBWA 3PJGA 1E6KA 2MT9A 1ULAA 4G8JA 4D92A 1DGQA 1FSGA 1D7OA 4PZPA 3VV2A 1GQSA 5JCZA 3F49S 3AW8A 2XGSA 4QHSA 4B3CA 1PL7A 4XYGA 5JQGF 5AOCA 4W1QA 5D5HA 4EATA 1V7CA 2CT8A 4I46A 1L7DA 4X3OA 2W8ZA 5TPZA 4OJMX 4RMNA 4F1KA 5DNYB 4H7PA 2XOKD 1IN7A 2HKIA 3ED1A 4DDKA 1UM8A 4GXNA 1XK6A 2R6HA 3E9RA 3E3LA 3PKZA 2IY7A 1Y4DE 4G2NA 1XELA 2PG3A 3ZGYA 4YRGA 4FMCB 5CFZA 1J8FA 1PG0A 4QPNA 2HMWA 2VWPA 2P69A 1N5DA 4Q9LA 5JIBA 5BXYA 4LMBA 4OLBA 4IGAA 2V65A 4QKQA 5IT0A 3QW4B 4EAAA 1RYFA 4RO0A 2DJIA 1KDRA 2X8JB 3BH0A 1TZJA 4U2GA 4YMVA 1L4EA 2RH5A 3NOOA 4CG0A 1N2EA 1T43A 2QTBA 1EFKA 2XB9A 1FDUA 4ZVTA 4FHGA 4Q24A 1EX1A 4BHTA 1UBCA 4F56A 2BKUA 4MPJA 2CUZA 2Z30A 5HHTA 5BYBA 1NW6A 3O95A 3GHYA 4IHJA 4INZA 2IV2X 3E8SA 1OH5A 1XDWA 4XOIA 2P7HA 3OZBA 3GIWA 4DDMA 1Z0KA 1Y5LA 5GM1A 4D9BA 5I9BA 3DMTA 3Q9UA 4Q1DA 1PJZA 2C99A 1G6OA 2HHJA 5JQGA 2P75A 1CZUA 4FB5A 1T4GA 3JRXA 3B2QA 3BIXA 3DDHA 1MRSA 4L8YA 1B7GO 5IC6A 4D97A 2UZ4A 5E2BA 3H5AA 2IUUA 5BR1A 4E2XA 5EMLA 3ROKA 1SHKA 1Z8NA 1E3LA 3C5VA 3W9YA 4WRRA 3AFHA 1QFXA 2IZ7A 2QW1A 4FNOA 4OF4A 2FF5A 3L1IA 5G41A 1V8DA 2ETXA 5LR6A 4AX8A 2VJMB 4B4OA 2PKCA 3IAS6 4L8LA 5DTMA 2PPLA 1YJQA 2OCPA 1N6NA 1UC8A 1Z39A 2FFHA 2GNOA 3NBAA 5COAA 3MWJA 4DC9A 2WMYA 1IOVA 1Z6QA 2OCAA 2CCKA 2F4NA 1SBHA 1MNAA 2E4AA 2NWQA 2QZJA 3ADKA 3ADCA 5IHPA 3O74A 3DE6X 1YJBA 3JD0A 3CVYA 3E3AA 2AX4A 3GPIA 4BJHB 1EZ4A 3HN7A 2EGGA 1RWNA 2Q9UA 2ZKLA 4PFQA 5KYVA 3D4PA 4JI6B 1PJTA 2C5GA 1SHZA 3ELDA 3HJGA 4HDRA 4TUYF 5EFZA 4B31A 2H52A 4QIHA 4DR4B 3BHIA 4M0EA 1U4SA 2C82A 3P2JA 5C8YF 2HA5A 5IEJA 2Q28A 2X5NA 3IEXA 3ACCA 4MI1A 3WLMA 4EMUA 5J4HA 2K2QB 5DX8A 3WFZA 3C7TA 3OEEA 3SVZA 4TLBA 2C00A 1JW9B 4ZHQB 2J07A 3DPIA 1WKBA 3L4JA 1CU1A 1OY1A 1OQAA 5IAEA 4C76A 3MB8A 4PAMA 3UN1A 5A0TA 2HHHB 5CFPA 2PUEA 1XALA 4RVGA 1NQWA 3HDVA 1QJ4A 2BGWA 4UZSA 3GU3A 1J0BA 1P7WA 2NUBA 2C3UA 4BLSA 1KARA 4HDNA 3VDQA 4RPIA 3GRVA 3R4CA 1GL3A 2HO4A 3I6BA 5AM2A 3H97A 3K15A 3PHLA 2J3DA 2VHZA 3HKBB 1Z4OA 5TX7A 3NXSA 2AUTA 4RIHA 1SCJA 1IZYA 4TZ6A 1AKUA 1C4OA 2DFPA 4JB8A 4Q3CA 3RVJA 1QDLB 2W2LD 2KQUA 2D8MA 3EUAA 4JKIA 4MW0A 3I6ZA 2JL1A 4KXWA 1KP2A 5FBKA 3BXHA 4PYMA 4RM3A 2BGTA 1Q77A 5G40A 3VKFA 3R9KA 4EYKA 3EY9A 5CXUA 3GHHA 4CM9D 2I6UA 5KDDA 3GX1A 3K8QA 2MSWA 3DE7X 3E5HA 4LHZA 4YJFB 3WNVA 1TIKA 1W1UA 3IDQA 1U1FA 3O1IC 4N82A 3DHNA 1ZJ5A 1U99A 4MWZA 5DW3A 2JIPA 4P82A 1GU0A 2B3TA 3M33A 3T7AA 5EUMA 3B48A 2H2AA 2Q8PA 5BN4B 4EKGA 4M22A 4BO9A 2X9VA 4G1CA 5DBGA 3UENA 2OKCA 3UJCA 5C7IO 2M32A 1ENYA 2NUAA 4E2ZA 1Z47A 1C8KA 1HBJA 2QLLA 2X0NA 4UHBA 2XRZA 2WWIA 4HHEA 2XA2A 3UAGA 2CLHB 1XUOA 2VDQB 4JASB 3ANYB 1KU6A 3T9AA 4M9XA 1ANKA 1C14A 2MIIA 2QIPA 4CKBB 3ANNA 2W90A 4FTWA 3UFBA 2O8CB 5JJLA 3E70C 2QM7A 4BP9A 4EO4A 3CRRA 3KPYA 3F4KA 4G24A 4OJYA 4QYTA 3SEZA 3SQMA 5BV8A 1HLGA 4FQ5A 2FUG1 3DYVA 3PUVA 4NP6A 3TRKA 3KWFA 2DQSA 3IBCA 3KKLA 5JI2E 1E96A 1FJGB 2A2ZA 1OGJA 2BEVA 1Z07A 2C9CA 2Q3LA 3AU8A 3E6AA 2MYTA 3EVNA 1EHIA 4NFHA 1GGNA 2FG7C 1F8YA 1Y1PA 5CLLA 4MCHA 1PZMA 4K2AA 121PA 1SO8A 3LKBA 4UUOA 3TH5A 4MHSA 1Z5UA 1R5NA 2OBNA 5JZSA 4BLOA 5FNVA 4WBNF 2PGOA 1XN4A 1E1NA 2G06A 3JWHA 5CW1A 3UJ3X 1JA9A 2BFDA 3KPUA 1D8AA 3ZNNA 2WG1A 2F1IA 4CMBA 2FWBA 1FRQA 5ITVA 4OJKA 5HUHA 3C45A 4LOLA 3RVRA 1KI4A 1U02A 2VNIA 3EGDB 4C4TA 4EW2A 4C0QC 1B42A 3CKLA 4AFNA 4BVLA 2VXOA 3U7FB 2OWEA 5KYWB 3R41A 2R62A 3PC6A 3RTEA 3SF0A 4WFIA 4G5OA 3OFKA 2JLBA 1FFWA 4PAWA 4WSOA 1MR3F 4GNRA 1BG6A 3DW1X 1O6BA 5ED0A 3SSMA 5JCXA 1MW8X 1QLJA 2C7PA 2WC1A 5KINB 2DB3A 3WGYA 4PAOA 1Z28A 4I8XA 2OHVA 4I3GA 3LQFA 4YRRA 4B75A 2C4TA 4G3XA 3RSQA 5JBIA 2Q27A 4A8JB 3UK2A 3KJIA 4KXMA 4N7JA 2IP1A 4YMHA 5H1YA 4D3ZA 1G8SA 3SJCA 3O1JC 1M8FA 9ABPA 4JYZA 4OK6A 2I80A 3KTOA 3RRFA 4PZUA 5BQXA 1C3OB 1N9GB 4HZIA 5F2EA 4TTVA 4AS3A 1FS6A 2I99A 3OHSX 3PR1A 4M37A 1JVSA 1GZ3A 4X6YA 1Y6FA 4EPVA 4E4RA 1EDBA 3PHIA 4FKBA 1CUWA 4AJ4A 4MB0A 1BXRB 5DYNA 2XXAB 2JH8A 4EY8A 1QPZA 1LWNA 2WJ3A 2XGOA 3ZEAA 4UTVA 1EUDA 4BRZA 5P8WA 5J4VA 5T8KC 2HPAA 4KXVA 1DUSA 1XBTA 4PANA 4G01B 4WX2B 4HT3B 4WZAB 2GARA 2PK3A 2G76A 3SXUB 3DWIA 4Q1AA 3TQQA 4X64B 5BV7A 4RULA 4NX2A 3UHOA 3RAFC 2R44A 3KZVA 4FKZA 4PHHA 4E5VA 3ADBA 3RLFA 4BCDA 5IUJC 3AM5A 4KN6A 1EX9A 2G83A 2XMRA 5I7FA 3GLGE 4FBLA 5IKEA 1NHWA 2FPPB 4YCCA 4IZIA 4P22A 2E5WA 3IRUA 1ESMA 3K1AB 3PVCA 1KH2A 3EZGA 1X2EA 3QZUA 4HFJA 4AX4A 4ZIRB 3AL0C 4K0KB 4FYYA 1SM4A 3KZMA 3OPQA 4H2DA 1M7GA 1N0UA 1QBKC 5LFAA 4F4FA 3T9CA 4U63A 1QWSA 2GPNA 1A5TA 1FP2A 2EYQA 2BP7B 3WMRA 4EEZA 2ZYTX 3KPJA 3OQBA 1N25A 1V6AA 1Z0DA 2EGHA 2OCXA 1JWBB 1VG8A 2QP9X 1O9HA 1YDFA 3EWIA 3IP3A 4FHEA 4RWZA 1ZD1A 4LJ6A 4MGEA 4IWXA 3KVRA 3P20A 5JR3A 4HUJA 2XTMA 2WM8A 3N3BC 4HPJB 2WTMA 1FSZA 1PJ2A 2Q45A 2JCBA 4FYJA 1F8GA 1YQUA 2DWPA 3C87A 4JB0A 4ZALA 2HBYA 3ZHTA 3LK6A 4F6CA 4ZPXA 1NW8A 2RHTA 4WESA 2J48A 1IJFA 3H8JA 1S4QA 4MJ7A 1KAHA 2HDWA 3WYNA 1JVNA 5HNKA 4AULA