1ZZ7A

Crystal structure of feii hppe in complex with substrate form 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
192
structure length
178
Chain Sequence
ASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyprophylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 41
structure length 178
sequence length 192
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz7A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz7A02
3N4MA 3U0ZA 5J7MA 3FYMA 2O1QA 2GC2A 3H8UA 3UKNA 2BNNA 3H5TA 2OYZA 3OGJA 5AVPA 4PU8A 2MQKA 1EP0A 2CAUA 1ZZBA 3IVPA 4HVQA 5HI0A 3FHIB 2AW6A 1RIOA 1LCDA 4K8FA 3S7IA 1WIZA 3KGLA 2B5HA 1UXDA 2MHFA 3CLCA 3SCGA 3KZ3A 3FMYA 4PIZA 1J3PA 2H8RA 1Q3EA 4FT8A 4PU7A 2XSDC 1ZZ8A 3FYAA 3S8QA 2ETEA 2XLGA 1B0NA 1R63A 1NYWA 3KCCA 4YG1A 3RYRA 5A7LA 1SQ8A 3EQEA 5T3NA 4AVAA 2ET1A 2LYSA 4Q0VA 4NVPA 1ZX5A 3H3ZA 1LB2A 3H1MA 3ETQA 4IVZA 2XL7A 3CL1A 4UXAA 4I6RA 1O4XA 3L2HA 3D0JA 1PRUA 1UIKA 2LYRA 1DWKA 4H7LA 4KWKA 5JCTA 3DV8A 4I8TA 2IXCA 3E6BA 2LYJA 2QVSB 4F8DA 3H7YA 5LRRA 3ZHIA 1IPKA 2VECA 2PTMA 2KZ8A 1NEQA 3G5GA 2CROA 5JSOA 2F4PA 2PAEA 3H1WA 2B8MA 4PIXA 2IXJA 4N9IA 1DZTA 2KXLA 1CAWA 2BNOA 4Z5DA 3IWZA 2Z2SB 3ZKCA 3NVCA 1GT0C 5LEKA 3NSTA 2XHKA 4X6RB 1J58A 2MEZA 1OI6A 3ELNA 4IWRA 2GRMA 2IXIA 3EO6A 1QXJA 2GC1A 3NKTA 4IEUA 4YARA 4XEZA 1UCXA 4F8AA 3H3UA 1X8EA 1DGRA 4L11A 4GULA 4RD7A 4F7ZA 3O14A 2PE5A 2IVQA 1I6XA 4KU7A 2C0ZA 4XFBA 1O3RA 2XIUA 1RC6A 5KHGA 1QY4A 3LAGA 5I8SA 1YLLA 3OD0A 3KXAA 5CADA 1PRAA 1XWRA 4E2QA 4HBNA 3E5XA 4AVBA 4Z59A 3PNAA 3UKTA 2PUGA 1CAVA 2OZ6A 2HKXA 4I6TA 4Q0PA 2Q30A 2FJRA 1ZZ7A 2O38A 4BHPA 4IEXA 1VJ2A 1H1MA 5I0UA 5CU1A 5FLHA 3G7DA 3HQXA 2PUCA 3HZIB 2B9UA 2XKOA 3SCHA 4FBIA 3CEWA 5EFUA 2IUOA 4FAGA 5E1RA 2FQPA 4I2OA 1O5UA 4JCYA 2BGCA 3EUSA 3M70A 2PUBA 3FWEA 2IVGA 1O4TA 2Q4SA 5FPXA 1CAUB 1Q5OA 1PM7A 5F1RA 4EV0A 1WETA 2WUSR 2O8QA 5BV6A 3OQNA 3RYPA 4B29A 4MV2A 1TQ5A 2O49A 3CECA 1O3SA 1VR3A 3SCFA 3HT2A 2PUFA 4WBBA 4YYOA 1CAXA 1UTXA 2H6CA 3C3VA 4IEVA 3OQMA 4XFAA 5BPXA 3BALA 2GU9A 1WH6A 4Q0SA 4BH9A 4I02A 2XGXA 4X4GA 1UIJA 2Z69A 1RGSA 1O7FA 2E9QA 1RZRA 2Q0AA 4BIFA 1H1IA 1L1MA 3OP9A 3OTFA 2HSGA 3NJZA 2EBYA 3KJXA 3RYKA 1OFNA 1ZZ9A 3UFDA 1YUDA 3D82A 4LA3A 4R52A 3F6WA 1ZRRA 4HZFA 1ZZ6A 1OMIA 4YBAA 3FFQA 4Z5CA 1YHFA 2IU7A 1DZRA 2IC1A 4I0BA 4IEZA 5JSPA 1EY2A 4MCXA 3QOPA 1ZZCA 4AQ2A 5KHKA 2PA7A 1X7NA 3D1NI 2KEIA 1PERL 2AXVA 4I09A 3TNQA 2EVXA 2CSFA 4WZCA 2GC3A 2PIJA 3I7DA 3DN7A 2H0VA 4LLOA 1NERA 1NZCA 3E5QA 4XFHA 4YSFA 4X4EA 4JTOA 3WW2A 3EJKA 4AVCA 2EAAA 4HN0A 4Z82A 3S0MA 4PJYA 1XE7A 3MLFA 1QP7A 3GYDA 4LEJA 4JV4A 1LRHA 4IETA 1CAWB 2ATFA 3U10A 4OLLA 2KEKA 3E6CC 4YNIA 3I59A 3PXPA 3RNSA 2EA7A 4X4HA 2QDRA 3CJXA 4CYDA 5FQ0A 1G6NA 4IEYA 5I0RA 4Z07A 3ES4A 3IIAA 1LQCA 4ZU4A 2HJIA 5FDBA 1ZRCA 4XF1A 2IXKA 5J3UA 4BYYA 2JCGA 4MCTA 4QMAA 1J59A 3ROUA 3D0SA 3MYXA 3SHRA 2AXUA 5FPZA 4DINB 2PAMA 1JH9A 4XF3A 1L3JA 2Y0OA 4YG4A 2PYTA 1YWKA 2CAVA 2CV6A 5D1IA 3ZDSA 3ZHMA 4EWAA 3LWCA 1ADRA 1RTVA 5C8WA 1ZRDA 4GQMA 4HSJA 3GN5A 3F51A 2WC2A 3PLQA 1VPWA 4LUKA 5JR7B 3SMHA 5I93A 4X4CA 2A6CA 2PUDA 2GZWA 5CVRA 4IEOA 4HMZA 1SEFA 3BCWA 5BY5A 3JXCL 3LA7A 4LULA 2LYQA 4D7SA 4IESA 4LA2A 3DKWA 4MUVA 4ORFA 1NXMA 2VQAA 5K98B 4JVAA 4KWJA 4WVZA 2D5VA 2O4AA 3BDNA 1SQ4A 2PAKA 4MZUA 4XETA 2UYAA 3R6SA 1OCTC 3KSCA 3LFPA 3RPQA 4HN1A 5EZWA 3TNPB 2OZJA 5KHIA 3DNVB 2AXZA 3LISA 4Q29A 2MNGA 3HT1A 3EBRA 2L8NA 4I01A 1FI2A 3L1PA 3HIFA 2XJ3A 1OD5A 5I8YA 1CX4A 1PMIA 2D5HA 5K8SA 1LCCA 3RZZA 2WFPA 2XLFA 4LUMA 2JVLA 4QXKA 1HF0A 1QPZA 1CAXB 4MGKE 3WW4A 2BNMA 1LR5A 1O5LA 3WW3A 4Y42A 4J1WA 3LZZA 2K9ZA 4O8BA 1OSLA 2PPXA 1LLIA 5FLJA 4IEQA 3CLPA 5I91A 3RDIA 2KPJA 3S7EA 2HINA 3QQ6A 1YSEA 1NE6A 3H1YA 5J48A 1X82A 2VPVA 2KEJA 4X4IA 2UY8A 2D93A 2IVBA 2R1JL 1RL3A 4EWDA 2XLAA 4UBHA 1WH8A 3QACA 1JUHA 4ZU7A 4Z5HA 1LMB3 4FN3A 3LA3A 5FCCA 3OCPA 4MGZE 1Y9QA 4X4DA 1AU7A 4QGMA 4A2UA 1ZRFA 3QF3A 3MDPA 3QYXA 1V70A 1YFYA 2PFWA 3EHKA 3LA2A 2OFYA 4PU4C 4META 4XF0A 3BU7A 4XFIA 4QM8A 1RUOA 2GH2A 5KBFA 3CO2A 1ZUGA 1GQHA 1QP4A 3BS3A 3B7HA 2N7GA 3FJSA 4X4FA 2QNKA 1S7EA 3IDBB 1EPZA 2PQQA 2IV1A 4IERA 2ICTA 3E97A 1BDHA 5LRSA 2OR1L 4MGIE 1XRUA 4Z58A 4HVOA 2Q1ZB 3FZ3A 5BXXA 2ET7A 4HSLA 3IDCB 4O9GA 5LEJA 4UBGA 4XFGA 4KL1A 1Y3TA 2PHLA 1IC8A 2ZCWA 1RZSA 1SFNA 4IEWA 1ZVVA 4L2NA 3JXBC 2LYPA 2QCSB 3USSA 2OA2A 2GAUA 1LKNA 4E2GA 2QJVA 4IA8A 2XL9A 3OMTA 3I59B 1X57A 4TLFA 5FQ0B 1UPIA 4PU3C 1E3OC 2R63A 3H50A 4P9GA 4AXOA 1ZAYA 2AWIA 3NW4A 3BPZA 3E5UA 1ZVFA 4JQDA 4E2SA 2BJCA 2UY9A 4R8HA 2DCTA 1WGPA 1WLTA 4HLTA 3CF6E 1O3TA 1RPEL 3WW1A 1QQBA 1YFWA 4EROA 3CROL 1J3QA 1DGWA 4YRDA 2GC0A 2EWTA 5KHHA 1WA4A 2D40A 2ZKLA 4ZU5A 3M3IA 2IXHA 2EF8A 2OPKA 2CGPA 3PVBB 3R1FA 3GN5B 1EFAA 5JAXA 1J1LA 1ZS4A 1JFSA 1CQTA 2UYBA 1ZPQA 4HVRA 2GZUA 4J1XA 2PHDA 2L49A 1UXCA 3OQOA 1QQAA 5I8TA 4XFCA 2LCVA 2LYKA 2PUEA 3U11A 3GBFA 4QGLA 1RUNA 5BUVA 1PNRA 3F52A 1CAVB 1UW8A 2FMYA 1GQGA 2XI8A 4I6UA 1BDIA 2MPFA 3KMHA 5FLIA 4QM9A 3I54A 1J3RA 4JTNA 1FXZA 1X2LA 2D5FA 3OF1A 1UD1A 4KU8A 1CJGA 3H9AA 4XF4A 1O3QA 5E16A 3SXWA 3O9XA 3B02A 3TRBA 4Q0UA 4JCXA 4YG7B 1EYBA 4IEPA 3ST7A 2WIUB 3ACLA 2V09A 1RZRD 4FAHA 3VHRA 3MZHA 4GHJA 3QWGA 4MX3A 1VP6A 3FE5A 4Q0QA 2LYLA 1ZREA 5KHJA 2H6BA 3NL1A 1X8MA 1R69A 1Q43A 2BYVE 3JZVA 1IPJA 4MH0E 4XFFA 3E6DA 2P17A 1QWRA 4I3PA 1FT9A 1NE4A 3U3WA 1PRVA 4XF9A 1I5ZA 1QXRA 2XKPA 4LTAA 1XE8A 1QP0A 4QGNA 5JSRA 3DL3A 3VK0A 1JFTA 4PIYA 3BD1A 4D7TA 3JXDL 5I0TA 2BEOA 3FX3A 1CGPA 5C6CA 2GRLA 2K0GA 3BB6A 3LOIA 2ICPA 1YFUA 4ONUA 4KWLA 4NDWA 1HW5A 2IXLA 1YFXA 3UKVA 1Y7YA 4N9HA 5I0SA 4EWEA 4OB4A 2PUAA 4FBFA 2XCJA 2AUWA 1U12A 3ES1A 4AQ6A 1JWLA 3H7JA 2B5AA 3MPBA 4O9EA 4QX5A 2I45A 4X6QB 1CAUA 1POUA 4I0AA 1DW9A 4MGYE 4OFGA 3IBMA 1ZNPA 4X4BA 3KGZA
chains in the Genus database with same CATH superfamily
4CDWB 2O8OA 3OG2A 1QJEA 5FP4A 5J7MA 3FYMA 2O1QA 3MW2A 4LR4A 3WF4A 5LY2A 2BNNA 3H5TA 2XVGA 5K0UB 3UESA 3DPRB 3BUCA 4K6BA 3N9MA 1WBFA 4GQ7A 4OHVA 1RYYA 4RFT0 5DAXA 3OGJA 4EN6B 4XJ9A 4OI4A 4XACA 1NY71 2HEWF 5IVEA 3WHTA 2XXQA 2HWC1 3A21A 3AP6A 4XXAA 4AE2A 4HVQA 3J8F1 2ZEYA 3A0KA 4OHZA 3NDBB 1YI7A 1K5JA 4XUTA 2FDGA 3K51A 3J7MA 3KGLA 1UZYA 3N9LA 5GJ6A 3FFZA 3MLJA 3IM0A 3KZ3A 3HAGA 4KH9A 4QDRA 1NCRB 2HEYF 4KG0A 5CFCB 1PMJX 4FT8A 4AW7A 2RMU3 2AC1A 1ZZ8A 2ETEA 2UURA 3DEMA 4JDNA 1B0NA 1GZWB 2W9XA 2WS93 1RJ7A 4IE4A 3SX0A 2ZX4A 5A7LA 1SQ8A 2VMEA 1MZEA 2HWF3 3SR4A 1AYM3 2LYSA 1MEC2 1LESA 2HYKA 1VALA 3H1MA 4BLIA 5LCWL 1V6MA 4Y33A 2BUKA 5LZ6A 4I6RA 1F5FA 2W1SA 4XCAA 2VCBA 1VBB2 4JCKA 4XXPA 3MW3A 4MG2A 3TRSB 3C7FA 5GLUA 1PRUA 4Z1VA 2ZGRA 4ER3A 3AMPA 4JDOA 3MIFA 4KGGA 2V72A 2LYRA 2V5YA 4XMAA 3PTYA 5FYCA 5AFBA 2IXCA 3AKSA 3H7YA 5APAA 2DUPA 3HNBM 2V4VA 1H2LA 4P9IA 3WR0A 4NIGA 5GAHi 2EIGA 5JSOA 1DYOA 2JIJA 4PIXA 1YQCA 5FUNA 2OUJA 1JH5A 1XYNA 5AC92 3SEEA 4Z5DA 5BNOB 3GHNA 4BU2A 3SLIA 4DB5A 2ZZJA 4W6WA 2MXDA 4NHYA 2VUDA 4H2AA 2JE9A 3WCSA 3ZPXA 3AVRA 4B1LA 5A3PA 1QDOA 5HXMA 2GRMA 2IXIA 4Q5OA 3ZR6A 4AEJA 3EO6A 1OH4A 2GC1A 3NKTA 4XEZA 3LEGA 1R1ZA 2W92A 4Q4V2 4H3WA 4F7ZA 1U2ZA 4YM2A 2E7TA 2C0ZA 2ZGLA 1DG6A 2NPIA 2OX0A 5L73A 5A80A 1KITA 1EV12 2ZGUA 3D5OA 3W20A 1XBFA 1YLLA 3OD0A 2XUMA 2VY0A 4YVWB 3LEIA 5CADA 2XBO2 2RS11 5FPUA 3E5XA 3WNKA 4QU1A 5CBLA 1US3A 4OUSA 1ZBA1 2BRTA 1DGLA 3QCWA 1VBC2 2FDHA 4D3WA 1N1VA 4J25A 4Q0PA 2FJRA 5FYYA 1SMVA 3N9NA 4IEXA 2YG0A 4DPNA 1VJ2A 1H1MA 1VBE2 3K4DA 4JKLA 4KBBA 5CU1A 3RMXA 5JWPA 3TEWA 2B9UA 2XKOA 1PIV3 3L9JT 1AR83 1FYUA 4JGYA 2RDQA 4AK3A 3HQRA 4O7XA 5EFUA 3KQ4B 4C8DA 3FLTA 4EJRA 5K0UC 3DPRC 2FQPA 4HG6B 1UU5A 1QNYA 2LM3A 2XJTA 1GWLA 1WA6X 1B09A 4JZRA 4P08A 2PUBA 1KFXL 4QKBA 2DBNA 4WM8B 5GZEA 1Q5OA 2R16A 4BE3A 1NA1A 4EV0A 3GJAA 3KVAA 4FPFA 5L9BA 3VBRB 1QQP1 2O8QA 5B4NA 5BV6A 1RVF2 3RYPA 4MV2A 4CCKA 1KDMA 1VR3A 4EQVA 1W8WA 4PF1A 3SCFA 4JQTA 3OYWB 2DVGA 4G3YC 2MEV1 3V64A 1NCRC 1ASJ3 5E88A 3GZTB 1LECA 5CFCC 4GMP1 2XB6C 4LBQA 3V0AA 3ZOIA 4XFAA 4GWNA 4RHV3 4AGVA 4W6YA 2IFWA 3NNGA 1IOAA 1D4VB 1QJX3 3EYPA 4Q0SA 1UY1A 3POGA 5EV7A 5FZFA 4Q4X2 2VVEA 1HV1A 3K4AA 4K21A 4U36A 4UF0A 4X4GA 1X9PA 4XBQA 3VD9A 1ZA7A 1W05A 1PZ9A 2C9AA 3MFCA 1LENA 1RGSA 1YRZA 2XR4A 2E9QA 1NX9A 4BIFA 1W9FA 1UY3A 2WLQA 4PQ9A 3NJZA 3RYKA 2EBYA 3CJIA 4OHWA 3LSDA 2ILMA 2G19A 1CJDA 1ZZ6A 4OBMA 4ARXA 3BYWA 4HKWA 2JD9A 3I8TA 3ZYPA 3TWIA 2A7AA 3FFQA 4GKYA 5F3IA 1YHFA 2IU7A 2XVLA 1PM4A 2IC1A 5A7NA 1UY2A 3LEKA 3ZXAC 4CUGA 5FO7B 3HQUA 1DQ1A 1DU3D 2ZAAA 1BJQA 2ZMKA 4ITCA 1FPN3 5GALA 2ENRA 5KHKA 1UL9A 3WZ1A 3RI8A 2PA7A 4JKKA 1RUC3 2VUAA 4QPWA 5GLVA 5GM0A 3VBHA 4EN9B 2QQPA 2BBVA 2J1RA 2LUWA 4K20A 3SISA 2R072 1SLAA 3C7HA 2EICA 2RS33 4WZCA 5CA6A 5FUIA 3WG1A 4FOVA 1AYN1 2H0VA 4HANA 1SPPA 4LLOA 2X05A 2RR13 5DAPA 4URTA 2XDVA 4XFHA 3POJA 4UFKA 1QHDA 4BWOA 1A34A 1F35A 1QDCA 4GA9A 1XE7A 4GJYA 4LEJA 1RUG2 3TB0A 5GZGA 1O91A 3NZLA 3MUY1 2DDUA 5M0TA 4AGRA 2P1BA 1QU0A 4BQWA 1JYVA 1PVXA 2BP6A 1LNSA 1JZ2A 1C8M2 3VGIA 3BKZA 3IPVB 3ZKYA 2E26A 3ES4A 4LO4B 3IIAA 4CP0A 1G7YA 1SBEA 4CSWA 2TEPA 1WMFA 2WO7A 3K77A 3HNMA 2E33A 2XQRA 1JYCA 3PU3A 1J59A 3HNYM 2ZMLA 3MIBA 2JKXA 5FZ4A 3USUA 1RUE1 3MYXA 4K3UA 2OVUA 2BZDA 2GP5A 1JH9A 4XF3A 5CIRA 2DURA 2V5DA 5CG8A 4XMIA 4M0HA 5E89A 4Z2WA 2Y26A 5D1IA 2HFZA 1RUF2 3GDBA 2TBVA 1QH7A 3J4UH 3LWCA 4XE9A 1SDDB 2PHFA 3SKVA 1ZRDA 1QMJA 4WM8C 2W39A 4IV3B 1OFSA 2YPDA 3IIIA 1PO23 1IG0A 2HEVF 4QQHA 5BYNA 5DT2A 1S0CA 5I93A 3O1VA 2UWAA 3VBRC 3I49A 1XB9A 2GNBA 4IEOA 3O1UA 2PXLA 1GZCA 1OPMA 3BCWA 3PIJA 4Y1XA 5BY5A 3MW4A 4BLJA 5LATA 2LYQA 4IESA 1FV2A 4LBOA 4MUVA 4LLFA 3NJXA 1BCXA 4WV8A 4YWAA 4Y3OA 2IVIB 4IE7A 1D0HA 1G8WA 1HX6A 4WVMB 4EQZA 2NZ9A 4DEVA 2D5VA 2Y38A 4NIIA 2UYAA 1OCTC 4ET7A 5ERLA 1CD3G 2I2SA 2OZJA 5A1AA 5KHIA 2HWD3 3JD72 4Q29A 3HT1A 4Y24A 2IVJA 1N3QA 3PURA 1Q8QA 4HONA 1FI2A 1Q8PA 5DSXA 1OD5A 4I01A 3ZN4A 4ZZ5A 5I8YA 4M01A 1LCCA 3M1HA 2W68A 2JVLA 3VZMA 3VD4A 4MGKE 5IVBA 1S0BA 5E8AA 5GLWA 5A7WB 4DO0A 5F5QA 3KHBA 4J1WA 3LZZA 4E9KA 3KQRA 5F5CA 3JBG1 4Q1PA 5D2AA 4CP9B 1G9AA 1K12A 1MEC1 5A7OA 3H1YA 5FYHA 1AX2A 1X82A 1VBB1 2KEJA 4X4IA 5IVJA 1G9BA 3ZXDA 2IVBA 3AZXA 2R1JL 1DLLA 1EUTA 2BW8A 2WAAA 3UGFA 5C70A 1FNYA 3I2IA 3LQCA 4QDSA 4BXFA 4ZU7A 1ZYBA 4Z5HA 2V73A 2QQNA 2HBTA 2NN8A 4V1PA 2J22A 2D98A 4MHRA 3K46A 4LQRA 4QGMA 2I07B 1WD3A 3QF3A 1V70A 1YFYA 2NM1A 3LIHA 5J98B 1G9DA 3BTZA 4QQOA 2YBDA 3HWJA 4META 4XF0A 1HXS1 2VM9A 2AREA 2DYCA 3BU7A 4LK6A 1CIWA 4XFIA 4Y1ZA 1RUOA 4ASKA 3K4ZA 5LA9A 3W9AA 3BS3A 4GZ9A 4QT6A 2VH9A 5A6XA 2P3IA 2DFCA 2WZR3 2QNKA 3M7AA 1WWYA 1EPZA 3IDBB 1AJKA 2NLRA 3VD3A 4B4RA 5GZCA 3CU7A 2OR1L 1QJY3 1XRUA 3PVEA 4LJHA 1WCDJ 3ZYJB 1CQ9A 1DGWX 1W3XA 4YG0A 5DRTA 2DVBA 3BTXA 4P9XA 3OPTA 3AYCA 2JENA 1H8TB 1OA4A 5C8CA 2JDPA 1OA2A 5EJZB 3ZFEB 1ZVVA 2ZX1A 3NV4A 4UAPA 4L2NA 3JXBC 1LOFC 4NAMA 2LTNA 4NRPA 5ACA2 2FZ2A 3KHCA 3POBA 1W90A 2LLWA 1EV11 1POV3 2DCJA 4BK4A 5JVVA 4NOTA 3APBA 4CDWA 1IQDC 1R1A1 4OUMA 2XL9A 3QLQA 2RM23 1MS5A 1OD3A 2A73B 2XBO1 5DAVA 5G04L 2VC9A 3B3QE 5K0UA 5LA1A 2WO1A 3DPRA 1C57A 2Y64A 3B01A 3H50A 1UYPA 1POQA 3K75B 4JGZA 1CIYA 3VBFB 2BWCA 4Y26A 3RI9A 1ZVFA 1U5ZA 3OGVA 5FMOL 4E2SA 2W47A 4R8HA 4UOJA 2ORZA 4FPGA 4IV3C 3HBZA 3O0VA 4HLTA 3CF6E 3NJVA 3KT7A 2LLVA 4AI0A 1W9SA 4P02B 3UETA 4EROA 1Z78A 2AENA 2AH2A 4HFSA 2EWTA 2WYSA 2RJLA 4S2HA 4XAEA 2ZGKA 4ZU5A 5KHHA 3S6PA 1NCRA 1HQLA 1RMU2 3HD8B 3E1F1 3U4SA 5CFCA 1WLCA 1FMD1 4MHUA 1RVF1 3ACHA 1JHNA 3PUSA 2VZ1A 4HK8A 3SQOA 2ZHLA 4XJWA 1GP6A 5A7QA 4E27A 1ZS4A 2QDNA 4DIQA 1DQ5A 4AL9A 1CVNA 3J9SA 1ZPQA 4HVRA 3DKQA 2GZUA 4J1XA 2PHDA 4IGQA 2L49A 4R9BA 3VZJA 1UXCA 3T08A 1OOPC 2VD7A 4AEKA 1VAKA 2HBUA 5FZ9A 4YZ4A 2PUEA 4CEWC 2Z4FA 5KR7A 3TYJA 2K2SA 5C71A 3BODA 1UKRA 2BQPA 2FMYA 1QH6A 4Q4W1 4DQAA 3SH5A 2QQKA 2DV9A 1MS3A 1PK6C 5C5UA 2XI8A 2P3YA 1UWWA 2JB4A 5IYYA 3I54A 1RUJ3 2VQUA 1FXZA 2YYOA 1X2LA 3MICA 4V2WA 3MIEA 2ZGMA 1W6QB 2E7AA 3H9AA 1O3QA 4XPVA 2WWUA 5EHDA 1JZ6A 1IS5A 5IAXA 4FSJA 1HRI3 3TRBA 4Q0UA 3CZUA 4YM0A 2X8KA 1XU1A 1UY0A 2QQOA 3ST7A 2WIUB 4EKGA 2RMU2 3GM8A 5BNOA 2VW1A 3PIGA 1NA1B 4LK7A 1K45A 2WS92 1S0IA 1YCIA 5ABJB 2VCMA 2VOXA 1GQPA 3HN1A 1N47A 4YW6A 4MX3A 4XOGA 5IK5A 1ZREA 1XOYA 2HWF2 3F2ZA 2FCVA 2VTFA 3TN92 1R69A 2CSGA 3VKOA 4C1XA 3OPWA 2BYVE 4XFFA 2JDKA 1S0JA 4XUQA 1AR62 4FTSA 1LOGA 1QWRA 3ZLIA 1MFQC 1T2XA 1PO12 3N7MA 2R071 4CCDA 1AR71 1F9KA 1FT9A 4LBQB 5FZCA 4BOWA 1AX1A 1TVGA 2XKPA 4LTAA 5AFEA 3TFLA 1YJLA 1QP0A 4QGNA 3UGHA 1TG7A 3U07A 3VK0A 4BQ5A 5A3NA 4PIYA 3BD1A 4LBLA 3JXDL 4YVWA 5I0TA 4YW1A 2VOKA 2JDMA 2PXQA 2K0GA 3ZFEC 2ICPA 1OQEA 3ZYFA 2VZSA 2FD8A 1BK1A 2WNVB 3C8XA 2DUOA 3WQ0A 2XWJB 1PVC3 1YI9A 4OZOA 3TBDA 4K7JA 2QQLA 3BTAA 3NXHA 2J1AA 1S0FA 2LROA 1HLCA 2J1SA 4OULA 3BU0A 3O12A 4XJ8A 5CNAA 2PUAA 4FBFA 1FOD1 1OXCA 2C5DA 3SH3A 1OURA 4IGOA 2VR4A 3JU9A 3UL2A 3VBFC 2A6ZA 4FXKB 4AQ6A 4HL0A 1BHGA 3MI8A 4Q26A 4WM8A 4CEYB 1EAH3 5LASA 2OQ7A 3LB9A 1ENRA 4MGYE 4COYA 1COV3 3R4SA 4X4BA 4P5HA 4AAPA 3T2PA 1DQ2A 2CGOA 5SV5A 2LNMA 1SPPB 5C3OA 1HQ1A 3H8UA 3I2OA 5FOJB 4TTGA 2YC4A 4W6XA 2A6VA 1BEV1 3DGTA 3OYWA 5F39A 2R7EB 2OYZA 4Y4RA 2L1PA 1L7RA 3AZWA 1HQNA 1OLRA 3HVDA 5A3MA 2MQKA 4DXSA 1WMDA 2J42A 3IVPA 1UU4A 2WZ8A 2WR9A 2YDEA 2ZBJA 5IHRA 3FHIB 4FPLA 5F6KA 1WLDA 4K8FA 4OMDA 1D4M3 3S7IA 1PIV2 2B5HA 1AR82 2D6MA 3SCGA 4XYXA 2XQXA 2VOTA 4PIZA 1J3PA 5IVYA 2H8RA 5FFOC 2E53A 4YVSA 4A7KA 4PU7A 3V65A 1R63A 1NYWA 2TNFA 2ARBA 3KCCA 1DP0A 2R063 3RZLA 1M06G 2Z42A 3RYRA 1VBA3 3USUB 1F5JA 4CZSA 4W4ZA 5C3SA 1WW5A 1JOBA 3SH4A 5A3OA 3VKLA 2OT7A 1AR91 4NVPA 3H3ZA 4CTEA 5AVAA 2G9GA 1S0DA 2XL7A 3CL1A 5EP9A 4UXAA 5JOXA 4TSVA 1PZ7A 3VKNA 1ASJ2 5F2SA 1O4XA 3L2HA 4A45A 1UIKA 2ZXQA 3B5LB 4ASMB 1NA1C 4RHV2 3KF5A 5JCTA 1JYWA 3ZPYA 4YGEA 2LYJA 1N3OA 1QJX2 4FPJA 2VECA 1TNRA 1NEQA 1DQ4A 1C3HA 2F4PA 2I74A 3BVCA 3WF0A 3C7EA 2QUOA 4D6SA 3ZSMA 4N9IA 1TMF3 4CRQA 2KXLA 4PCRA 4YM1A 3IWZA 4FO9A 3UV9A 2Z2SB 5FBJA 4PBOA 1W6NB 3ZKCA 1X50A 5IK4A 5CG9A 4Y20B 5IFTA 1I9RA 4KG8A 3ZDVA 3HR9A 1LU1A 2XHKA 1J58A 3IPVA 5T50A 3LPGA 4N90A 2MEZA 1OI6A 4IWRA 4IE5A 2JD4A 2BGOA 1OUSA 4AYUA 2XXPA 3PHMA 4IW3A 4OI1A 1E57A 4IEUA 3LPFA 2Y6KA 4QKFA 5IJRA 1FPN2 2VXRA 2WNVC 2Y34A 2ZAHA 3H3UA 5FZIA 2JWPA 2ZX3A 1V00A 1RUC2 2IVQA 1I6XA 1Z0HA 3NMBA 1HRV1 2ZEZA 2SBAA 5GLZA 1O3RA 2EALA 4FPKA 5DDJ1 1QJZA 1RC6A 1R083 2RS32 3THCA 5I8SA 4MADA 4XJUA 5FP8A 5ACA1 1PRAA 2RR12 1Z7S1 4E2QA 5GLTA 4GJZA 5FPVA 4FPHA 3H8RA 2RDSA 1FX5A 3PNAA 3PUAA 3WG2A 1JHJA 1OQ1A 3UKTA 3ZMNA 1C1LA 2D6KA 2OZ6A 5FYBA 4IV3A 2HKXA 3AX4A 4BHPA 5KXDA 1YQ5A 5I0UA 2YMZA 4J6GA 5FLHA 3WUCA 1IZ3A 4XUOA 1H0BA 4CCLA 3VZKA 3SCHA 2WQ8A 5JI7A 1XJAA 4EN8B 3UJQA 1VBD1 1WW4A 4RSUA 4AI2A 4GB33 4FAGA 5E1RA 4DUVA 1JZ7A 1BBT1 1NXD1 1O5UA 3B7MA 4WVMA 3EUSA 1KDKA 3DXTA 3M70A 3WUDA 2FFHA 1OC1A 2WABA 2NMNA 3PE5A 5EWSA 1CAUB 1KD7A 3MGUA 2SLIA 1W06A 1MVQA 3KV5A 3T0AA 1WETA 4PQQA 1RUH3 4B1MA 2WJSA 2GNDA 4B29A 1MS8A 1RMU1 2BFUL 3NNFA 4UFMA 1UAIA 5C8CB 2YGMA 2A3WA 2PXUA 3N9QA 4NIAA 5DG2A 5FRAA 5H9RA 3U78A 2ZOEB 4AQTA 1HIXA 1LCLA 3ME5A 1UZ0A 3C3VA 3C7GA 3KB5A 4IEVA 5EQUA 1NLQA 4QDQA 3GZCA 3OQMA 1GOFA 4WVLA 5BPXA 1W0OA 1J1TA 1V6IA 1PO22 2BOJA 3LDBA 3U75A 4NPLA 1QB2A 1BQPA 1W2TA 1ODNA 2PXEA 2R043 4BA6A 5LB6A 2BPA2 4QD2A 1CONA 3VBSB 2XGXA 1UIJA 1XSRA 4JGZB 4LORA 4W65A 5FP7A 5IVCA 1OLME 4QXHA 5JPMB 3T1LA 3LF7A 1CWPA 1O4ZA 2Y6JA 3OTFA 3RQ0A 5K7PA 3KJXA 2RS53 1OFNA 3P5BA 4BM8A 3AP9A 3VDAA 2BJSA 4A44A 4XUNA 1OMIA 1LJ7A 2Y6HA 4N8MA 1SCRA 2VL4A 3VZNA 4YBAA 1WBLA 2ZACA 4PLMA 3AKPA 4UYBA 4OHXA 3WNMA 2JQEA 2RMU1 5JSPA 1EY2A 2JDHA 4EN0A 4AZZA 4FPYA 1SFPA 4C0BA 3NWKA 3ILFA 2KEIA 5J96B 4I09A 1JYNA 3N35A 1XC6A 4I30A 3NNMA 1DCSA 2A1XA 3WSOA 3UGGA 3ALQA 1AR61 2GC3A 2PXTA 2LRPA 3I7DA 3DN7A 2FCUA 1H8TA 1PO11 2HWC3 3JB4C 1NZCA 4A41A 1NW3A 3ECQA 1ZBE1 3J8F3 4YSFA 3ZFEA 4JTOA 1PHMA 3WW2A 3NAPB 3EXUA 4HN0A 4A6OA 2CWMA 4Z82A 2G9ZA 5DN2A 3MLFA 5CFDB 1IPSA 3LCPA 1CAWB 2ATFA 3U10A 1VRH2 1APNA 4OLLA 3VDDB 4S2DA 4NRMA 4P9WA 4E8DA 3PXPA 4CCOA 4EN7B 4X4HA 2QDRA 4Y5TA 5IWFA 4CYDA 3LOBA 1G6NA 1RXFA 4IEYA 2PXJA 4CCMA 2XJUA 3VBUB 3VBFA 3O1SA 3BTYA 2GN3A 3O1MA 4LHNA 4ZU4A 2HJIA 1NKGA 2WT1A 4XF1A 3G6JB 1OVPA 3I3DA 4D69A 2GDFA 5FDBA 3IKWA 2WZR2 5HCAA 5BNPB 4MCTA 2CTVA 1QJY2 3OEBA 1IKPA 1NAEA 1H1AA 2DWRA 4ES8A 1HB4A 5CKNA 3MIHA 5FOBB 2HWE3 2CDPA 1M4WA 1ALYA 1W28A 3FL7A 4C0HA 2Y0OA 3EMRA 4YG4A 3R0RA 4QHOA 4XQ4A 4NROA 3W59A 4C1WA 4CCEA 2L9LA 1JS9A 3D6EA 4QX7A 4YG3A 1RUI1 4GQMA 3WNPA 5FMDA 2WC2A 5FZGA 1W04A 5GZDA 3PLQA 1VPWA 3R4UA 4EZHA 4Q1RA 5C5TA 3RZHA 2VMDA 3ZYGA 2C6SA 3N7KA 4JQRA 2PUDA 5KXEA 2RM22 2Y6GA 3AKQA 4XC9A 3N36A 2LW8A 1V6JA 3LA7A 4LULA 5D8AB 5C8CC 4D7SA 2KM2A 4LA2A 1A8DA 1NXMA 2JG9B 5HCBA 1TME3 4QPIB 4XHBA 3JCIA 5K98B 3M3CA 4GKXA 4WVZA 1SQ4A 3BDNA 2ES3A 4NRQA 3AYDA 4XETA 3VZLA 3WF3A 3NV1A 2R1DA 1AR81 4CDWC 2F17A 3B94A 4ISRA 2PLV1 2JB8A 4E4SA 2FDIA 2MNGA 3A7QA 5ANNA 2J1VA 1W6QA 3M3OA 3TEPA 4HPKA 4K1ZA 2ZS6B 3HIFA 3VBSC 3ZIWA 4JGZC 5K8SA 2OXBA 2GP3A 5DRYA 3RZZA 2WFPA 1W8FA 3NKGA 4QXKA 3OBZA 1DQ6A 1HF0A 3T3YA 1CAXB 4AHZA 1O5LA 4AHXA 1LGNA 4Y42A 2K9ZA 5A3LA 5ABJA 1OSLA 4H14A 2PPXA 1LLIA 2JE8A 4IEQA 3ZSEA 3O1OA 4OVEA 2DCKA 3S7EA 1XU2A 3RZGA 4NIHA 1NE6A 1H4HA 1ZBA3 4FI9A 5IVFA 2B45X 1BXHA 3QOXA 3CQOA 1DF0A 3LFMA 2CHHA 1ASJ1 1C28A 4LO6B 2JDAA 4AFAA 3IMNA 1RJ8A 4P00B 3PUHA 4RHV1 1QOTA 1ENSA 2OS2A 1JI6A 1JUHA 3QACA 3PMEA 4FN3A 4XVHA 3PJYA 1U5XA 1UMZA 1QJX1 5SV8A 1RUD1 4RR3B 3QD6A 1Y9QA 4MGZE 4A2UA 3WEZA 1AF9A 1DQ0A 2LALA 3I2HA 3OPZA 3UT0A 5F3CA 1ZRFA 3QYXA 1RUJ2 3LA2A 3EHKA 4KQ7A 4LOTA 4QKDA 2OFYA 1RHI1 4CPBD 1KRIA 4D7YA 1O6UA 1MACA 4QM8A 5FZBA 1QQP3 1O4YA 3SEPA 1LHWA 3CO2A 3NAPC 1QP4A 1Q56A 2WNVA 4YVSB 1HRI2 1S7EA 1OLQA 3AMHA 4E4HA 2Q1FA 1N3PA 1X36A 1QZXA 2IV1A 2PQQA 3T4HB 1BDHA 1H9WA 5CKQA 5CFDC 1DZQA 4OI2A 2WNOA 5BXXA 3VDDC 2F6BA 3WG3A 5LEJA 1GSLA 4UBGA 1L7QA 2WKKA 1Y3TA 1XNCA 4KL1A 3ACFA 4CU6A 1FPN1 1MR5A 5FYVA 1C1FA 1PNGA 1SFNA 4IEWA 3VBUC 4MSVA 4N7UA 1RUC1 4B7KA 4XBLA 3ZM8A 1GP5A 4CEYA 1DLCA 4ZXEA 3USSA 1MZFA 2RS31 5BNOC 1O8SA 2GAUA 5HV4A 5JPNB 3RVHA 4CCNA 5BNPC 3FMGA 2D3SA 2BGPA 3OMTA 3I59B 5FXXA 1GUIA 2PXDA 3OBRA 3WVJA 4A4AA 3AXEA 4TLFA 4MVTA 4ZONA 4PU3C 4YM3A 2XJPA 1TZOA 3QOWA 4AXOA 3CIHA 1V9U1 2AWIA 1QEXA 2PHUA 4IUGA 3RS6A 1WMXA 1JOPA 2PHRA 4NAOA 1YO8A 3WQBA 4YW2A 3ZN5A 4AWDA 3NV3A 3OKZA 4JQDA 2QFEA 1PVC2 3IAPA 2BJCA 1F4AA 2WFF3 3VN4A 1W9TA 1EUUA 4AOCA 2PHXA 3OBTA 4LOSA 1UXZA 4PBPA 1KS5A 1TE1B 4DRRA 2QBXA 3CROL 1SACA 3J7HA 4YVWC 5LRSA 2DBIA 4AQSA 5D8AC 2AACA 4CU7A 3ILNA 3AL6A 4NWVA 5H9SA 1ND2B 2W1UA 4QPIC 3I2DA 2GMMA 3N3HA 1AYN3 1GNYA 3PUQA 3WY6A 4BIOA 4DMIA 1F4HA 3PVBB 1EAH2 3R1FA 3GN5B 1EFAA 1UZZA 2IUWA 4FOQA 1P8JA 5JUWA 1COV2 3RZMA 1AXKA 4RYDA 1JFSA 1CQTA 5F5IA 2FCTA 4AF9A 3VHOA 5C3QA 3QH7A 1AL0G 3SNMA 4LNVA 2R49A 4IDZA 2VXJA 5JXJA 5DUWA 1KEXA 3ZR5A 4M0NA 4KWUA 1PNRA 3F52A 1UKGA 3I3BA 2W1WA 3ZXFA 5HV0A 5DAWA 1PNFA 4XABA 2W3JA 3WNNA 3Q8FA 5FLIA 4AG4A 5DUUA 2YBKA 4QWNA 5T54A 1H2MA 1UD1A 2FDKA 4KU8A 1D4M2 1CJGA 4LXLA 4LO8A 4X8PA 2FBEA 2EAKA 2YU2A 1NQDA 3AP4A 4XF4A 3U1XA 4DUXA 2AZ5A 5FYMA 1CX1A 1TNFA 2VZPA 3SXWA 4XDPA 3ENRA 3ZXEA 3O9XA 1LOAA 4YG7B 3DM5A 1W6NA 2V09A 5C33A 1K5MA 4RR3C 4Y20A 3VHRA 2R062 1I5PA 2ZX2A 2W2IA 4LIUA 5JMOA 1VBA2 3DECA 3OBAA 3MZHA 5FZ6A 4RGGA 5FZ1A 2DUQA 5FYTA 5FO8B 1YIPA 4UI9L 2VZOA 1LEDA 1LHUA 3N9OA 4Q4Y3 3E6DA 4GIQA 4HT1T 4YVSC 3KD4A 3ZSLA 3H0OA 1JZ4A 4XF9A 1S2EA 1I5ZA 2HH9A 1OF4A 3ZIXA 3DL3A 1JZ8A 2OQ6A 5LK7B 2ZGTA 5FZOB 2R32A 1R64A 2BEOA 3FX3A 1SZBA 4ER7A 3DF0A 5C6CA 3ABZA 3KM5A 1A8MA 5A3UA 3MIDA 4YFWA 5A7SA 1IS4A 1VRH1 1W8NA 3LOIA 4CDXB 3B00A 3I3MA 2PXVA 2AR6A 1QOOA 1HW5A 3AMQA 1XNTA 1YFXA 4RN5A 3A0NA 4OYUA 1TMF2 1BLZA 1Y7YA 4FP3A 3FLRA 4N9HA 1CPMA 3OUJA 3ZN6B 1UQXA 5F7UA 2YC0A 1ENXA 4P9LA 4EZ4A 2FDFA 2JICA 3JBG3 5AC91 3QFIA 5L7OA 4QAWA 2WZR1 5IATA 1BZWA 3TEXA 5F8PA 2EIBA 3O5SA 2VMIA 4CXXA 4IE0A 1JWLA 1DIWA 3NNJA 4LMFA 4O61A 4WVVA 3Q8CA 4O9EA 4QX5A 2I45A 2X5IB 1CAUA 1POUA 4I0AA 1DW9A 3ASIA 2WWSA 4OFGA 3AZYA 3MF6A 3T09A 4G4FA 4OUEA 1DGRN 2C24A 1R082 1UY4A 4Q4V1 4LKEA 3HJRA 3PUIA 2GC2A 3KVBA 3UKNA 1PGW2 1RB8G 3D4KA 3A9ZA 1DBNA 3FBMA 1VMJA 4GMP0 5FXZA 4LHKA 4QX2A 1WZXA 2ZKNA 1POV1 2C26A 3MV01 2W52A 5BNNB 3WDXA 4PU8A 1XXNA 4AHWA 1HXS3 3FHQA 1HB1A 1EP0A 1QOSA 5IAVA 1PGL2 1ZZBA 1SCSA 3LD8A 5DUXA 5J1XA 2ZHNA 3OUHA 4JKMA 2AW6A 2WBKA 1AJOA 2OW4A 1WIZA 1NOVA 3VBSA 1HDKA 1OT5A 1UXDA 2BDRA 1VBC1 2MHFA 2VUCA 3MLLA 4EKIA 1DULA 3IAQA 2XJVA 2JG8B 3FMYA 3U14A 1GOHA 3WDUA 5FY7A 1ULPA 1VBE1 2J1TA 3OOXA 4D0QA 5F3EA 3S8QA 3FYAA 1J83A 3GCXA 3I2GA 5FY4A 4ZPIA 5FMCA 4YG1A 5IUQA 1QJU2 2QQUA 4ZY9A 1XNDA 5DTRA 5GAGi 1Y7BA 4PDWB 1RUH2 3INAA 3S57A 2DFBA 4UFJA 5A1LA 1LAJA 3EQEA 5F2WA 1ZM1A 5T3NA 4AVAA 5FK7A 1QIQA 3RG0A 3ETPA 1R1A3 3WNOA 4D94A 2QZ3A 4IVZA 3WQ7A 4I3GA 3A4UA 2DVDA 3I4IA 1EPWA 4LHLA 2R0FA 4L92A 2W5FA 3CHXA 2WO2A 3AKTA 4UFIA 5C9AB 2QQJA 1DWKA 3PMSA 2VMCA 3DV8A 2VG9A 4O65A 3E6BA 4UW3A 2QVSB 4F8DA 1W0NA 2PXFA 5LRRA 1ND3B 1JTZX 2R042 3AJZA 2KZ8A 1A6CA 3G5GA 2V3CC 1SLTA 2GMPA 3POFA 5EJ3A 3NAPA 3WDYA 1D2QA 1HN0A 2B8MA 4CDQB 3B9CA 3J26N 5CFDA 3TN91 1N1TA 2ZGOA 3PVOA 1AL23 1RUJ1 2AUYA 2D44A 1CAWA 3PTRB 1AXYA 4Q4X1 3ZXJA 4M3CB 4AI3A 3Q9OA 2RS52 4LBQD 3VDDA 4AHYA 3S5AA 3NVCA 2J1UA 5LEKA 2P6CA 5FYIA 1FMD3 2ZEWA 2YFZA 4NIDA 4HPKB 4QQLA 1V0AA 3IB3A 4HXCA 2Z79A 3TEYA 1HRI1 3VBUA 2WA4A 4COWA 1REFA 1IHMA 1SG3A 2XWBB 1MZ6A 1QXJA 1OH3A 4OMCA 4YARA 2GSYA 5F6LB 4CDXC 5HCFA 4E4DX 5HXVA 4F8AA 1AUYA 4CDUB 1RINA 4L11A 4RD7A 4GULA 5LBBA 5KXBA 5BNPA 5KC5A 4CXYA 2P37A 3VZOA 5LA2A 1FATA 4KU7A 1KGYA 4URAA 5LY1A 1QY4A 1NY72 3FC0A 3I2KA 4LITA 4M4PA 4Q4W3 5FZAA 1AYM2 5FY0A 1FV3A 1UOJA 5FY5A 4YZ2A 3KXAA 2HWC2 5DABA 2QQIA 4FTBA 3J8F2 3AZVA 5H9QA 3UJOA 1PX4A 3JXSA 4FOWA 4AVBA 4XJAA 4D6RA 1UN1A 2PUGA 1CAVA 5K4LA 2X5IC 1NLRA 3FN9A 2EF6A 1ZZ7A 2O38A 2WNUB 2ZX0A 4LPLA 3G7DA 1ONAA 3WXPA 1UPSA 3HZIB 4NPRA 2CGNA 2ADEA 1H8TC 1MS0A 5D8AA 5FO9B 1RUG1 4JDMA 4CU9A 2JG9A 2IUOA 5L36A 1AVBA 1PVC1 4QPIA 2O0OA 1W3VA 5FZMA 5A1FA 5JOYA 4I2OA 4L97A 2QQVA 2R6QA 2JDZA 1C8M1 3FWEA 1O4TA 3K3NA 3NQHA 1JU4A 5FPXA 1MQTB 1XNBA 3AB0A 3EB7A 4SLIA 4DUWA 5F1RA 4OQ8A 4XDOA 4NN0A 2HWB3 2IWGB 4P9JA 1AR73 4AVTA 1O59A 1TQ5A 5IK7A 4QXBA 2O49A 2D3PA 2HWE2 3RMYA 3CECA 3ILRA 1JYXA 2CYFA 2ZMNA 3HT2A 2PUFA 2JG8C 2PXKA 1H6YA 1UMIA 2C4XA 1CAXA 3D8CA 4LO5B 2BERA 2A75A 2H6CA 2B46X 4BPZA 5KXCA 5IK8A 1GYKA 2D97A 5FKCA 1W9WA 2GMEA 1JXNA 1RUF1 4M3CE 1WH6A 4PDWC 5FZDA 2W46A 3SKJE 3WF1A 2XG3A 4Q8KA 5C3PA 5CEHA 3AMMA 4ER6A 2Z69A 3T0DA 3WF2A 2IFRA 4LBNA 1TME2 2VNGA 4W8JA 1UZVA 2E51A 2YBPA 1HV0A 3X29B 1H1IA 1FOD3 3OP9A 2HSGA 3C7OA 4H7MA 2J7MA 4RR3A 1ZZ9A 3UFDA 1F2NA 4LA3A 4R52A 4YPJA 5C9AC 1ZRRA 4HZFA 1KJLA 2VUJA 3Q8BA 3RWNA 1LGCA 4PHZA 1LOCA 2BBAA 3BI3A 5T5OA 1MS9A 2JE7A 1ND3C 1OVSA 4L0PA 1DZRA 1W6PA 2XUEA 2B42B 4N53B 1CJPA 2ZTNA 3AVSA 5A3TA 2HCNA 2BV4A 1WKYA 4D6QA 5JDBA 2BTVC 1OBNA 3OUIA 4MCXA 4NMIA 4XBNA 1ZZCA 1S2KA 2YXSA 2R061 2ZZQA 2JJ6A 3JD71 4AQ2A 1OA3A 1CZVA 1VBA1 4CDQC 1LU2A 1GZTA 1W6OB 1BEV3 2A6XA 1PERL 2AXVA 2W1QA 4M3CF 2VZUA 4XZPA 2NP0A 2CSFA 3WNLA 2Y0IA 5LBEA 1SDWA 3A9YA 5FYSA 4EYUA 2PIJA 1ZBA2 5IW0A 3JB8A 4C91A 1NERA 3B93A 1RIRA 3GHMA 4MYEA 5LWBA 4X4EA 3DXUA 4ISQA 2EAAA 1W2NA 4GH4B 3RZKA 4L8QA 2AGSA 3S0MA 2A6WA 4PJYA 3GYDA 3MIGA 3BOPA 4CDUC 4JV4A 5ABJC 1LRHA 2VW0A 4IETA 3O1RA 1BMV2 1RXGA 2KEKA 3D3AA 4P9YA 4YNIA 1W9YA 2RDNA 3I59A 4IV1A 4DOUA 2EA7A 5FAXA 2EXJA 3CJXA 3ZKUA 3AP7A 2VBBA 4Y22B 3ZFGB 5KWRA 5L9RA 4Z07A 3H42B 3I2FA 2H0BA 2VBPA 4FFFA 4YW7A 1QQP2 5C4WB 2W94A 4TN7A 1ZRCA 4AVSA 2VBDA 3OGRA 5J3UA 3WP4A 4XTMA 5JXHA 2JCGA 1AR93 1ULCA 3MBWA 1ENQA 3CMGA 4INDA 5JIAA 1SLIA 1K5MB 4RS5B 1Y9GA 2G9FA 4QMAA 2TUNA 5K9YA 2WNUC 1CN1A 3I2JA 1T6BX 3QBQA 4QB2A 2CNAA 3POEA 2VOWA 4GWJA 3VHPA 3SHRA 4H55A 2AXUA 3T0BA 3H8XA 1LB2A 4DINB 2PAMA 5DTQA 1ND2A 4NR1A 1YWKA 3ZDSA 5FMOS 4BQXA 5EXOA 4AFBA 5FIXA 4EWAA 1F8VA 5DUVA 3AXDA 1ADRA 1OUXA 4BQ2A 5C8WA 1D2SA 4HSJA 3GN5A 4QHBA 2UWBA 1S0GA 4UFLA 4YGCA 1MQTC 1Q8OA 2CU5A 5JR7B 4X4CA 2A6CA 3UNPA 4HMZA 4F3JA 4QX3A 5FZLA 3JXCL 2WSVA 4KNCA 4LE4A 4KBZA 4JHTA 4ORFA 2DU1A 1JYTA 2OPWA 5FJKA 1DFQA 3MUZ1 5FR3A 5FTTC 1GKBA 4K9SA 5DPNA 4CEYC 2YHJA 4N7IA 2EIEA 4YW3A 4MZUA 3GF6A 1YEWA 5E6HA 2ODRD 2WFF2 1GOGA 3KSCA 3R6SA 1GZ9A 3S30A 3UYJA 5EZWA 4QX1A 1K42A 3TNPB 3CDZB 1KFUL 1SBFA 4WZFA 2AXZA 3LISA 2GALA 2WN2A 2XH6A 4MOAA 5FMBA 1REDA 1W8TA 5L7OB 4Q8LA 1UYZA 4Q2FA 3L1PA 4NPMA 2XJ3A 1HRV3 2VAUA 1PMIA 3PL0A 5DDJ3 5FV3A 4OCTA 1GR3A 1QPZA 1QJU1 3ZMOA 2JKBA 3WW4A 2DVFA 1OKOA 1LR5A 3WW3A 4BISA 4NE9A 1UU6A 2OUHA 1Z7S3 1NCQB 4O8BA 3OY8B 5FLJA 5I91A 3CLPA 2WN3A 5FZHA 5F32A 3H8OA 5FBZA 4DNYA 2HCSA 3QQ6A 1YSEA 2XXZA 5J48A 3KT4A 4JRLA 2VPVA 4N53C 3IT8A 3VD5A 2M4HA 3ZXGA 2ZJCA 2XVKA 1RL3A 4EWDA 1NT0A 3MO4A 1WH8A 5FY1A 3VBOB 2VVDA 5DZFA 1VBD3 4CUBA 3LA3A 4RA0A 3KT1A 3OCPA 3B69A 5FCCA 2W95A 2R041 1BBT3 1V6NA 4X4DA 3WQ1A 4A3XA 4BDVB 3GALA 1R093 1NQJA 5GKAC 3KF3A 3GGLA 2PFWA 2X10A 4PI2A 5FZOA 4QB1A 4Y5Z0 4PU4C 5JI9A 1UX6A 4Z2AA 3W5NA 3ZXKA 1W8HA 3ZXLA 4CDXA 5IVVA 3M3EA 4QKNA 1ZUGA 1GQHA 3FUOA 5KBFA 3B7HA 4A6SA 4GH4C 4BB3A 2P3JA 2XONA 2E32A 4X4FA 5L9VA 4Y1VA 1WMEA 2WA3A 5F5AA 1B35A 3E97A 2QQMA 4IERA 4E4ZA 5I0DA 5JUVA 2PN5A 3ZN6A 2Q1ZB 3FZ3A 2XPJA 2YFUA 2ET7A 2HWD2 2WYFA 2ZGQA 3IDCB 4O9GA 3RGBA 4XFGA 1ACCA 3U37A 2PHLA 5A6ZA 3ZFGC 5JR2A 4CE8A 5DG1A 2JIGA 1ULOA 1BK0A 2WS91 4MXWB 4NHKA 4Q4Y2 4QHZA 5C4WC 5F9TA 3B9IA 1W6MA 2QCSB 4NJ4A 1BVVA 1NZIA 2X5IA 2HWF1 4FQ4A 1AYM1 2VQTA 4R4ZA 1LKNA 1UOFA 1K5MC 3ACIA 4RS5C 4NHMA 2E7QA 2P34A 2QJVA 1GP4A 4IA8A 1I3HA 5FYZA 3AYEA 3W21A 4P14A 4QQ2A 5FQ0B 1UPIA 4AEDB 4AEMA 1E3OC 4Q27A 3ZYHA 3ZSJA 5JLVA 4L99A 4XAAA 1U5YA 5FREA 3LIGA 4BMBA 3BPZA 5BNNA 2EXKA 3E5UA 2VZVA 1SLLA 1MPXA 2WL1A 4COZA 2BWAA 1Y9MA 4W50A 1N1SA 2DCTA 1WGPA 3N7LA 1WLTA 1WW6A 3NV2A 3WW1A 1QQBA 2D7FA 1YFWA 2W87A 2P4EA 3ZYRA 2VMGA 4OQ9A 3JBG2 4YRDA 3J7LA 4MGSA 2VOVA 2JG8A 2ZGSA 4RFRB 2D40A 2ZKLA 4SBVA 2PMWB 4TLGA 4PLNA 4DY5A 2IXHA 1AR63 2VJXA 5DAQA 4BQ1A 2EF8A 1WCUA 2OPKA 3NO8A 1PO13 3S5QA 4FQZA 1UZWA 1ZBE3 5A32B 4ZXKA 2VNOA 1MS1A 5JAXA 2HWE1 3P1IA 4R9AA 1J1LA 1LULA 4NHLA 4PDWA 2XXAA 2B4KA 2UYBA 1KS4A 1UO9A 4JC1A 2WQZC 3LSEA 4CCJA 2A70A 5L7OC 5I8TA 2LYKA 2ZPXA 3U11A 3WP5A 3LFIA 3RWKX 1WCSA 1RUNA 2VTXJ 1OSGA 1HB2A 1LEMA 3QH6A 1CAVB 1VMFA 1UW8A 3MEJA 2QQWA 2XJRA 5FKBA 1HXS2 3T1MA 3T4VA 1GQGA 1OKQA 3KCYA 1NCQC 5FXVA 5C9AA 2J7WA 4I6UA 1BDIA 4QM9A 4JTNA 1G9CA 1ND3A 5GZFA 3PU8A 1TME1 1REEA 2WINB 3KV4A 4Y4YA 1YIFA 1PGSA 2YBSA 4GWIA 1S0EA 5E16A 1FNZA 4CDQA 5J36A 4JCXA 3OWQA 3VBOC 3RSJA 3WP3A 4FFGA 4IEPA 1S1AA 3ACLA 1PIV1 4M3CA 4QPGA 4GD4A 4GXLA 1UNBA 4DEQA 2BVVA 5FJHA 5FP3A 4GHJA 2WLPA 1RUI3 2LYLA 3WLUA 3MEPA 5KHJA 2H6BA 1JW6A 3NL1A 1X8MA 1MZ5A 2YY1A 4QX8A 3UWPA 1Q43A 1IPJA 1YJKA 2WZEA 3VKMA 2RDRA 1R1A2 4RQPB 2R0HA 2GH8A 2P17A 1N1YA 3DYPA 2CWSA 4DFSA 4I3PA 4CDUA 5T5LA 1NE4A 2HLEA 1PRVA 1MS4A 2RS13 3A9XA 1QXRA 3O1TA 2ARAA 1VMHA 1XE8A 1YQ6A 4FPEA 4XHXA 5A7PA 1OHFA 5FZ0A 4FFIA 2CDOA 2A5ZA 2ZGPA 3GZDC 4U2AA 4XIOA 2ZGNA 4IL7A 2Q5TA 1CGPA 4QX0A 2GRLA 4CCCA 2PLV3 1BMV1 1Y43B 1YFUA 4NDWA 2IXLA 4XQDA 2P6HA 1PX3A 4AFMA 1DYPA 3LDKA 1CZSA 1AL22 3J7NA 3TEZA 5DMYA 5HBAA 2WNUA 1DDLA 4R9CA 2WNEA 1I1EA 4B8EA 4Z8BA 2QTWB 4BMEA 1FMD2 2YUEA 1GANA 1F31A 4BXSV 1W6PB 4EWEA 2Y8KA 4AEDC 2XCJA 1JBCA 2VZQA 5JZGB 3H3LA 1U12A 1XYPA 3ES1A 3N9PA 1DHKB 2WSUA 4G9SB 4PI0A 1U5IA 3VDCA 3MPBA 2PQSA 5A33B 1W2AX 2YZ4A 4X6QB 1MQTA 1GFF2 2MEV3 3PJQA 1E5HA 1ZNPA 4IE6A 3W58A 2X29A 2ZEXA 3KGZA 4GMP3 2X53S 4AR2A 3N4MA 1WW7A 4YZ3A 4XJZA 3AC0A 3U0ZA 4WM7B 4CU8A 3AK0A 4Q4W2 4LBJA 4ZS2A 1RUD3 4MGTA 2GN7A 3ZFFB 5CISA 4OI0A 2RJ2A 1CZTA 1RHI3 4HRAA 2FDJA 4RGKA 5AVPA 3RJRA 3GJBA 4JAAA 1C5HA 4XW3A 2CAUA 2FZ1A 1VB4A 2DU0A 2RR11 2Q8EA 4YZ5A 4IV1B 5HI0A 1JYIA 3ZYBA 5LBFA 2BFUS 3WOGA 1RIOA 1LCDA 2UU8A 3NRUA 3A23A 5JXGA 2PXBA 3WDVA 3M4FA 3CLCA 1SBDA 4JHZA 4YW4A 4A3ZA 5BNQA 2WFF1 3Q8EA 5A6QA 2ZHKA 1Q3EA 2WQ4A 5FZ8A 1WLWA 2XSDC 1S2BA 4UW4A 2XLGA 3W5MA 2RV9A 2YC2A 1HJFA 3FBYA 2AEZA 2DF7A 4DZGA 5LW9A 2HWB2 1AR72 4FPOB 4N53A 1QF3A 3IN9A 2ET1A 3WNXA 2D6PA 4Q0VA 1D7PM 2JG9C 3CNAA 1ZX5A 3R09A 1G9FA 4HETA 3ETQA 3HPNA 4N43A 1URXA 3V0BB 2O14A 1LOEA 1W6OA 2WIIB 3JQXA 3D0JA 2WDBA 4ER5A 4YG6A 1V9U3 5FYUA 4H7LA 1X33A 4KWKA 4I8TA 2HYXA 1V6OA 1UF2C 4OHYA 1XSQA 3VHNA 3WD5A 1Q8SA 3ZHIA 1IPKA 2E63A 2PTMA 4I0WB 2CROA 2PAEA 4UT5A 3H1WA 4GH4A 1PO21 4RQPC 1AX0A 5B4XA 3KCXA 2IXJA 4ARYA 1DYKA 5B2GB 5FK8A 1DZTA 1OQDA 1X9TA 4AVVA 1FOD2 2BNOA 1S55A 2EIDA 3M8LA 1IQAA 4L9BA 4F83A 5A6YA 4FTEA 5FY9A 4A7YA 1GT0C 1WUVA 3O0XA 1BKZA 4LKSA 4QQPA 3RRDA 3NSTA 4X6RB 2Y6FA 2RVAA 1U0AA 4Y22A 5DXDA 3ZFGA 4K8RB 4B7EA 2Q1MA 4UW5A 3ELNA 3THTA 1WCKA 1RITA 1KXGA 2J1EA 3FUQA 1RUE3 5C4WA 4JX0A 4KMQA 5T52A 4DXTA 2D43A 1UCXA 2HWD1 1X8EA 1DGRA 3MV11 4RS5A 3O14A 2PE5A 1BEV2 1GICA 1VIWB 4XFBA 4QU2A 3THPA 1JMUB 2XIUA 2Y60A 2Q8DA 5KHGA 2YB7A 4NHXA 1OLMA 2VCCA 3K48A 4Q4Y1 3URFA 3LAGA 3I3EA 3RJ2X 2VTXA 3KV6A 5DQ0A 3VWSA 1XWRA 1W8ZA 2JDNA 3M2MA 4HBNA 1W99A 3OSDA 4XQWA 5JZGC 3FLPA 1Y4WA 5EJ1B 5F37A 4Z59A 1W39A 3ZO0B 3BPSA 4KI5M 3HOBA 1VAMA 3LGRA 4S2GA 3GBWA 4I6TA 2G1MA 2Q30A 4M4RA 3THDA 3HQXA 4ZZ8A 2PUCA 5JIUA 1QJFA 1LHOA 4WM7C 4FBIA 4EZIA 3CEWA 1TEIA 4MGQA 1OOPB 2KR2A 2CL2A 2WWJA 4BJ0A 4CEWB 3KV9A 2ERFA 3ZFFC 2VZTA 4JCYA 2BGCA 5ISLA 4Z92B 5F3GA 3KL4A 3LQXA 1JN2P 3DYMA 3OGGA 2IVGA 2A6YA 1B35B 1CR7A 2Q4SA 1AR92 2XJSA 2YROA 3VUOA 2D3RA 1PM7A 1PZ8A 1W0PA 2VCAA 2IZWA 4GWMA 4BCUA 1PK6B 4AFCA 2WUSR 2NMOA 4IV1C 4V2VA 3R05A 2E31A 2F4LA 3OQNA 3IMMA 1STMA 5D21A 2RJKA 4AI1A 2VW2A 1XPWA 3VV1A 4C90A 1O3SA 2GNTA 3ATGA 4NWWA 1MEC3 1ULEA 3CZJA 2EXHA 3WP6A 1QJY1 3GXUA 4WBBA 4YYOA 2DCZA 5FP9A 1W6MB 1UTXA 1VBB3 4LKFA 1T6GC 1H2KA 1H4GA 1H30A 1NCQA 3OY8A 3K3OA 2YPJA 3VB9A 5CYYA 4CUAA 5IFPA 1VRH3 4RL7A 1GNHA 1GWMA 1O8PA 3BALA 4OZXA 3AL5A 4XURA 5FZEA 2GU9A 4CA9A 1JZ3A 5HCHA 4BH9A 2A3XA 5KC6A 4I02A 1UOBA 4XCBA 1ND2C 2GNMA 4HK9A 5LBCA 1K3IA 1O7FA 3VBOA 1RZRA 2Q0AA 5AC93 2RM21 3C2UA 1JZ5A 1J84A 1L1MA 2W0XA 3D82A 1YUDA 3POWA 4IXLA 1ULGA 4WVWA 1ULDA 3F6WA 2JX9A 2ORXA 3AM2A 1KJRA 1MVEA 2XOMA 4PT6A 5FUPA 2WZPP 4Z5CA 2JDUA 3UK9A 3MPPG 1GMMA 3CKHA 3WINE 3OJBA 1IKQA 4GB32 1GLHA 1HRV2 2JEMA 4I0BA 4IEZA 5DDJ2 2P2KA 3QOPA 5JXIA 4LIVA 2WAOA 4Q4V3 5C7GA 2ZABA 1X7NA 3BOWA 3D1NI 1Z7S2 1YYNA 3TNQA 4BQ4A 2EVXA 3GCWA 2FHRA 3TAYA 2V4AA 3GZDA 4ATEA 4B4QA 3N7JA 1EV13 4COUA 2P3KA 2ARCA 3HEIA 3AKRA 2ARXA 3E5QA 2XBO3 2VULA 4MXWA 3EJKA 4AVCA 5T55A 1QP7A 1VBC3 2E6VA 2WT0A 2XJQA 1IG3A 3ME2A 4LBKA 1VBD2 5A3WA 3I3QA 1LOBA 1LTEA 3OB8A 1BBT2 3POSA 4TXWA 3E6CC 4IQPA 1VBE3 1R092 5FWEA 4PLOA 3RNSA 4XZUG 4DRVA 4AEDA 5FQ0A 1ZRIA 5DZEA 5I0RA 1H2NA 2VE1A 5T5JA 4CXWA 1AL21 1LQCA 3NJYA 2IXKA 3BGAA 5EPAA 2VNVA 4BYYA 1CPNA 4IGPA 2DCYA 1XNAA 2DVAA 4QPGB 2A3YA 4MLOA 1QXPA 3DYOA 1GZWA 2R1BA 3OD4A 1RVF3 2VVFA 1KQRA 2VGDA 3ROUA 3D0SA 5FPZA 3WT3A 1GWKA 3ZPOA 4CP2A 1L3JA 5LK5A 2PYTA 2CAVA 2CV6A 4XDQA 5TSWA 3ZHMA 1VAVA 1H8VA 4NUBA 1RTVA 1LHNA 2EXIA 4Y1UA 5A32A 3PVNA 3IDEA 1B35C 3F51A 4FFHA 1PGL1 3DCQA 4LUKA 3SMHA 3M9LA 2JDYA 2GZWA 2W91A 5CVRA 3TN93 3VD7A 4Q4X3 1SEFA 4E8CA 5EYYA 4ES9A 2G4IA 4JGYB 3VKFC 4YGDA 3DKWA 4ER0A 4LE3A 1HKDA 3LEMA 1UYYA 2VQAA 3DUIA 3VL8A 3SC7X 4AFDA 4YFZA 4JVAA 1OPOA 4KWJA 1LGBA 1VLNA 2C1FA 2O4AA 2PAKA 2NYYA 4XILA 2W08A 3LFPA 3RPQA 4DXRA 2VMFA 4HN1A 4A7ZA 1UOGA 3G0TA 3DNVB 1OF3A 2VZ3A 4YZ1A 5CKMA 5FPAA 5JOWA 2BOIA 2ZHMA 3EBRA 2L8NA 4YGBA 4DXZA 1SLCA 4LKDA 1CX4A 2D5HA 2RE9A 4B4PA 1H9PA 2XLFA 4CVUA 5EIYB 4LUMA 2RHPA 5BNNC 1JUIA 2D6LX 2BNMA 2VEOA 2WT2A 3K2OA 2HWB1 2FMDA 3V0AB 1D0GA 1Q8VA 1ZBE2 3RDIA 4AI9A 1W8UA 2R073 2KPJA 4P5YA 2PXPA 3L2YA 2HINA 3BIEA 3ON7A 4ATFA 2VO5A 2ZA9A 1HN1A 3MLKA 1EAH1 2UY8A 3O0WA 3R4DB 3TELA 4UF0B 2KD7A 2D93A 4QXCA 4RQPA 5FPBA 2OKXA 4LT5A 1COV1 2BVBA 2XLAA 1IS6A 1HB3A 1V6LA 2JXAA 3A22A 1UXXX 4UBHA 3ZSKA 5FZ3A 1LMB3 1RUG3 2K46A 4UFHA 1NLSA 1UX7A 4DY3A 1C4RA 3CJIB 4A42A 1AU7A 2QZ2A 3HBKA 2PELA 3MDPA 4CUCA 1IGOA 1C8M3 3LKJA 4HKLA 2UWCA 2Z5WA 1YQ8A 3PDQA 3KWVA 3GZUC 1ST8A 2GH2A 1W2OA 1W2UA 2N7GA 2VMHA 3FJSA 1JU3A 5LA0A 3T2QA 1D4M1 5JMCA 2ICTA 1BYHA 2Q8OA 3GZEA 4MGIE 4Z58A 3VBHB 4HVOA 3AP5A 3JQWA 3GBGA 3ZYIB 4HSLA 3VBRA 4AAXA 2B39A 2Y6LA 4FOYA 3GUUA 1RUI2 4BZ4A 1IC8A 4AGGA 5JZGA 1AHSA 1PMHX 1RZSA 2ZCWA 1GU3A 2ADDA 5CB7A 1RUF3 4N43B 2LYPA 5A33A 4TYSA 1H6XA 3T2TA 2YGLA 2P5BA 4QPGC 2OA2A 3P6BA 2X09A 2RS12 4ZHNA 3MF9A 4E2GA 4K1YA 4Q2JA 3GNEA 1WD4A 3KZ4C 4FPCA 4WM7A 5JOZA 2OIIA 1XYOA 1YQ2A 1X57A 1POV0 2NQYA 4YLZA 3ZFFA 2R63A 4P9GA 3ITQA 1ZAYA 2WRAA 3NW4A 2PLV2 5DTMA 4FP2A 1UYXA 5FZ7A 1QKQA 4RGAA 2YU1A 4KGQA 3AZZA 3IZOA 3OGSA 4FVVA 4R4XA 2UY9A 1SFYA 5FPLA 1AZDA 1O3TA 5CZKA 3JD73 1RPEL 3ZVXA 3LDRA 1J3QA 1DGWA 1TMF1 2GC0A 4FCAA 4MXVA 4HKOA 4XIKA 4JGYC 3POIA 3KLSA 1WA4A 1QGLA 5G05L 5J37A 3M3IA 1YNAA 4BQYA 1F15A 1YC61 4Y1YA 2CGPA 3O1PA 1SHWB 1UMHA 3NROA 3CBNA 4TWTA 1A3KA 2MEV2 1E5RA 4Y5SA 5T5PA 3TOJA 3MFAA 4K40A 4CPBA 2ID4A 1V6KA 2QE3A 4ZKTB 3SITA 1W03A 5J09A 1XNKA 2VNRA 3OQOA 1QQAA 4ASLA 5C3RA 1ODMA 4XFCA 2LCVA 4BK5A 1RUD2 2WO3A 3AJYA 4GAZA 3GBFA 1IS3A 4X8NA 4QGLA 1ULFA 5L19A 1LODA 3V0BA 1GV9A 5BUVA 1RHI2 1R081 5EYXA 1W8OA 4R9DA 2Y33A 4ZS3A 3M3QA 3AYAA 1PGW1 1VB2A 5FXWA 3WDTA 1NUKA 2RG4A 1JOJA 1E5SA 2MPFA 2DTYA 3HN3A 3KMHA 3POYA 4HOOA 4COVA 1J3RA 4BQ3A 5IT6A 1NG0A 3RZJA 2D5FA 3OF1A 3AFKA 5FZKA 2DTWA 1ZA4A 4GALA 3WCRA 1S4CA 4EK9A 1G86A 2VZRA 1LHVA 1HJGA 3IDAA 3I97A 3B02A 1CESA 1C8NA 1LOFA 3VDBA 4LO7A 3VLBB 1EYBA 2XHNA 1FAYA 2AEYA 2CY6A 1RZRD 1GNZA 1QNWA 4FAHA 3LE0A 2YV8A 3CJIC 3AMNA 4GB31 3WDWA 3GZAA 2C9KA 4B3NA 3BN6A 3QWGA 1VP6A 3FE5A 4Q0QA 2A71A 4DE8A 2B7YA 3F95A 1AXZA 4XTPA 5FWJA 2QKDA 4MH0E 3JZVA 4PF5A 2Q8CA 3T2OA 4XUPA 3OEAA 5HPOA 3O7OA 5H9PA 1AYN2 2JECA 1BVP1 1RUH1 1VPHA 1XE0A 1SLBA 5ACA3 4TZDA 3ZX7A 3U3WA 4UWDA 1V9U2 2WUHA 3VBHC 4CP1A 5DZGA 2D6NA 3ACGA 3T30A 5JSRA 4QB6A 2R30A 1JFTA 3RFRA 4AI8A 2VQ0A 4M00A 4D7TA 3KS7A 4DS0A 3WHUA 5ANQA 4QPYA 3BIWE 5A70A 1JODA 3BB6A 4ONUA 3JUUA 4KWLA 5FY8A 3NNLA 1US2A 2AYHA 1XQNA 3ORJA 2PHTA 4DE9A 4N43C 1WCQA 2J7UA 1GBGA 1R091 3P3NA 4JRAA 4YW5A 3HMYA 3UKVA 3AFGA 3P3PA 1VRBA 1A78A 5CAZA 1L7LA 1QJU3 4UW6A 3MHZA 3V56A 3VL9A 4S2FA 3Q8AA 2KA3A 1YXWA 3WV6A 5I0SA 2VU9A 2XMLA 4NO4A 4OB4A 1OOPA 4D8MA 2LS6A 3WX5A 4CEWA 4FXGB 1VE0A 2AUWA 1C5IA 2RS51 1RUE2 1HQWA 2B9VA 1RMU3 4EE2A 4LHSA 2D6OX 3U4XA 1E5IA 3H7JA 3WG4A 2PHWA 2B5AA 4MO3M 5A7WA 2BU9A 4LBMA 3IBMA 1PK6A 4CP9A 3FHAA
chains in the Genus database with same CATH topology
4CDWB 2O8OA 5J7MA 3FYMA 2O1QA 3MW2A 4LR4A 2BNNA 3H5TA 2XVGA 5K0UB 3DPRB 4K6BA 4GQ7A 1WBFA 4OHVA 4RFT0 4EN6B 3OGJA 4XJ9A 4OI4A 1NY71 2HEWF 3WHTA 2HWC1 4XXAA 3AP6A 4AE2A 4HVQA 3J8F1 3A0KA 4OHZA 1YI7A 3K51A 3KGLA 1UZYA 5GJ6A 3FFZA 3MLJA 3IM0A 3KZ3A 3HAGA 4KH9A 1NCRB 2HEYF 4KG0A 5CFCB 4FT8A 4AW7A 2RMU3 2UURA 1ZZ8A 2ETEA 4JDNA 1B0NA 1GZWB 2WS93 1RJ7A 2ZX4A 5A7LA 1SQ8A 1MZEA 2HWF3 1AYM3 2LYSA 1MEC2 1LESA 2HYKA 1VALA 3H1MA 4BLIA 1LB2A 1V6MA 2BUKA 4I6RA 1F5FA 4JCKA 1VBB2 4XXPA 3MW3A 3TRSB 5GLUA 1PRUA 4Z1VA 2ZGRA 3AMPA 4JDOA 4KGGA 3MIFA 4XMAA 2LYRA 2V5YA 5AFBA 3PTYA 2IXCA 3AKSA 3H7YA 2DUPA 1H2LA 4P9IA 3WR0A 2EIGA 5JSOA 4PIXA 2OUJA 1JH5A 1XYNA 5AC92 4Z5DA 5BNOB 3GHNA 3SLIA 4DB5A 2ZZJA 4W6WA 2JE9A 3WCSA 1QDOA 2GRMA 2IXIA 4AEJA 3EO6A 3NKTA 2GC1A 4XEZA 1R1ZA 4Q4V2 4H3WA 4F7ZA 4YM2A 2E7TA 2C0ZA 2ZGLA 1DG6A 2NPIA 5L73A 1KITA 1EV12 2ZGUA 3D5OA 1YLLA 3OD0A 2XUMA 2VY0A 4YVWB 5CADA 2XBO2 2RS11 3E5XA 5CBLA 4OUSA 1ZBA1 3QCWA 1DGLA 1VBC2 4D3WA 1N1VA 4Q0PA 2FJRA 1SMVA 4DPNA 4IEXA 1VJ2A 1H1MA 1VBE2 4KBBA 5CU1A 3RMXA 5JWPA 2B9UA 2XKOA 1PIV3 3L9JT 1AR83 1FYUA 4JGYA 4AK3A 5EFUA 5K0UC 4EJRA 3FLTA 3DPRC 2FQPA 1UU5A 1QNYA 2LM3A 2XJTA 1B09A 2PUBA 1KFXL 4WM8B 5GZEA 1Q5OA 2R16A 1NA1A 4EV0A 4FPFA 3VBRB 1QQP1 2O8QA 5BV6A 1RVF2 3RYPA 4MV2A 1KDMA 1VR3A 3SCFA 3OYWB 2DVGA 4G3YC 2MEV1 3V64A 1NCRC 1ASJ3 5E88A 3GZTB 1LECA 5CFCC 4GMP1 2XB6C 4LBQA 3V0AA 4XFAA 4GWNA 4RHV3 4AGVA 4W6YA 2IFWA 1IOAA 1D4VB 1QJX3 4Q0SA 5EV7A 3TN92 4Q4X2 2VVEA 1HV1A 4K21A 4U36A 4X4GA 4XBQA 1PZ9A 2C9AA 3MFCA 1LENA 1RGSA 1YRZA 2E9QA 4BIFA 2WLQA 4PQ9A 3RYKA 3NJZA 2EBYA 3CJIA 4OHWA 3LSDA 2ILMA 1CJDA 1ZZ6A 4HKWA 3ZYPA 3I8TA 3TWIA 2A7AA 3FFQA 4GKYA 1YHFA 2IU7A 2XVLA 2IC1A 3ZXAC 5FO7B 1DQ1A 1DU3D 2ZAAA 1BJQA 2ZMKA 4ITCA 1FPN3 5GALA 2ENRA 5KHKA 1UL9A 3WZ1A 3RI8A 2PA7A 1RUC3 2VUAA 5GM0A 5GLVA 3VBHA 4EN9B 2QQPA 2BBVA 2LUWA 4K20A 3SISA 2R072 1SLAA 2RS33 4WZCA 5CA6A 3WG1A 4FOVA 1AYN1 2H0VA 4HANA 4LLOA 2RR13 4URTA 4XFHA 4BWOA 1QHDA 1QDCA 4GA9A 1XE7A 4LEJA 1RUG2 3TB0A 5GZGA 1O91A 4AGRA 1QU0A 1PVXA 1C8M2 3VGIA 3IPVB 3ES4A 4LO4B 3IIAA 4CP0A 1G7YA 1SBEA 2TEPA 1WMFA 1JYCA 1J59A 2ZMLA 3MIBA 3USUA 1RUE1 3MYXA 4K3UA 2OVUA 1JH9A 4XF3A 5CIRA 2DURA 5CG8A 4XMIA 4M0HA 5E89A 4Z2WA 2Y26A 5D1IA 1RUF2 2TBVA 1QH7A 3J4UH 3LWCA 4XE9A 2PHFA 1ZRDA 1QMJA 4WM8C 2W39A 4IV3B 1OFSA 5BYNA 1PO23 4QQHA 2HEVF 1S0CA 5I93A 2UWAA 3VBRC 2GNBA 4IEOA 1GZCA 1OPMA 3BCWA 4Y1XA 5BY5A 3MW4A 4BLJA 2LYQA 4IESA 1FV2A 4LBOA 4MUVA 4LLFA 4WV8A 1BCXA 1D0HA 1G8WA 1HX6A 4WVMB 2NZ9A 2D5VA 2Y38A 2UYAA 1OCTC 1CD3G 2I2SA 2OZJA 5KHIA 2HWD3 3JD72 4Q29A 3HT1A 4Y24A 1N3QA 1Q8QA 4I01A 1FI2A 1Q8PA 3ZN4A 1OD5A 5I8YA 4M01A 1LCCA 3M1HA 2W68A 2JVLA 3VZMA 4MGKE 1S0BA 5E8AA 5GLWA 5F5QA 4J1WA 3LZZA 4E9KA 3KQRA 3JBG1 4Q1PA 1G9AA 1MEC1 3H1YA 1AX2A 1X82A 1VBB1 2KEJA 4X4IA 1G9BA 3ZXDA 2IVBA 3AZXA 2R1JL 1DLLA 2BW8A 1FNYA 4ZU7A 1ZYBA 4Z5HA 2V73A 2NN8A 4V1PA 2D98A 4QGMA 2I07B 1WD3A 3QF3A 1V70A 1YFYA 2NM1A 5J98B 1G9DA 4QQOA 3HWJA 4META 4XF0A 1HXS1 4BE3A 2AREA 2DYCA 3BU7A 1CIWA 4XFIA 4Y1ZA 1RUOA 3W9AA 3BS3A 4QT6A 2VH9A 2P3IA 2DFCA 2WZR3 2QNKA 3M7AA 3IDBB 1EPZA 1AJKA 2NLRA 4B4RA 5GZCA 3CU7A 2OR1L 1QJY3 1XRUA 3PVEA 1WCDJ 3ZYJB 1CQ9A 1DGWX 4YG0A 2DVBA 4P9XA 3AYCA 2JENA 1H8TB 1OA4A 5C8CA 1OA2A 3ZFEB 1ZVVA 2ZX1A 3NV4A 4L2NA 3JXBC 1LOFC 2LTNA 5ACA2 2FZ2A 1EV11 2DCJA 1POV3 5JVVA 4NOTA 3APBA 4CDWA 1R1A1 4OUMA 2XL9A 3QLQA 2RM23 1MS5A 2A73B 2XBO1 5K0UA 3B3QE 3DPRA 1C57A 3B01A 3H50A 4JGZA 3VBFB 2BWCA 4Y26A 3RI9A 1ZVFA 1U5ZA 5FMOL 4E2SA 4R8HA 4FPGA 4IV3C 3HBZA 3O0VA 4HLTA 3CF6E 3KT7A 4AI0A 4EROA 1Z78A 2AENA 2AH2A 4HFSA 2EWTA 2RJLA 4S2HA 4ZU5A 2ZGKA 5KHHA 3S6PA 1NCRA 1HQLA 1RMU2 3HD8B 5CFCA 1WLCA 1FMD1 1RVF1 1JHNA 4HK8A 2ZHLA 4XJWA 4E27A 1ZS4A 2QDNA 1DQ5A 4YFZA 1CVNA 3J9SA 1ZPQA 4HVRA 2GZUA 4J1XA 2PHDA 4R9BA 2L49A 3VZJA 1UXCA 4AEKA 1OOPC 4CEWC 1VAKA 4YZ4A 2PUEA 3TYJA 2K2SA 3BODA 1UKRA 2BQPA 2FMYA 1QH6A 4Q4W1 4DQAA 3SH5A 2DV9A 1MS3A 1PK6C 2XI8A 3I54A 1RUJ3 1FXZA 2YYOA 1X2LA 3MICA 3MIEA 2ZGMA 1W6QB 2E7AA 3H9AA 1O3QA 4XPVA 1IS5A 1HRI3 3TRBA 4Q0UA 4YM0A 2X8KA 1XU1A 3ST7A 2WIUB 2RMU2 5BNOA 2VW1A 5ABJB 1NA1B 2WS92 1S0IA 1YCIA 2VOXA 3HN1A 1N47A 4MX3A 4XOGA 5IK5A 1ZREA 2HWF2 3VKOA 1R69A 4C1XA 2BYVE 4XFFA 1S0JA 1AR62 4FTSA 1LOGA 1QWRA 1PO12 3N7MA 2R071 1AR71 1F9KA 1FT9A 4LBQB 4BOWA 1AX1A 4LTAA 2XKPA 5AFEA 1YJLA 1QP0A 4QGNA 3U07A 3VK0A 4PIYA 3BD1A 4LBLA 3JXDL 4YVWA 5I0TA 4YW1A 2VOKA 2K0GA 3ZFEC 2ICPA 1OQEA 1BK1A 2WNVB 3WQ0A 2DUOA 2XWJB 1PVC3 1YI9A 3TBDA 4K7JA 3BTAA 1S0FA 1HLCA 4OULA 3O12A 4XJ8A 5CNAA 2PUAA 4FBFA 1FOD1 3SH3A 2C5DA 3JU9A 3VBFC 2A6ZA 4FXKB 4AQ6A 4HL0A 3MI8A 4Q26A 4WM8A 4CEYB 1EAH3 3LB9A 1ENRA 4MGYE 4COYA 1COV3 3R4SA 4X4BA 4P5HA 1DQ2A 2CGOA 5SV5A 3H8UA 5FOJB 4W6XA 2A6VA 1BEV1 3DGTA 3OYWA 2OYZA 3AZWA 1HQNA 1OLRA 5A3MA 2MQKA 1WMDA 3IVPA 1UU4A 2YDEA 2ZBJA 3FHIB 4FPLA 5F6KA 1WLDA 4K8FA 1D4M3 3S7IA 1PIV2 2B5HA 1AR82 2D6MA 3SCGA 4XYXA 4PIZA 1J3PA 2H8RA 5FFOC 2E53A 4YVSA 4A7KA 4PU7A 3V65A 1R63A 1NYWA 2TNFA 2ARBA 3KCCA 2R063 1M06G 2Z42A 3RYRA 1VBA3 3USUB 1F5JA 4CZSA 1WW5A 3SH4A 3VKLA 1AR91 4NVPA 3H3ZA 4CTEA 5AVAA 2G9GA 1S0DA 2XL7A 3CL1A 5JOXA 4UXAA 4TSVA 1PZ7A 3VKNA 1ASJ2 1O4XA 3L2HA 1UIKA 3B5LB 4ASMB 1NA1C 4RHV2 5JCTA 3ZPYA 4YGEA 2LYJA 1N3OA 1QJX2 4FPJA 2VECA 1TNRA 1NEQA 1DQ4A 1C3HA 2F4PA 2I74A 2QUOA 3ZSMA 4N9IA 1TMF3 4CRQA 2KXLA 4PCRA 4YM1A 3IWZA 4FO9A 3UV9A 2Z2SB 5IK4A 4PBOA 1W6NB 3ZKCA 1X50A 5CG9A 4Y20B 1I9RA 4KG8A 3HR9A 1LU1A 2XHKA 1J58A 3IPVA 5T50A 4N90A 2MEZA 1OI6A 4IWRA 2JD4A 4AYUA 3PHMA 4OI1A 1E57A 4IEUA 1FPN2 2VXRA 2WNVC 2ZAHA 3H3UA 2ZX3A 1V00A 1RUC2 2IVQA 1I6XA 1Z0HA 1HRV1 2SBAA 5GLZA 1O3RA 2EALA 4FPKA 5DDJ1 1QJZA 1RC6A 1R083 2RS32 5I8SA 4XJUA 5ACA1 1PRAA 2RR12 1Z7S1 4E2QA 5GLTA 4FPHA 1FX5A 3PNAA 3WG2A 3ZMNA 1OQ1A 3UKTA 1C1LA 2D6KA 2OZ6A 4IV3A 2HKXA 3AX4A 4BHPA 5KXDA 5I0UA 2YMZA 4J6GA 5FLHA 3WUCA 1IZ3A 1H0BA 3VZKA 3SCHA 5JI7A 4EN8B 3UJQA 1VBD1 1WW4A 4RSUA 4AI2A 4GB33 4FAGA 5E1RA 1BBT1 1NXD1 1O5UA 3B7MA 4WVMA 3EUSA 1KDKA 3M70A 3WUDA 2NMNA 5EWSA 1CAUB 1KD7A 3MGUA 2SLIA 1MVQA 1WETA 1RUH3 2WJSA 2GNDA 4B29A 1MS8A 1RMU1 2BFUL 1UAIA 5C8CB 2YGMA 2A3WA 5DG2A 5FRAA 5H9RA 2ZOEB 4AQTA 1HIXA 1LCLA 3C3VA 3KB5A 4IEVA 3OQMA 5BPXA 1W0OA 1J1TA 1V6IA 1PO22 1BQPA 2BPA2 2R043 4BA6A 4QD2A 1CONA 3VBSB 2XGXA 1UIJA 4JGZB 4W65A 5JPMB 3T1LA 1O4ZA 3OTFA 5K7PA 3RQ0A 3KJXA 2RS53 1OFNA 4BM8A 3AP9A 1OMIA 1LJ7A 1SCRA 3VZNA 4YBAA 1WBLA 2ZACA 4PLMA 3AKPA 4OHXA 2RMU1 5JSPA 1EY2A 4EN0A 4FPYA