1ZZ7A

Crystal structure of feii hppe in complex with substrate form 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
192
structure length
178
Chain Sequence
ASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxyprophylphosphonic Acid Epoxidase
total genus 41
structure length 178
sequence length 192
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz7A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz7A02
3RYKA 3F52A 1YHFA 2D93A 3H3ZA 1OCTC 1RIOA 4HVQA 4J1WA 1FXZA 2EF8A 1CAXB 4X4BA 2IXCA 4YARA 3SCFA 2H0VA 3RDIA 2O8QA 4D7SA 2CSFA 2WUSR 2C0ZA 5LEKA 4IEXA 3QACA 2CAVA 4O8BA 2MNGA 3QYXA 4MGYE 4JCYA 2KPJA 2B8MA 4Z5DA 1YLLA 3DV8A 4PIXA 2OZ6A 4Q0QA 3S7IA 3EO6A 1JUHA 2OYZA 4I0AA 5J3UA 3USSA 2PIJA 4MCXA 4TLFA 4PIYA 1RPEL 5LRSA 1Y3TA 5JCTA 1SFNA 1YFXA 4HMZA 3IWZA 3L1PA 3OF1A 3R1FA 5BPXA 5I0RA 1XE8A 5A7LA 2O1QA 5T3NA 5FDBA 2UY8A 3I54A 1PERL 4F7ZA 2A6CA 3BU7A 1GQGA 4D7TA 2MHFA 1L3JA 1O4TA 2PPXA 4KWKA 2K9ZA 3BCWA 4QM8A 2IUOA 3ST7A 2IVBA 1NYWA 4EROA 1XWRA 2JCGA 2LYPA 1UW8A 4IA8A 4YG7B 3QOPA 1XRUA 4MGKE 4PU8A 1I6XA 1UIJA 4X4IA 3EJKA 1VPWA 1Y7YA 4FT8A 5K8SA 1QQBA 4AVBA 3MDPA 4JV4A 3FWEA 1J3QA 1QWRA 4LUKA 1O4XA 4JQDA 4OLLA 1ZZ7A 3VK0A 1JH9A 4PJYA 3OD0A 5BXXA 3CROL 3BPZA 4F8DA 2MEZA 3VHRA 4LEJA 1YFWA 3G7DA 2AW6A 2PUEA 4I8TA 5FLJA 2B5AA 5HI0A 3BD1A 3BDNA 4RD7A 3CLPA 4IVZA 2PTMA 3WW2A 2EA7A 1X7NA 4KU7A 1J58A 1DZTA 1ZRCA 4Q0UA 1RL3A 1L1MA 3EQEA 2LYRA 1LKNA 4MGIE 2B5HA 2K0GA 3U10A 3PNAA 3IBMA 4FAHA 1NE6A 5FCCA 3I7DA 1WH8A 3FHIB 2ET7A 3UKTA 3QQ6A 1OSLA 4EWDA 4ZU4A 1X8MA 3RYPA 5CU1A 2BJCA 3SCHA 2PA7A 3MPBA 1ADRA 1J59A 2PFWA 4IERA 1NZCA 3JXCL 3KSCA 4NDWA 3D0JA 4N9IA 1AU7A 2HINA 1I5ZA 4XF0A 4X4CA 3MZHA 2R1JL 1LLIA 2O38A 1LR5A 2QCSB 5I8SA 1SEFA 1YFUA 3OCPA 3O9XA 3FFQA 4IEYA 4WVZA 3I59B 5CADA 4IETA 2GC0A 3MYXA 3L2HA 1O3QA 2LYJA 3C3VA 5LEJA 4Q0VA 1ZZCA 4X4HA 1O5LA 1NEQA 1J3RA 1H1MA 1WGPA 2XL9A 1X2LA 4I6RA 2H6BA 1XE7A 2GZUA 3H1MA 1G6NA 2BEOA 3E5XA 1ZX5A 4IEPA 3U11A 2PUGA 4H7LA 4AXOA 2OZJA 4LUMA 4FBFA 4XF3A 2WC2A 3CL1A 2XCJA 2PUAA 1HW5A 4UXAA 2OR1L 2IXLA 3OTFA 2CROA 2XKOA 3EBRA 5FPXA 1R63A 1EP0A 5KHGA 3QF3A 2UYBA 1Q5OA 2PQQA 2PUCA 4I2OA 1QQAA 4IEWA 2PHDA 2Y0OA 1Y9QA 2Q4SA 5I93A 5KHIA 1X82A 3CLCA 4AVCA 1GT0C 4META 4OFGA 3U3WA 4Z58A 2KEJA 4XFBA 4NVPA 3OQMA 2HSGA 2ICTA 2ETEA 2WFPA 2OA2A 3PLQA 2XLAA 3SMHA 3WW1A 3PVBB 1IC8A 1ZZBA 1RZRD 4YG4A 3GBFA 3WW3A 1RZRA 2XIUA 2Q0AA 5D1IA 3H9AA 4WZCA 4MZUA 4JVAA 1ZNPA 3H3UA 2IXHA 4IEVA 1H1IA 1O3SA 3OQNA 2KXLA 5LRRA 3R6SA 1LRHA 4XF1A 2CGPA 1DW9A 1Q43A 5E16A 1LMB3 3CO2A 2PAEA 2IXKA 3HQXA 3KGZA 3H5TA 1RGSA 2DCTA 2QDRA 2KZ8A 2PAMA 4I0BA 2ZKLA 2EWTA 3EUSA 2ICPA 3RYRA 5FQ0B 2O4AA 4A2UA 3WW4A 4MV2A 4XEZA 4CYDA 1O3RA 1JFTA 2D5HA 5I91A 3ES4A 1CAXA 2BNOA 4FAGA 5I0UA 2QJVA 3HT1A 3OP9A 2JVLA 4L11A 4GQMA 2GAUA 3BALA 3NVCA 2B9UA 2BGCA 3HZIB 4HLTA 3S7EA 2O49A 4Y42A 5C6CA 3DKWA 5KHHA 2LYQA 2IV1A 5FQ0A 1QP0A 1OFNA 3TNPB 3GYDA 5CVRA 3E5QA 2PE5A 4X4FA 1SQ4A 1CJGA 1EFAA 4MH0E 2IVGA 1HF0A 1QP4A 4Z82A 5EZWA 1DWKA 3LA3A 4XETA 4XFFA 4XFIA 4XF9A 1RUOA 3ELNA 1CAWB 1QP7A 1UD1A 3NL1A 5FPZA 4X4DA 4IWRA 1QXJA 1B0NA 4IEQA 2WIUB 1ZVFA 2BYVE 2L8NA 4GULA 2CAUA 4YRDA 3LISA 3H7JA 1VJ2A 2LCVA 2D5FA 1O3TA 3GN5A 1WA4A 3NSTA 3ZKCA 1ZVVA 4ONUA 1WETA 4WBBA 4ZU5A 1LB2A 3E6BA 1LCCA 4BHPA 2UYAA 3B7HA 4KWLA 4PIZA 2LYKA 3OGJA 2I45A 4IEUA 3SHRA 1WH6A 3LA2A 3LOIA 3MLFA 4Z5CA 3DNVB 1ZZ9A 2Z69A 2BNNA 3DN7A 3ES1A 3LAGA 3NKTA 3NW4A 4QX5A 1ZREA 4HBNA 3H1WA 1ZUGA 3HIFA 4PU3C 4IEZA 2L49A 2QVSB 2AXUA 3E97A 3KCCA 2R63A 5KBFA 1OD5A 4HVOA 4XFCA 1ZZ8A 1QXRA 3UKNA 3QWGA 2VECA 2PHLA 1WIZA 1UIKA 1UXCA 1QY4A 3OQOA 2FMYA 2BNMA 4I6UA 2H6CA 4MUVA 3JXBC 1VR3A 1ZAYA 1FI2A 4BIFA 4ORFA 4I6TA 3E6CC 2ET1A 4LA2A 1SQ8A 3KMHA 2H8RA 1RC6A 3LZZA 4XFGA 2N7GA 2GU9A 4JCXA 2GC3A 4XFAA 1GQHA 4YSFA 2AXVA 2AUWA 2KEIA 2GZWA 4E2QA 4LLOA 4QMAA 1BDHA 4K8FA 5JR7B 1QPZA 4FBIA 2GRMA 3EHKA 3NJZA 5KHKA 4HZFA 4X6QB 4YG1A 3ETQA 4UBGA 4I3PA 4LULA 4Q29A 2OFYA 5K98B 3H7YA 3KXAA 2AWIA 1DGWA 4YYOA 1NERA 5BY5A 1LQCA 2Q30A 2IU7A 1EY2A 5J48A 2XI8A 3TNQA 4ZU7A 4J1XA 3S0MA 3B02A 2IVQA 1J3PA 1TQ5A 3FJSA 4N9HA 3UFDA 1ZRRA 2PUBA 4PU7A 1YFYA 2ZCWA 4I02A 2XJ3A 4KU8A 1CAUA 2UY9A 3FX3A 1RZSA 4O9EA 2D40A 1X57A 4HSLA 3SXWA 3F6WA 3KZ3A 2XSDC 1OI6A 1POUA 2IC1A 2LYLA 3FZ3A 5KHJA 5FLIA 2E9QA 1PRUA 5C8WA 4OB4A 2FJRA 1PRVA 1CAVA 1O7FA 4I09A 5J7MA 3FYMA 3ZHIA 4KL1A 2IXJA 3UKVA 2XHKA 3GN5B 4QGNA 4UBHA 3DL3A 4Z07A 1Q3EA 4Q0PA 3TRBA 4P9GA 3ROUA 1WLTA 4XF4A 3KJXA 3FE5A 1DZRA 3S8QA 1X8EA 4AQ6A 4O9GA 4JTNA 2FQPA 1CAUB 4DINB 1RTVA 3JZVA 4I01A 4AVAA 3LWCA 4HVRA 5E1RA 1VP6A 4YBAA 2XLGA 2XKPA 4R52A 2VQAA 4Q0SA 3E5UA 3U0ZA 2Q1ZB 3JXDL 4X4EA 3CJXA 3G5GA 2HJIA 5I0SA 2LYSA 4Z5HA 1NE4A 1YSEA 1UPIA 3H8UA 4QM9A 2GC2A 5BV6A 2OPKA 1YUDA 1EYBA 1ZS4A 1J1LA 2PAKA 2V09A 3LA7A 1PRAA 4MCTA 3CECA 4EV0A 2PUFA 1EPZA 4BYYA 3CEWA 2P17A 3IDCB 1CGPA 2CV6A 2Z2SB 4B29A 5AVPA 3FMYA 1NXMA 3RZZA 3F51A 1JWLA 2EAAA 4IEOA 2IXIA 4MX3A 2MQKA 1O5UA 1PM7A 4IESA 2GC1A 5I8YA 2XLFA 5JSPA 3CF6E 4GHJA 4X6RB 2KEKA 1E3OC 1ZZ6A 3D0SA 2VPVA 1PMIA 5EFUA 4EWEA 1ZRFA 5I0TA 2QNKA 4HN1A 2PUDA 5BUVA 3FYAA 5JSRA 4MGZE 1S7EA 1V70A 3IIAA 5FLHA 4F8AA 1RUNA 4EWAA 3H1YA 1JFSA 1CQTA 4PU4C 3E6DA 2AXZA 4YNIA 4XFHA 3D1NI 3N4MA 3M3IA 4QGMA 1LCDA 3ZDSA 3RNSA 3H50A 3SCGA 4JTOA 4FN3A 1ZRDA 1R69A 1CAVB 3ACLA 4LA3A 4Z59A 4R8HA 4E2SA 2XGXA 1ZPQA 4KWJA 1UCXA 2D5VA 1CAWA 2MPFA 2XL7A 1DGRA 1YWKA 3ZHMA 3OMTA 5F1RA 3IDBB 4HSJA 1IPJA 5JAXA 4BH9A 2GRLA 3HT2A 3LFPA 3IVPA 4QXKA 2EBYA 3PXPA 1UXDA 3BB6A 2ATFA 4AQ2A 3O14A 2EVXA 3I59A 3KGLA 4X4GA 1PNRA 5JSOA 3RPQA 1IPKA 1FT9A 4L2NA 3D82A 4LTAA 1UTXA 4QGLA 2GH2A 5I8TA 1OMIA 3M70A 4HN0A 4E2GA 1CX4A 2HKXA 1U12A 1BDIA 3BS3A 2PYTA 2F4PA
chains in the Genus database with same CATH superfamily
1AR82 1F9KA 2C9KA 3AFGA 1HJFA 3HQUA 2D93A 5GLVA 1OCTC 3GDBA 4HVQA 2VC9A 1FXZA 3UYJA 4A6OA 4UT5A 3VBOB 2IXCA 4Y5SA 5FOBB 2HWF1 4QKDA 1XNCA 5C3OA 3IDEA 2O8QA 4M3CB 1W03A 1K3IA 1N3PA 5LEKA 5F5CA 2ZEXA 2WKKA 4L0PA 2YPDA 2CAVA 4UF0A 5K0UC 4FFFA 1S0EA 3QYXA 2MNGA 3T0AA 1LULA 4MGYE 2QQUA 4JCYA 3V0BA 4RHV2 4FPJA 4OI4A 4QPIB 4Z5DA 1YLLA 4PIXA 1RUI1 3WX5A 3S7IA 1S4CA 2CSGA 3EO6A 3LKJA 3N9OA 1LHOA 5EJ3A 5J09A 2BBAA 4BXSV 4MCXA 2ZHKA 5L7OA 3MW2A 3L9JT 3VBUC 1Y3TA 3AKPA 2HWE1 1V9U2 1H30A 2E32A 2OXBA 1UY1A 1KQRA 4QHZA 2WT0A 1XE8A 1LAJA 2ADDA 4LHKA 4JQTA 4BLIA 2A6CA 1IOAA 1S0CA 5KC6A 3RRDA 1N3QA 4S2GA 3H8XA 2JB4A 2K9ZA 3USUB 4CDXA 1KDMA 2YGMA 3WQ1A 1BJQA 2PN5A 2IVBA 4EROA 1DIWA 3OYWA 3POIA 1UW8A 5KXCA 5G05L 5DRYA 1RUC3 4IA8A 1OF4A 2P5BA 3PU3A 1PHMA 3ZFFA 4X4IA 4NR1A 1XNAA 5FMCA 1Y7YA 3ZYGA 3ZDVA 5K8SA 3DYMA 4EN7B 1J84A 2PXFA 1SDDB 1WBLA 5T52A 2B39A 4AVBA 3FWEA 2RS13 2OT7A 4ISRA 2WRAA 1O4XA 5FPLA 1ZZ7A 5A6ZA 4KGGA 1JYNA 1V6KA 3KF5A 3LEIA 1YI7A 1MS5A 2A6XA 2BWCA 2VOKA 2GN3A 5FLJA 5BNNC 5FZMA 4AOCA 1VBD3 3BDNA 3KD4A 2VGDA 3HEIA 5LCWL 4MXWB 1UX7A 2EA7A 1FOD3 2A3XA 2JXAA 2QQWA 3FHAA 3K46A 2CWSA 4MADA 4IV3A 2WO2A 5EJZB 4OQ8A 5JDBA 4FTBA 2VMEA 4BXFA 2QDNA 3EQEA 1LKNA 1QF3A 3WNLA 1DQ4A 1LOCA 4GWMA 1BXHA 2HWD1 4OCTA 4PBOA 4LBKA 3WCRA 1LTEA 5E6HA 2VAUA 2PXUA 2Y6JA 3WCSA 1SLTA 4EWDA 1HXS3 4AFAA 2VMIA 1AYN2 1NAEA 3RVHA 2YPJA 4ZU4A 3SKJE 4YZ3A 3T09A 1GZCA 5SV8A 1UAIA 1UWWA 2R6QA 3SCHA 3AZXA 4D8MA 4JAAA 2E6VA 1IKQA 1ADRA 4GA9A 1SACA 5CFCA 1U5XA 1B09A 5M0TA 1AXKA 4BQ1A 3W5NA 1W6PA 4YWAA 2VU9A 2DBIA 4UFIA 4WM7A 4YW3A 5LY2A 3V64A 3MIHA 2VVDA 2ZGSA 4X4CA 4HT1T 5FUNA 2FDIA 4IGQA 1LR5A 4IQPA 4CCCA 3WP3A 1YFUA 4DMIA 2RE9A 4A44A 4RL7A 1SPPB 2MEV3 4XZPA 1Y4WA 4IEYA 3I59B 3SR4A 1AYM2 4IETA 4LBQD 1XSRA 4Q4X3 1OXCA 1UY0A 2B7YA 3BTYA 2LYJA 2PLV3 4CEYB 1GLHA 3WDUA 4C0HA 4XCAA 5EP9A 4B1MA 1NEQA 5FYBA 1UPSA 2LTNA 5J1XA 2GZUA 1G6NA 1ODMA 2BEOA 2EXJA 1NCQB 2TUNA 2UWCA 3GZUC 1MS0A 4K7JA 3U4XA 3VHOA 4H7LA 1UKRA 1QQP1 2YBPA 5F2SA 3VKMA 2OZJA 1DYKA 5C5UA 3AMPA 1G9BA 1COV3 4H2AA 4Q1RA 2WABA 3VBSB 4XF3A 3POFA 2WC2A 1W9YA 2WSVA 5JOXA 4OI1A 1LOAA 3N35A 2WNUA 5GZDA 4YG0A 1PO21 1GANA 1UYZA 1QJEA 1ND2A 3EBRA 2XXQA 2YC0A 1ULFA 2PXQA 2LNMA 1A8DA 5L9BA 3VBRC 3ZSMA 4BISA 5HV4A 4QHBA 1OA3A 1W6OB 1REDA 3Q8AA 3O1OA 2UYBA 5BNOA 1HV0A 3BYWA 1H8TC 5DZFA 4CVUA 5I93A 5KHIA 1ZBA2 1GT0C 1ZM1A 1AHSA 3OGRA 5C70A 2RJLA 5KXBA 4Z58A 1EV11 2WINB 4CP2A 2KEJA 4BK4A 1R093 3OQMA 2ICTA 1RUI2 2CNAA 4N53B 1T6BX 3ZXGA 1OVSA 2JICA 1ZZBA 4YG4A 4OUMA 3GBFA 3MHZA 3WW3A 2FBEA 1VE0A 1JN2P 3RFRA 1GKBA 4CCOA 4QX2A 4LO7A 4LKSA 1F5FA 1ND3B 4AEDB 5GZGA 1UMHA 4IEVA 1DLLA 1H1IA 3J8F3 4BJ0A 3B93A 5B2GB 3RZMA 1W8TA 1DGWX 4LXLA 4XF1A 3FUQA 1Q43A 5E16A 3WNNA 5D8AA 1PIV2 1UY2A 2AEZA 5BNPC 2VQTA 2IXKA 3KGZA 5FBJA 2DCTA 2QDRA 4FPGA 4JKLA 1W8UA 2EWTA 3QOXA 1WLCA 2ES3A 3RYRA 5FQ0B 2VY0A 5HV0A 1CQ9A 4FP2A 4UWDA 1NLRA 3LIGA 4XEZA 2FZ2A 3PJQA 1AR81 4JGZA 4XYXA 4LHSA 3ZIWA 4COUA 5I0UA 3G0TA 1YJKA 2QJVA 3OP9A 2JVLA 1J83A 4RGAA 4I30A 4L11A 2GAUA 3NVCA 3UWPA 3POBA 3V56A 4AE2A 4GWIA 3ZR5A 2Q5TA 3LQXA 5LK5A 2Q1FA 2A6YA 2LW8A 3TEPA 4LO5B 4AEDA 1DQ2A 3I8TA 5J37A 4LOTA 1CIWA 2VCAA 4NWVA 3RWKX 3ZLIA 2JENA 1Q8QA 1VMFA 2DYCA 4MH0E 1ND2C 2VEOA 4Q5OA 1G9CA 2IVGA 2UU8A 2VNVA 2GN7A 5F5AA 1US3A 3IMMA 3ACIA 2G9FA 4LO8A 3ELNA 2XJTA 3PVNA 3OOXA 4N90A 4Q4W1 1V6JA 4N43C 5H9SA 1QMJA 1SCSA 1UMIA 1B0NA 1IS6A 2QQIA 2WIUB 1ZVFA 4ATEA 4GULA 3LISA 4FPCA 1MQTA 2LCVA 2ARBA 3ECQA 2X10A 4K21A 1E5SA 1IS5A 3NSTA 4M0HA 4NPRA 4Y1VA 3IMNA 3E6BA 3ON7A 1DYPA 3PJYA 2UYAA 3B7HA 1KD7A 3DPRC 4KWLA 4QPGC 5LBEA 1RUG3 1AX2A 2I74A 1W8ZA 1POV3 2LYKA 1S2KA 1V9U3 4OZOA 2QKDA 2ZHNA 2FMDA 5F3EA 4QU2A 3ZFEB 2ENRA 2RHPA 3VZKA 5T5PA 1WH6A 3MICA 3VDCA 3MLFA 2G1MA 1TVGA 2BNNA 4K40A 3LAGA 3NKTA 4FTSA 5IJRA 4Q8KA 1ZREA 4HBNA 3AJZA 4BE3A 2ARCA 4PU3C 1XC6A 4IEZA 5CKNA 5IFTA 1BEV3 1OLMA 1GWKA 2WR9A 3E97A 2R63A 1QGLA 1RUC2 2IZWA 2V5YA 4XJ9A 3RWNA 4HVOA 1XNBA 3OUHA 4HFSA 4RFT0 4RGKA 5L73A 1JYVA 2WDBA 1PZ9A 2JE8A 1WD3A 2J1RA 1C5IA 4HXCA 4MHRA 4Y1UA 3HN1A 1GWLA 5APAA 2ZAAA 2VBBA 5DXDA 2WZR1 3GGLA 3OQOA 3K51A 4K9SA 3OPWA 1W6OA 4I6UA 3ETPA 1W8WA 3JXBC 2VOTA 1VR3A 3UGFA 2WN3A 4BIFA 4JQRA 1RUG1 3VD7A 1OA4A 2D97A 1W2NA 2HWC2 2J22A 1DFQA 3USUA 4CDXB 1UU6A 1CZSA 4QX0A 2HEVF 1DYOA 3KMHA 2NYYA 1HQNA 3THDA 2ORXA 4RHV3 2EIEA 5IUQA 2EIGA 3IIIA 4YSFA 1VBA2 2EXHA 2JECA 1OOPB 5IAVA 1RUE3 3N7JA 1NA1C 5KWRA 1F5JA 4OHXA 5FY4A 5CISA 1SLAA 1MZFA 3UNPA 5CAZA 3TN93 5FZEA 2GNDA 5A7PA 3POYA 3DPRA 4FBIA 4BDVB 2W1SA 5LBBA 3O1UA 1GMMA 4HZFA 3WDVA 5C9AC 1F15A 2W92A 1ZBE3 2W68A 4Q4V1 4B1LA 1JMUB 4LULA 3UGHA 2CGNA 1AL0G 5ACA3 4OZXA 1DGWA 1QHDA 4YYOA 1YC61 5FJKA 3ZFGA 1AR73 4QB2A 2H0BA 3IAPA 2OIIA 4JDOA 1VAMA 1QJU1 4EKGA 2DWRA 1AR62 2CYFA 3JD72 2XWBB 4QKBA 3TELA 2VNGA 4N9HA 3UFDA 4KU8A 4PU7A 2JKBA 4I02A 2J1VA 1H6XA 1MS9A 1URXA 1CJPA 5A7WA 5GKAC 2YBSA 2R072 3HMYA 1OOPA 3TEZA 1QXPA 1RZSA 5FTTC 3ZXDA 2VZTA 2VZOA 3X29B 1JZ7A 5GJ6A 3J8F2 2IC1A 1STMA 1RMU2 5LBFA 3B94A 4XURA 5HCHA 1UZ0A 1WCUA 2WZR3 2WSUA 5F5IA 1IS4A 4JGZC 3D4KA 5FMDA 3FYMA 5J7MA 4W6YA 2XJPA 4KL1A 3VBUB 3ZSJA 1RUF1 3MUZ1 3JD71 4MGTA 1W9TA 3NAPA 4Z2AA 5T55A 3NMBA 1REEA 2Y6HA 1PO13 1VB2A 1C8M1 3ITQA 3N7MA 3NV3A 1Q3EA 1U2ZA 1WKYA 4YM1A 1XE0A 4XF4A 4P14A 3KJXA 4XE9A 1DZRA 2NMOA 1RB8G 1W8FA 3JUUA 4HKLA 4IV3C 4O9GA 3WP4A 5DTRA 2ZACA 2D3PA 4I01A 4ES9A 2J1AA 4HVRA 3J26N 3N9NA 1VP6A 2XKPA 1ULDA 2QQKA 4XXAA 4EZHA 4R52A 2XONA 1BHGA 2VQAA 3IM0A 4Q0SA 4KNCA 5DUXA 3U0ZA 1HB3A 1DU3D 1JZ3A 1FV2A 4X4EA 3I3BA 1JU4A 4AFCA 2HJIA 5C3QA 4Z5HA 1UY3A 1NE4A 3ZR6A 3RSJA 3WUCA 4QM9A 5FWEA 2HYKA 5BV6A 3FFZA 4PBPA 4XMAA 2DTWA 4Y4RA 1RUH2 1EYBA 4GAZA 4IXLA 2PAKA 5FY7A 4H7MA 1HB4A 3AP7A 3LA7A 1ENQA 3ZPXA 1EPZA 4UW3A 1H8TA 1CGPA 1RHI3 1YRZA 1KJLA 1COV1 1BBT1 5JPMB 4LQRA 1EPWA 2EAAA 2IXIA 1BVVA 3MLLA 2MQKA 5DRTA 4CP0A 5I8YA 3BI3A 3CF6E 3KQ4B 1B35B 2P6CA 4X6RB 5JVVA 3D0SA 5EFUA 1PMIA 3KQRA 4CDUA 4L8QA 4CXWA 1W2AX 2PHWA 4COYA 3BTZA 3QBQA 3ZIXA 2DUQA 4LKDA 1K42A 5FYCA 3QLQA 5FLHA 4F8AA 2NN8A 3GZTB 4J25A 4EWAA 3H1YA 4PQQA 4OI2A 1WUVA 3F2ZA 5A6QA 3A7QA 2XUEA 3I4IA 1PGW2 5GLUA 3ACFA 3N4MA 1DZQA 3JB8A 5K0UB 4OBMA 4QHOA 3ZDSA 5IK5A 4FN3A 3VZLA 1R69A 1CAVB 4K20A 2VBPA 2O14A 3GCXA 4KWJA 4LITA 1QJY2 1TG7A 2V72A 1EUUA 3FBYA 1DGRA 3VZNA 2F6BA 3P3NA 1W6QB 4M3CF 5FOJB 4NIGA 3ZHMA 3OMTA 4LBNA 5EJ1B 2ZA9A 5CYYA 2RS51 5F6LB 3AYAA 3TBDA 4IE6A 2EXIA 3C8XA 3ZYIB 2GRLA 1I3HA 3ZKYA 1QZXA 1IHMA 3T1MA 5FZ7A 3LFPA 3ZN6B 3JD73 5IVFA 4CP9A 4MYEA 1VBC3 3ZN4A 2WQ4A 4S2DA 3GNEA 2ZGLA 5SV5A 1T6GC 2LROA 3QOWA 1R091 2EVXA 3I59A 3O14A 4LK6A 3KGLA 4N8MA 1CR7A 1UOGA 4GB32 1LU2A 5T5OA 3VDDC 2P34A 5JSOA 4V1PA 4QX8A 4L2NA 3D82A 5FZ1A 1KJRA 1BBT3 4QGLA 2GH2A 1K5MC 2VUDA 3KZ4C 3AXDA 3M70A 5LWBA 5IVVA 4XUTA 2VTXJ 2HKXA 4NHYA 2R49A 2PYTA 4KG0A 4F3JA 2RJ2A 3H3ZA 2JB8A 3M9LA 5CNAA 5DTQA 3CJIB 3P3PA 5FV3A 2K2SA 1GOFA 4AI2A 3C7FA 2H0VA 3LEKA 5FMOS 4DFSA 5F7UA 3RDIA 5JMOA 1PMJX 2P3YA 2WNUB 4JHZA 4ZZ8A 2A75A 2C0ZA 2OW4A 3UT0A 4WVMB 4NRQA 1T2XA 3LFIA 3QACA 3PUHA 1Q8SA 2VOWA 1QB2A 1AXZA 2AACA 3WY6A 2WZPP 5IHRA 4A42A 3LD8A 1LODA 4UFMA 1N1SA 1S0BA 1PVXA 2B8MA 4RR3C 2OZ6A 3ZFGB 2WNVA 2TNFA 4SLIA 3OB8A 4EJRA 1XJAA 3PTYA 4I0AA 1OLRA 4JGYC 1SCRA 4RN5A 3USSA 4BQWA 2J1UA 4QB6A 4PIYA 4Q4X1 3ZVXA 5LRSA 2UWBA 1SFNA 1YFXA 2X05A 4LHLA 4YW2A 5JOYA 3H8RA 3W58A 1B35A 3OF1A 4YZ5A 2A3YA 5A7LA 2MXDA 2O1QA 4F7ZA 4FOWA 3BU7A 1UOBA 3UV9A 4GZ9A 1GQGA 1MZ6A 2MHFA 2YU2A 4IW3A 5KR7A 4OQ9A 3J7LA 1BMV2 3RI9A 1NYWA 2BFUS 2VVEA 1XWRA 5A7NA 2JCGA 4XQ4A 2AENA 1WA6X 2DUOA 2QTWB 3NJYA 4YG7B 1MS1A 1XRUA 4RYDA 4XBLA 3S6PA 1UIJA 4DQAA 3V0AB 5FZGA 3VBUA 3T2OA 2J1EA 5IAXA 5FYIA 3ZFEA 1HRV3 3MDPA 3P1IA 1ULEA 1YQCA 4PDWB 3T08A 1HRI2 4AVSA 2AYHA 4JQDA 3AJYA 2HWE2 3A0NA 4OLLA 5ACA2 3VK0A 1JH9A 5FYSA 3OD0A 5BXXA 3CROL 2X5IB 1DULA 3S57A 2E7QA 1XYNA 5A1LA 4LEJA 3H3LA 2HCNA 3G7DA 4I8TA 1D2SA 1LESA 4GH4A 5F8PA 4JC1A 1HRV2 3KV4A 3VBOC 4EN9B 1QJU3 5HI0A 4BU2A 2WT1A 5F39A 3ALQA 4DIQA 1RUH1 3B9IA 4XDQA 3WW2A 5LASA 3SISA 4KU7A 1G9DA 1DZTA 1JYIA 3ZN5A 4NIIA 4W4ZA 3S5AA 4D69A 4EKIA 3WNKA 5H9PA 5L9VA 3IT8A 4AHZA 4FAHA 1NE6A 3JB4C 1OC1A 3I7DA 1QDCA 4MXVA 5FAXA 4DEVA 3O1SA 1GWMA 4QDQA 4Q8LA 2ET7A 5EWSA 3UKTA 5AC93 3MGUA 5FXXA 4DUXA 1XNTA 4YZ2A 5EIYB 1V6OA 1X8MA 2P6HA 5L36A 2NPIA 1M06G 2BJCA 4XBQA 5C3PA 1BKZA 3IAQA 4CUCA 4AG4A 2PA7A 1YYNA 4XAEA 1UF2C 3MPBA 3MBWA 2PFWA 3ILNA 2LALA 3AFKA 3IN9A 5FUIA 1AJKA 4J6GA 1RIRA 2C26A 5GAHi 1PO22 2LUWA 1R1ZA 3D0JA 3M3QA 1WMEA 2ZABA 1AU7A 4GMP3 2HINA 5JXJA 1OKQA 4ITCA 2WT2A 4IV1A 3IB3A 2JDAA 3U1XA 1LJ7A 5A3OA 5BNNA 1PVC2 2PXEA 1S0JA 2EF6A 4HOOA 4URTA 4AI3A 1FOD2 2JG8A 1Y7BA 4GH4C 4OMDA 3TN92 2C6SA 3O9XA 3R4DB 4LIUA 3FFQA 3MW3A 3LPGA 5FZ0A 1MZ5A 1OSGA 3BKZA 3LCPA 5FFOC 1OUXA 5FK7A 1JH5A 1HIXA 3A4UA 3MYXA 2ZMLA 5CIRA 1ND3A 4KI5M 3C3VA 4BQ4A 2D43A 2D6KA 4CU9A 1W04A 2RG4A 1H1MA 1J3RA 2CTVA 3RJRA 2XL9A 3VB9A 2H6BA 4FOVA 4ASMB 4BIOA 5BNNB 2WJSA 5FKCA 2LLVA 4MOAA 3GF6A 3H42B 4A6SA 4XQWA 4G4FA 3VV1A 3QFIA 3WDYA 1I9RA 1JODA 3KV9A 2VD7A 3BUCA 1FX5A 4XHXA 1HLCA 5FREA 3OGVA 2XCJA 1ACCA 3E1F1 4ZS3A 5A32B 5J3UA 1DF0A 1EAH1 3B9CA 3J7MA 4UXAA 2JE7A 1W2TA 2OR1L 2IXLA 4Q4W2 3ZXFA 5JIUA 1F4HA 2CROA 3WNXA 3UL2A 4YM3A 3I2JA 1TMF3 3M4FA 3TWIA 4YVWB 2DF7A 5A3TA 1R63A 3KWVA 4Q4W3 5JIAA 3T4VA 1SLCA 1RUF2 3AVSA 4PLMA 3AMQA 1D4M3 3ZSLA 3UGGA 4Y22A 2PHDA 1ND2B 1Y9QA 1F2NA 3DGTA 4CP9B 3CLCA 1AR71 3ZXEA 1GZWA 3AXEA 4UOJA 4OFGA 3WG2A 3O0WA 1YQ2A 4CDQC 1AJOA 5FMBA 5FY1A 3ZSKA 3MIDA 3RS6A 2W39A 2HSGA 1FPN1 2WFPA 2W0XA 3FN9A 2OA2A 3DYOA 5C4WA 1W0PA 3SMHA 3ZOIA 3ZPYA 3O1PA 3VKFC 2J7MA 5C9AA 1DP0A 2IFRA 2A71A 2YXSA 2ZPXA 5D1IA 1W9WA 3ILFA 4CXYA 4QU1A 4QT6A 4MZUA 5D21A 4UFJA 4B7EA 2ILMA 3HD8B 4NHLA 2ZEZA 3VD9A 1KRIA 4TTGA 4Y26A 4GD4A 2VZ3A 5LRRA 3R6SA 4CCEA 3WG1A 4L97A 1LMB3 3AVRA 1EUTA 3AM2A 3CO2A 4HETA 4MHUA 4B4QA 1RUC1 2PAEA 2FDFA 4P9JA 2KZ8A 2XQRA 1JXNA 4XJ8A 4DZGA 2JX9A 3NNJA 4O61A 4OUSA 1QH6A 3KT1A 5FYTA 4BMBA 3WW4A 4DY5A 3AKTA 4P02B 4CYDA 1VAVA 5CKMA 1YXWA 2D5HA 4XQDA 1LGBA 2D7FA 1LHNA 5I91A 1W6NB 3HNMA 1F8VA 4KWUA 1CAXA 3NV1A 1W9FA 1SBFA 3K4AA 4LBQB 4W6XA 2QQOA 5EQUA 2QQPA 3RZGA 3BALA 5FYUA 5F32A 2BWAA 1LGCA 3NQHA 3S7EA 3ZXKA 3I49A 4Y42A 5CG8A 3DKWA 1R64A 2BBVA 1JOBA 1OQEA 3I2FA 2VUAA 5IVEA 1OFNA 2XH6A 3GYDA 4MGSA 2PE5A 4X4FA 1SQ4A 4PI2A 1HF0A 4Z82A 5FRAA 3FC0A 2HH9A 1V9U1 2WA4A 3LA3A 4BCUA 5LB6A 2P1BA 4YGBA 2VMFA 1VMHA 2VCCA 2XB6C 2GNTA 1V00A 2VZUA 1GP6A 3KHCA 4FPEA 4H14A 2RDRA 1UD1A 4FQ4A 4QXCA 5DZGA 5LA2A 1QXJA 4IEQA 4WZFA 3H0OA 2BYVE 2L8NA 1YCIA 4YRDA 1AF9A 4AVTA 1XU2A 4COWA 5HCFA 3ZKCA 4WBBA 1LB2A 2ODRD 2BPA2 1ND3C 3RZJA 4C91A 4DS0A 4BHPA 3JBG1 1F31A 3NWKA 3MV01 5FZ6A 1GOHA 2J42A 2XMLA 4JX0A 4PIZA 4K8RB 3OGJA 3KB5A 3VHPA 3SH4A 5CG9A 4D7YA 3I2KA 2RMU2 2CWMA 3WDXA 4M00A 1U5IA 2EIBA 2Z69A 2WFF1 3DN7A 3ES1A 5FXZA 3NW4A 2GP5A 4QX5A 5A1FA 1NKGA 2J7WA 4MG2A 5EYXA 3HIFA 4K6BA 2W3JA 1UYPA 3VDDA 3I3QA 1A8MA 2ZHMA 4BQ3A 1D2QA 1ZZ8A 1O8PA 1VBE3 2JG9C 3QWGA 3K75B 4FPOB 3W21A 4A3ZA 2JG9A 3B5LB 4FFIA 4HPKB 1JZ2A 2BNMA 1QJFA 1DLCA 2PHTA 1ENSA 5DAWA 1ZAYA 2L9LA 1FI2A 3ACHA 4FOYA 4P9LA 4RS5C 4IV1B 5FZHA 1VMJA 4AGGA 2VZQA 4I6TA 2ZGMA 3NXHA 4NMIA 3AK0A 5DUUA 2H8RA 1OUSA 1VRBA 5DSXA 2WBKA 3GJAA 3KVBA 4NHMA 4EZ4A 2W1WA 1W8HA 5IWFA 5FPBA 2Z4FA 2GC3A 3AP4A 4N43B 2AUWA 2KEIA 2GNMA 2GZWA 2OPWA 3MO4A 1AYN1 5E8AA 2EIDA 3RG0A 4D6QA 4DE8A 3QH6A 5JR7B 3VBRB 1HQWA 3VBOA 4OHVA 2ADEA 2BOIA 3NAPC 3WNMA 4BQ5A 5KHKA 2CDPA 2P3KA 4UBGA 4NROA 2G19A 2ZX4A 3DKQA 4WM7B 4Q29A 1BVP1 2BTVC 2VMCA 4R9AA 2OFYA 5K98B 2VR4A 3OGGA 3T2QA 3THPA 5C8CB 2ZGQA 3D3AA 3MFCA 2VJXA 4P5HA 5LK7B 5FMOL 4RSUA 2Q30A 1HJGA 3VZOA 2IU7A 1ENXA 4FI9A 2D6LX 4XAAA 1CONA 1ZA7A 1PNFA 5A7QA 1TE1B 4PLNA 3B02A 4BQ2A 1TQ5A 3FJSA 5GLWA 1ZRRA 3IPVB 4BWOA 2O8OA 1YFYA 3LFMA 5DQ0A 1PO23 1CAUA 5CZKA 3ZXLA 2QQJA 2FHRA 3GHMA 3DXTA 2JJ6A 5FP3A 2D40A 4ARXA 2ZTNA 2AUYA 3SXWA 3OYWB 3KZ3A 1OI6A 1POUA 2R062 3M1HA 3WD5A 4D0QA 2E9QA 1B35C 3LDRA 2C24A 2FJRA 1ZBA3 3ATGA 4JGYB 2BQPA 1VBC2 2Y33A 2Z42A 3N9LA 4NHKA 2WZEA 4AR2A 3ACGA 1X9PA 4QWNA 2EICA 4Q2JA 3AKSA 1UZWA 3C2UA 3VBFC 2RV9A 4BQXA 4CCDA 1GNYA 3TRBA 1A3KA 2HWE3 3ROUA 1ZBE2 1UQXA 1NCRC 1RVF3 1NXD1 2ARXA 2DVAA 4Y1ZA 5D8AC 3THTA 5J96B 1SZBA 2DURA 4G3YC 1OQDA 2HWD2 1CAUB 4DINB 1RTVA 1Q8OA 4QKFA 1AYM3 1WW7A 1AR91 2TEPA 3JZVA 3OY8B 2R061 3PDQA 2MEV2 1BZWA 4RQPB 2W08A 4N53A 2XLGA 4ER5A 1LHVA 3NNGA 4YLZA 4XW3A 3VBFA 2Q1ZB 5FZBA 5A3WA 5JOZA 2JQEA 4PQ9A 2VMGA 1OH3A 3G5GA 5EPAA 2HYXA 4QPIA 1QJX1 3H8UA 1SBDA 2GC2A 1PIV1 2X5IC 2G4IA 1UU5A 3OEAA 4OVEA 4Y24A 5G04L 1PVC3 1PRAA 1MS3A 2P37A 3CECA 2DCJA 4JDMA 1Z7S2 3B01A 4ER7A 2CV6A 2PXVA 5IT6A 3VDDB 4XIKA 1NXMA 3F51A 4R4XA 2YZ4A 1C8NA 2DFCA 4B4RA 3LB9A 1W90A 5JSPA 4S2FA 2PHXA 2XXZA 5FZ8A 2KEKA 2WLPA 3BVCA 1TME1 2XJUA 1ZZ6A 2BERA 3PURA 5GALA 2VPVA 1PM4A 4EWEA 3EB7A 4AK3A 3ZSEA 1Z7S3 4BB3A 1S2EA 1AR92 2XQXA 5BUVA 5FO8B 1H8VA 4MGZE 1S7EA 1V70A 2B42B 3IIAA 3MFAA 3T0BA 3WZ1A 2YBDA 1CQTA 3MEJA 1OH4A 5FZ4A 1JW6A 4YGCA 1YQ5A 4ER6A 1MS4A 3D1NI 1W8OA 2WL1A 1LCDA 2ZGOA 4ATFA 3WQBA 2RR12 3H50A 5CKQA 2ZAHA 4IV3B 4JTOA 5JI7A 1ZBA1 4LA3A 4V2WA 4GQ7A 1OVPA 3T2TA 4TSVA 5BNPA 2XGXA 2WS92 1ZPQA 1JZ8A 4F83A 2D5VA 2VNRA 4DUWA 1CAWA 3OBTA 2DBNA 4INDA 1AYM1 2W91A 1O91A 4PLOA 1YWKA 1W39A 3T4HB 2VZSA 3AP5A 2VZPA 4TLGA 1OFSA 3LPFA 4ZZ5A 1JOPA 1H2MA 3ZXJA 3HN3A 3BU0A 3KV6A 1Z78A 1MQTB 1RVF2 3M3CA 2B9VA 3PUAA 2GMPA 2JDHA 1OQ1A 1G8WA 2Y0IA 4BH9A 2MEV1 3QD6A 2WQZC 3HT2A 5JPNB 4TN7A 1NA1B 3IVPA 2JIGA 2WWJA 5ABJC 4QD2A 1W6PB 2KD7A 3A21A 3NROA 3LE0A 4QXKA 3PXPA 3BB6A 5FP8A 3PUIA 4JGYA 5HPOA 2VXJA 4YM2A 5HCAA 2HCSA 1PNRA 2WNEA 4AZZA 1OBNA 1QEXA 3A23A 4M01A 1D0GA 3A9YA 3RPQA 1S1AA 2RMU1 4CDUB 1VLNA 4Y20A 3I3MA 3JBG3 5BNOC 1I5PA 4NN0A 4P00B 1VIWB 2HWF3 2XPJA 2F4PA 1JYWA 1H2LA 3F52A 3WEZA 4Y5Z0 1WCQA 4YVWC 4J1WA 1S0IA 3UETA 1KFXL 1QOTA 3OGSA 1YIFA 3A9ZA 1CAXB 1UYYA 1V6MA 4LHNA 1KITA 4B8EA 4L99A 1QNYA 1POV0 2P2KA 1FPN2 4CDWB 2CSFA 5CFDA 1SLBA 1CWPA 1JYCA 1Y9MA 4UYBA 4IEXA 2C4XA 3A9XA 3PVEA 4FP3A 4O8BA 4LORA 1WLWA 3SQOA 4NPMA 3PL0A 2VTXA 4Y5TA 2KPJA 1FAYA 2VH9A 3OPTA 4QDSA 5KXDA 3DV8A 2X53S 4Q0QA 3HVDA 4LBOA 1SMVA 3SKVA 3VBHA 1JUHA 1OD3A 1IPSA 1X33A 4JGZB 3NNMA 2ZGRA 2PIJA 4TLFA 4QQHA 2BDRA 3LDKA 3HPNA 4CCLA 3CKHA 5JXHA 3VD5A 3IWZA 3M2MA 1L7LA 1TNFA 2W95A 2ZZQA 5FDBA 2RDSA 2UY8A 3I54A 3LF7A 3RZLA 4K1ZA 2X29A 5T50A 1L3JA 1D7PM 1O4TA 2JDKA 2OS2A 4KWKA 4Q4V2 2VG9A 3BCWA 4CU7A 2GNBA 4QM8A 2PMWB 4BMEA 2XHNA 2AC1A 4E8DA 1KDKA 3POWA 5CBLA 2LYPA 1UOFA 3CMGA 3HR9A 3QOPA 4MGKE 4PU8A 4YM0A 4YW7A 3KT4A 1VPWA 1C4RA 4FT8A 3M7AA 1D4M2 4WV8A 1BYHA 1GBGA 1GFF2 2XWJB 5DUWA 5E89A 5T5LA 3U78A 5T5JA 1CESA 1IG3A 1VBE1 1UOJA 1OPOA 1SBEA 4P5YA 1QWRA 1L7RA 1V0AA 4LO6B 5A6XA 1SDWA 2QUOA 2ZGUA 3LIHA 3K3NA 4E4ZA 3CIHA 1Y9GA 2DVFA 4Y1XA 2LS6A 4LMFA 4QX3A 3BPZA 1DHKB 5CFDC 2MEZA 2RS12 2PLV2 3CJIA 3PHMA 4S2HA 3VHRA 2AW6A 2PUEA 1W6MB 1G86A 5GZEA 3VLBB 3KLSA 5JWPA 2B5AA 1MVEA 3N7LA 4RD7A 1S0GA 4H3WA 4LOSA 1C28A 4DO0A 3CLPA 2CU5A 2RVAA 3PMSA 1VBA3 5JI9A 3A0KA 3DUIA 5JZGB 2NZ9A 1X7NA 3JCIA 2Y8KA 3MUY1 4Q0UA 3WF1A 4XJWA 1WW5A 1RL3A 4Z8BA 1D4M1 1DG6A 4LBJA 2LYRA 2VE1A 4JCKA 4TYSA 1H2NA 1YQ8A 2K0GA 1AR72 3C7GA 4QXHA 4CCMA 5A32A 1FNYA 4I3GA 2QFEA 2E53A 1WH8A 4N7UA 4LR4A 3FHIB 1OSLA 1W9SA 2PELA 2Y60A 4Y1YA 2VXRA 4K3UA 3R09A 2QZ3A 2W2IA 3RYPA 3VHNA 4R9CA 1E5HA 3B00A 3CZUA 1HXS2 4DXZA 1J59A 2R073 5FZ3A 4C90A 3ME5A 1LEDA 1NZCA 3JXCL 4WVLA 4NDWA 4N9IA 2WS91 5FZIA 1GUIA 2FCVA 4DY3A 3BOWA 3BN6A 4NRMA 2O38A 2QCSB 2W52A 1W0OA 5I8SA 1SEFA 4XABA 1UO9A 2R30A 2YU1A 3OPZA 4DXRA 4PDWC 3Q8CA 2XVKA 2JG9B 4HPKA 1W6NA 2GC0A 5DDJ2 3ZKUA 5FKBA 2JDNA 4FPLA 1BK1A 4NPLA 5FP7A 4CUBA 4I0WB 5HXMA 3RZKA 4NAOA 4Q0VA 3AP6A 1ZZCA 1GOGA 4X4HA 1NOVA 3WF2A 3C7OA 3BODA 3ZMNA 1X2LA 4I6RA 2BZDA 2SLIA 2Y38A 4C1XA 2HWC3 3E5XA 4IEPA 2DU1A 2I2SA 5IYYA 1W3XA 4JKKA 1BEV2 5BYNA 2XUMA 4LUMA 4C1WA 5F9TA 2DVDA 1HKDA 3CL1A 4AQ2A 1K5MB 1NLQA 2VW0A 4BOWA 2BFUL 2WWUA 1JOJA 3OTFA 4UFHA 5DAXA 2XJRA 3AMMA 4ZXEA 3MIBA 2DTYA 3AKRA 4UFLA 1VRH2 3HWJA 4P9XA 2XBO1 3CDZB 3WF3A 4C8DA 2FDHA 1Q5OA 2PQQA 5FPVA 4I2OA 1QQAA 2Q4SA 3ZO0B 3OKZA 5FYHA 3EMRA 4ISQA 5CA6A 4ASLA 1U0AA 1CZTA 1HRI3 3JU9A 3MW4A 3SNMA 3VD3A 2ETEA 4DB5A 1FMD1 4BM8A 2BUKA 5K0UA 4AQTA 2PXPA 2G9GA 2XLAA 1UZZA 2GALA 3I2IA 3FUOA 4RR3B 4BK5A 4XC9A 1RZRD 1Z0HA 1RZRA 2XIUA 4TXWA 2Y6FA 2ZOEB 3H9AA 4WZCA 4URAA 3ZXAC 4GIQA 4JVAA 1HDKA 2HBTA 3H3UA 1NX9A 3SITA 2GMMA 3ZYRA 2WN2A 3VWSA 1EAH3 4DOUA 5IK4A 3PUSA 2ZGTA 5GAGi 1XXNA 3GBGA 3W59A 3KCYA 1DCSA 1W99A 1NCRA 3AZYA 3U4SA 3HQXA 3H5TA 1RGSA 2R0HA 2WZ8A 4R4ZA 2PAMA 3CNAA 4WM8C 4XMIA 5J98B 2ZKLA 3TFLA 3AZWA 3EUSA 1TEIA 4COZA 3PTRB 2DCZA 1O8SA 1VALA 4XZUG 5ISLA 2D6MA 1E5RA 2JDPA 4MV2A 5FP9A 4CEWA 1O3RA 2VVFA 4EN0A 4FPKA 2BNOA 1UX6A 4XXPA 5D8AB 1AL23 2Z5WA 3HT1A 4RA0A 5A3MA 2HWB2 1X9TA 4GQMA 1WMXA 3J7HA 1QQP2 1XOYA 2BGCA 4HLTA 1GZTA 3HNYM 2F4LA 2O49A 5C6CA 2QBXA 4LKFA 1WCKA 2LYQA 2ZXQA 3RQ0A 2IV1A 5FQ0A 1OKOA 5DTMA 1QP0A 4YGEA 4XHBA 3TNPB 4AVVA 5CVRA 1IZ3A 2D6NA 2WFF2 3GM8A 1CJGA 3R4UA 4RS5B 1QP4A 4LBLA 2WNVB 4C0BA 2JIJA 3H8OA 4XETA 4XFFA 5C4WB 1FV3A 4CDQB 3S30A 1RUOA 3QCWA 3WINE 2YHJA 4LPLA 1CAWB 1QP7A 1OLQA 2RM21 3NL1A 3RMYA 5FPZA 4IWRA 3JQWA 2QQVA 2UWAA 3O0XA 2FCTA 3OUIA 4OUEA 4QXBA 4M4RA 1NY71 2V4VA 4AFDA 2D6OX 3H7JA 3NAPB 3AMHA 3GN5A 1O3TA 1WA4A 5B4NA 1ZVVA 4ONUA 5EHDA 4ZU5A 5K9YA 1MFQC 1R1A1 1QDOA 5C8CC 3J7NA 4WM8A 4SBVA 2WUHA 3CBNA 1R092 3WHTA 1O59A 5GZFA 4GB33 5A3LA 1NQJA 2I45A 5H9RA 4CEYA 4QB1A 5JZGA 5ABJA 3WR0A 1W6QA 2VZVA 3U07A 3SHRA 1UYXA 2VUJA 3LOIA 1AR63 4Q4Y2 4CUAA 4E8CA 1VBC1 3N9PA 2OX0A 3DM5A 5EV7A 3UK9A 1W05A 4KBBA 4Q4Y3 3WSOA 3H1WA 1ZUGA 1RXFA 5GLTA 2L49A 3WOGA 1LCLA 2QVSB 3GJBA 2AXUA 3KCCA 4KH9A 3APBA 3IPVA 4YG6A 3MV11 1CPMA 2JWPA 1QXRA 4LE4A 1MR5A 2VZRA 2X09A 4XFCA 5FZAA 2VCMA 2W5FA 2VECA 1HRV1 3UKNA 3MLJA 3OBRA 5FXVA 1UXCA 4HG6B 4AGVA 4CU8A 1QY4A 2FMYA 2PXJA 1Q56A 2H6CA 3KVAA 4MUVA 1V6NA 3W5MA 2CL2A 2PHFA 3TRSB 1N1TA 2YC4A 2OKXA 1U5ZA 2HWF2 1UNBA 2DFBA 1POQA 3SX0A 3DECA 2EALA 3E6CC 2ET1A 3JBG2 1SQ8A 1NLSA 4KMQA 3VBFB 1RC6A 3LZZA 3VBRA 1CIYA 4JCXA 3TYJA 4XFAA 1GQHA 4QQ2A 2HWB1 2AXVA 1UY4A 2P3IA 3KF3A 2BV4A 3LOBA 4DNYA 4Z1VA 4LLOA 1W8NA 1VPHA 3FLPA 4FOQA 4K8FA 4QMAA 3AL6A 2YY1A 1QPZA 2CGOA 4QX7A 4CEWB 2WFF3 2R16A 4CU6A 5C8CA 2GDFA 5FXWA 1YI9A 4A4AA 4D94A 4PCRA 4X6QB 4YG1A 1KS4A 3ETQA 3WDTA 1FPN3 5FBZA 1PK6C 2Y6GA 4NIAA 2V5DA 5FZLA 1BBT2 1RMU1 2B4KA 4YVSB 3ME2A 1CZVA 5BY5A 1IKPA 5B4XA 1LQCA 4NJ4A 3BTXA 4AW7A 4DXSA 5JLVA 1EY2A 1ZBE1 5FO7B 5FWJA 1RHI1 2VMHA 3INAA 1JZ5A 2XI8A 4ZU7A 2FD8A 2G9ZA 5JR2A 1MEC1 2ZGNA 4HL0A 1RUD1 2AZ5A 3VN4A 3BIEA 3OUJA 2XJQA 1TMF2 2PUBA 1W0NA 4UFKA 2ZCWA 5FZCA 4Y20B 1GSLA 1G7YA 4RHV1 2RS53 1XNDA 4IUGA 2R043 3FX3A 4O9EA 1ODNA 1OURA 5JUWA 3N7KA 5DPNA 3K4DA 4LE3A 1UZVA 5KC5A 1EAH2 4ZHNA 2VCBA 1D4VB 3FZ3A 4CCJA 5FLIA 1PO12 1S0DA 2XR4A 1QOSA 3AL5A 3SC7X 1JHJA 4OB4A 2YV8A 1C1LA 2ZX2A 3LGRA 1PRVA 1ENRA 2IFWA 2WIIB 4W6WA 1RXGA 4I09A 3I3DA 3ZHIA 3KV5A 4M3CE 4NIDA 3WNOA 3ZN6A 1LOBA 2YROA 2XHKA 3GN5B 2CY6A 3MPPG 2R32A 4UBHA 3DL3A 3WUDA 4LIVA 3FLRA 3VUOA 5L9RA 5T54A 1LOFC 3N3HA 4Q0PA 4FXGB 1WLTA 3M3EA 3VGIA 1H0BA 1SLLA 2VOVA 4D6RA 5LBCA 5AFBA 3D5OA 3TEXA 1COV2 4XOGA 2A6ZA 4AVAA 4UW6A 1CX1A 2W9XA 5E1RA 4DPNA 2R7EB 4YVWA 1HRI1 4WM7C 4YBAA 1C3HA 1LOFA 1N1YA 1C5HA 1WCDJ 2Y6LA 4AHYA 4CCNA 1G9AA 4HKOA 1APNA 3QH7A 2VQUA 3JXDL 2WWSA 2BRTA 4ZKTB 1KS5A 1UXXX 4YGDA 2OQ7A 4OHZA 2F17A 1MQTC 5I0SA 2LYSA 1YSEA 1REFA 2EXKA 4TZDA 3VBSA 4XJUA 2ZZJA 4WVMA 5AC91 2OPKA 2E63A 3GXUA 3SH3A 1NG0A 2E7TA 1DGRN 1RUD3 5ABJB 2DCKA 1GR3A 2V09A 1TZOA 2JDYA 4MCTA 1XNKA 4U36A 2PUFA 4BYYA 5JOWA 5DT2A 3CEWA 2P17A 2Q8OA 1XYPA 2P4EA 4Y4YA 2Z2SB 4B29A 2BP6A 3CQOA 5AVPA 5C33A 4HONA 2ERFA 3N9QA 1JWLA 1IGOA 5FP4A 5FZOA 3WVJA 3RZHA 4MX3A 2NP0A 1PM7A 5A3NA 1RUH3 4GKYA 2XLFA 2Q1MA 3OG2A 5BNOB 1W2UA 2VTFA 1E3OC 4MGQA 5LATA 3T30A 4RFRB 4UI9L 5I0TA 2RS33 4CTEA 3FYAA 5JSRA 3U75A 4A45A 5IVYA 1H4HA 2VNOA 3NNFA 3RGBA 1A78A 4XPVA 1TMF1 2JDMA 1AL22 3V65A 4AAPA 1JFSA 1PO11 2JD4A 3AC0A 1QU0A 2CDOA 1AUYA 1NZIA 1AR83 2FDJA 2OQ6A 4PU4C 1LNSA 2VULA 2XXPA 4NRPA 4XACA 4UAPA 2XXAA 1RUF3 4XFHA 4YNIA 2W1UA 2Q8EA 5CFCB 1ASJ2 3KT7A 4QGMA 3RNSA 5FYMA 5A3PA 3SCGA 2PXBA 2WYSA 5JXIA 1DQ0A 1E57A 2WZR2 3ACLA 5C71A 3AB0A 4E2SA 1UXZA 3N9MA 5AFEA 3VDAA 4PDWA 2VZ1A 5LZ6A 2YB7A 1UCXA 1W28A 2MPFA 5FY8A 5FY5A 1BCXA 4IV1C 4COVA 3AP9A 3J4UH 1BMV1 1QJY3 2YG0A 3DEMA 5JUVA 5F1RA 3IDBB 4HSJA 5DABA 1SG3A 4FTEA 1IPJA 1WW4A 4IE4A 4BPZA 1BLZA 5JAXA 4W8JA 1DDLA 3MF9A 4Q1PA 2A3WA 4FVVA 5L19A 3LEGA 2VBDA 1RUJ3 5A80A 4EK9A 3GHNA 3HQRA 4XJAA 5CB7A 3NO8A 1FMD3 1GQPA 1US2A 2O0OA 2DCYA 2WYFA 3FL7A 4IDZA 5DG1A 4NUBA 5GLZA 3VBHC 3GZAA 4AHWA 1EV13 4X4GA 1UL9A 5H9QA 3VBSC 1IPKA 3NRUA 2HFZA 1FT9A 2D3RA 4JKMA 3T1LA 1UTXA 4XTPA 4AI0A 4FPFA 4X8PA 5A6YA 4GH4B 1OMIA 1LHWA 2PQSA 4B4PA 2ID4A 1YJLA 1NUKA 1BDIA 2R041 3BS3A 2RS32 5C5TA 1H1AA 2GMEA 3RYKA 1A6CA 1RUD2 1IQDC 1YHFA 2JD9A 4DE9A 1RIOA 1RUE1 2CHHA 2PXKA 3TB0A 5A3UA 5CFDB 4GMP1 3BIWE 2EF8A 1RHI2 4X4BA 2PHRA 1RUG2 2JG8B 4YARA 3SCFA 4AGRA 3PUQA 4A41A 3TOJA 4YW5A 4E9KA 2L1PA 2WUSR 4D7SA 5DZEA 1R082 3P5BA 2BGPA 1QQP3 5J36A 3MF6A 2ZEWA 5ACA1 2HWC1 4CPBD 1DQ6A 1TME2 5F3GA 2RDQA 1CPNA 2DUPA 1ZA4A 3IDAA 3ZYFA 1DBNA 2BU9A 4PF1A 2YFZA 2PXTA 2OYZA 2JKXA 2PLV1 2LRPA 2VO5A 4IE5A 4DUVA 3DF0A 4IGOA 3PU8A 1RPEL 1XQNA 2E51A 1G9FA 2JEMA 3GCWA 5JCTA 4HMZA 2DVGA 4MLOA 3L1PA 4AAXA 4YFZA 4PT6A 1RUE2 1A34A 3R1FA 1MPXA 5BPXA 1VB4A 3K77A 3VKNA 5I0RA 1GICA 5T3NA 3POEA 1QJY1 1PERL 1YO8A 5DAPA 5FY9A 2SBAA 1NCRB 4D7TA 1RUJ2 5TSWA 3OJBA 2PPXA 1H9PA 5BNPB 1QOOA 4X8NA 1AR61 3O1TA 1K5JA 4XUPA 2IUOA 3ST7A 3WQ7A 2DV9A 3O12A 4W50A 3C7EA 3B7MA 4NWWA 3WG4A 2BVVA 4ER3A 1I6XA 3EJKA 4RQPC 3VL8A 5L7OC 3WF4A 1QQBA 1OA2A 1HV1A 5A7OA 1ULOA 2OUJA 3R0RA 4XILA 2FCUA 4HK9A 4JV4A 2EAKA 1J3QA 4LUKA 4QQOA 1C57A 4XCBA 4CCKA 1HXS1 4AEMA 1V6IA 4QDRA 1BEV1 4HANA 3I97A 4ZS2A 4AEJA 2A6WA 4PJYA 2KR2A 2BJSA 2VW2A 2Y64A 3EXUA 4XTMA 1RITA 1VRH1 3MI8A 3TEYA 4F8DA 2W47A 4GKXA 1YFWA 3KS7A 3ZPOA 5IVCA 1O4YA 5ANQA 4GALA 3I2DA 3K48A 4GWJA 4AWDA 3BD1A 1NCQC 2RDNA 1X36A 1HX6A 4CDWC 2Q8CA 2E7AA 2LLWA 1AX0A 1FOD1 4IVZA 3HJRA 3UJOA 2PTMA 1MS8A 1Q8PA 2C5DA 2DDUA 4FFHA 1CJDA 1LU1A 4CUGA 2XVLA 1NCQA 4GXLA 1J58A 5F5QA 2AH2A 1ZRCA 3ZYJB 4Q4V3 4ZPIA 1ASJ3 4RGGA 1H2KA 1O6UA 1L1MA 2WAAA 5HCBA 4MGIE 2B5HA 1SLIA 4GJYA 2IUWA 3U10A 1HB1A 3MIGA 3GZEA 3PNAA 4K1YA 4RS5A 1K5MA 3IBMA 3TN91 2V4AA 4B7KA 1R1A2 5FCCA 1ZRIA 4AF9A 1AL21 3D6EA 1X50A 3QQ6A 3I2OA 5A70A 2QQNA 1H8TB 5CU1A 1LHUA 1PGL2 2RJKA 1LGNA 3I2GA 4RQPA 1WW6A 3ZFFC 5K7PA 1CD3G 1JHNA 1FYUA 2W94A 2NLRA 1JS9A 4IERA 2OUHA 3W20A 3KSCA 4QPWA 4YW1A 3TAYA 3WV6A 5FZOB 4N53C 3MIEA 1I5ZA 4BLJA 4XF0A 5FZKA 1BK0A 3VD4A 3MZHA 2R1JL 1LLIA 3D8CA 1XBFA 1RUJ1 5C7GA 3OCPA 2LM3A 1OLME 3VL9A 5DAQA 3URFA 1AX1A 4ZXKA 1GP5A 4WVZA 5CADA 1ONAA 2I07B 2ZX1A 1WD4A 2Q8DA 1M4WA 3ZYBA 1KFUL 4DRVA 3SEPA 3MEPA 1PMHX 3L2HA 2YC2A 1O3QA 3Q9OA 1YNAA 1SPPA 5LEJA 1GNHA 1WGPA 1O5LA 4XBNA 4YW6A 1RUI3 4NOTA 5F3CA 4ZONA 3H1MA 1J1TA 3WLUA 1XE7A 1ZX5A 1RJ7A 5K4LA 4EZIA 3U11A 2PUGA 3K3OA 3POGA 4FXKB 4GB31 4QKNA 4AXOA 5HBAA 4OHYA 2R071 2AREA 4MXWA 3WDWA 4FBFA 3HBZA 1KXGA 3ENRA 2NM1A 5DN2A 4V2VA 4CDUC 1VBE2 2PUAA 4JRAA 1HW5A 3J8F1 2XBO3 5FK8A 1PVC1 2HEWF 1OOPC 1ULPA 5A7SA 3VDBA 2D3SA 2K46A 4XDPA 2XKOA 5LY1A 2YBKA 3DYPA 2A7AA 5FPXA 4R9BA 3I2HA 5ERLA 4AI8A 3VKOA 5C9AB 1EP0A 3WQ0A 4YZ1A 5KHGA 3IKWA 3QF3A 2R042 2RS31 2PUCA 4DXTA 2RM22 4IEWA 2Y0OA 2A70A 5LA0A 3MIFA 3FHQA 3POSA 1X82A 2WNVC 2Y6KA 3G6JB 1PZ7A 4AVCA 1S0FA 4META 4RR3A 5IATA 3JQXA 2X5IA 2C9AA 2IWGB 3U3WA 5IW0A 4YPJA 2PHUA 1RMU3 2ORZA 1PZ8A 4XFBA 1F35A 3PIGA 5FO9B 4NVPA 4P9WA 1TNRA 2QZ2A 3T2PA 5FZDA 5BNQA 2Y26A 3LQCA 4QPIC 1Y43B 2WO3A 3ASIA 3AZZA 2ZEYA 3DCQA 2W87A 3PLQA 3PVBB 4MVTA 5DAVA 3WP6A 5FJHA 3WW1A 1IC8A 1L7QA 2VQ0A 3AZVA 3HBKA 5LA1A 3LDBA 1D0HA 3AX4A 1PNGA 1RVF1 3MLKA 4Q4X2 1UN1A 3OWQA 1FNZA 2Q0AA 4Y22B 5FYZA 3V0AA 3Q8BA 1LEMA 3PE5A 2HWB3 3BOPA 4Z92B 5I0DA 2W46A 5FY0A 1LOGA 4XUOA 4BQYA 3KL4A 1MVQA 1ZNPA 3B69A 2B45X 2IXHA 1N3OA 2D44A 1O3SA 2YDEA 3OQNA 2KXLA 3EYPA 1LRHA 4AL9A 4OULA 1E5IA 1DW9A 2CGPA 3O1MA 3B3QE 1PGSA 1YIPA 4CEYC 1LENA 1LOEA 4JZRA 4MO3M 5A7WB 3S0MA 3I3EA 2AEYA 1C8M2 4I0BA 3FBMA 4M4PA 4H55A 2ICPA 2J7UA 1O4ZA 2IVIB 5IVBA 3AYDA 1K12A 2O4AA 4IE7A 4A2UA 5D2AA 4OI0A 1RJ8A 1XPWA 3M8LA 1JFTA 3NKGA 2FZ1A 5EXOA 1YQ6A 3ES4A 4ASKA 1LECA 4FAGA 5IK8A 1OT5A 1EV12 3Q8FA 1NW3A 1JZ6A 1NY72 1C8M3 5LA9A 3WG3A 3NNLA 4M3CA 1FMD2 3BPSA 4AHXA 5A33B 5FYYA 2B9UA 4ER0A 3HZIB 2WA3A 5KHHA 1JTZX 3WXPA 4M0NA 3RJ2X 3E5QA 1S55A 1FATA 1WZXA 1XU1A 1EFAA 2UURA 4GWNA 3WF0A 4EN8B 2VL4A 1ULGA 5EZWA 2WQ8A 1DWKA 4D6SA 5CFCC 4U2AA 5JZGC 4IL7A 4LBQA 4XFIA 3UJQA 4LT5A 1SHWB 3ABZA 4L92A 4XF9A 3FMGA 5JMCA 3ZM8A 3K2OA 4A7YA 1K45A 4UF0B 4G9SB 1MEC2 4P9YA 1V6LA 3ZMOA 4X4DA 3ZYPA 3ILRA 2NMNA 1QNWA 2AR6A 3CHXA 2R1DA 4BA6A 1JBCA 1S2BA 3O1VA 2CAUA 3RMXA 1QJX3 1VJ2A 2D5FA 2RM23 2TBVA 1MEC3 1QH7A 3OBZA 3ORJA 1PK6A 4PHZA 1WETA 1VBD2 4D3WA 4ET7A 3N36A 1LCCA 4YVSC 4ARYA 1UU4A 4LO4B 2NQYA 2RMU3 1QJZA 2HBUA 2XJSA 1JI6A 1JUIA 4NO4A 4YW4A 1QKQA 5AVAA 1H6YA 4IEUA 1VBA1 2JDZA 2R063 2B46X 4EE2A 1UMZA 1AR93 2J1SA 4OHWA 3LA2A 4WM8B 2ZMKA 4Z5CA 3DNVB 1ZZ9A 3HAGA 4O65A 2AGSA 4NHXA 1PGL1 4AQSA 2QE3A 3POJA 4KG8A 1PX4A 2ZS6B 1W2OA 5KBFA 2WNOA 1YEWA 2J1TA 4AFBA 3NV4A 2KA3A 1OD5A 2WO7A 2RS11 4FPHA 4O7XA 4Y33A 1GZWB 1I1EA 4FCAA 4QPYA 2PHLA 1WIZA 1UIKA 4FPYA 2V3CC 1QJU2 4XVHA 1HN0A 4UW4A 5GM0A 4AEKA 1OHFA 3ZYHA 2A1XA 2KM2A 1HQLA 2V73A 3WP5A 2BW8A 2X8KA 5A1AA 4LNVA 5FR3A 1ULCA 3LSEA 4ORFA 1C1FA 1R083 2DVBA 3NDBB 5GZCA 4AI9A 3GALA 2XOMA 4LA2A 3OSDA 4Q26A 2PXDA 2RS52 2A5ZA 4IE0A 4XFGA 2N7GA 4YZ4A 2GU9A 4LKEA 4FFGA 4CP1A 4EN6B 5AC92 4E2QA 3WNPA 4Q4Y1 4QPGA 5F2WA 4N7IA 1BDHA 4YVSA 3GZCA 1WMDA 2HWD3 3A22A 1XSQA 2GRMA 2D6PA 3EHKA 3NJZA 4AI1A 3T0DA 3O1RA 4A3XA 3R05A 4JHTA 4I3PA 1TME3 1QIQA 2R1BA 4Q27A 1H4GA 1KGYA 2WAOA 3V0BB 3H7YA 3KXAA 5FYVA 2AWIA 3AYEA 2P3JA 3DPRB 4XDOA 1NERA 1ALYA 1POV1 3LSDA 4N43A 1NQDA 1NT0A 1OPMA 5DUVA 4UW5A 4EYUA 1R1A3 3HNBM 4A7ZA 3P6BA 3ZFEC 4XUQA 5J48A 3TNQA 2JDUA 3SH5A 1HB2A 2ZHLA 3JXSA 5ANNA 3NJVA 2VUCA 4J1XA 1GU3A 2VMDA 1NA1A 2C1FA 2HLEA 2IVQA 1J3PA 4LBMA 1P8JA 2VM9A 4XJZA 4Y3OA 4YFWA 4E4DX 4CE8A 2XJ3A 2YYOA 2JG8C 3R4SA 3BTAA 4LLFA 1WWYA 2W1QA 4KGQA 2UY9A 3PIJA 2WNUC 3SLIA 5FUPA 4AEDC 3TEWA 4E27A 1X57A 2ZX0A 4HSLA 1R081 2GH8A 4DRRA 3F6WA 2XSDC 2WO1A 3CU7A 1N47A 2LYLA 5KHJA 2FDKA 5IVJA 2Z79A 4WVVA 1PRUA 1Q8VA 4KBZA 3ZFGC 3U14A 4CSWA 5C3RA 1VBB2 5C8WA 4HRAA 5F3IA 1CAVA 2E31A 1ZYBA 2ZBJA 1O7FA 4B3NA 1GZ9A 5KXEA 1IQAA 2IXJA 2QQLA 2YMZA 3M3OA 2M4HA 2ARAA 5CEHA 1VBB3 3UKVA 3WHUA 4QGNA 2XG3A 5FPAA 3GZDA 5FPUA 4OMCA 4Z07A 3GBWA 4XUNA 1JYXA 2E33A 4P9GA 2XDVA 1SFPA 3K4ZA 4LK7A 5F6KA 1MACA 3VKLA 2DU0A 3FE5A 1WCSA 3S8QA 1X8EA 2ZKNA 4AQ6A 1Z7S1 1DQ5A 2FQPA 4JTNA 4QQLA 3OEBA 4A7KA 3BGAA 3DXUA 4E4HA 1ST8A 5DDJ3 4PF5A 2A73B 1RYYA 4OYUA 5JXGA 3LWCA 2WS93 4FO9A 4WVWA 3S5QA 1PK6B 2XJVA 4FQZA 1AXYA 2BVBA 4CDWA 5L7OB 3GZDC 3E5UA 3RI8A 3CZJA 1XB9A 2ZJCA 5FZ9A 3T3YA 5C4WC 1KEXA 3CJXA 3LEMA 3NJXA 4KQ7A 1PGW1 1WMFA 2BOJA 4GMP0 5DG2A 5IFPA 3L2YA 1UPIA 3NV2A 4Z2WA 2RR11 5A33A 4E4SA 2D98A 4MSVA 3F95A 3SEEA 1YUDA 3GUUA 1HQ1A 1PIV3 4IGPA 4L9BA 3U37A 1ZS4A 1J1LA 1PX3A 2YFUA 4CPBA 1XYOA 2FFHA 2Y34A 2XVGA 2IVJA 3KHBA 5EYYA 1GV9A 2ZX3A 4QAWA 4EV0A 1HN1A 3AMNA 4NAMA 3IDCB 2JE9A 2GSYA 2VOXA 5HXVA 3VBHB 4NIHA 3PMEA 3FMYA 3RZZA 4IEOA 3O7OA 4HKWA 4QPGB 1O5UA 4IESA 2VW1A 4CRQA 2GC1A 3J9SA 4GHJA 1AZDA 3ZX7A 3OY8A 1BQPA 4R9DA 1VBD1 4QX1A 1ZRFA 2A6VA 3NZLA 3KCXA 1W06A 2ZGKA 2QNKA 3AKQA 4HN1A 1DQ1A 2PUDA 1IG0A 4JRLA 3C7HA 1F4AA 4LJHA 1SFYA 3UESA 3CJIC 1AYN3 4AFMA 1WBFA 1DGLA 3IZOA 1GYKA 3WT3A 1RUNA 3VZJA 4ZY9A 1U5YA 1AVBA 2RR13 3O0VA 5FIXA 1H9WA 5LW9A 3HOBA 5FZFA 2E26A 1VBB1 3E6DA 2AXZA 3ZFFB 3VZMA 4FSJA 3M3IA 1RINA 1W3VA 4YG3A 1WLDA 1N1VA 2ZGPA 4EQVA 1ZRDA 4Z59A 4R8HA 5DMYA 1IS3A 3OBAA 3Q8EA 3THCA 1JYTA 1JZ4A 2XBO2 1OF3A 2XL7A 3AYCA 4JDNA 5DDJ1 4Q2FA 3PVOA 4CDXC 4AYUA 5IK7A 4TWTA 1MZEA 1W6MA 2FDGA 3O5SA 3FLTA 4PI0A 4GJZA 4ES8A 1UZYA 4EQZA 1GNZA 1UKGA 4XIOA 4W65A 2BGOA 4NE9A 2OVUA 3W9AA 3KM5A 2PXLA 2YUEA 2EBYA 1ASJ1 1UXDA 2YGLA 4CEWC 4CZSA 2ATFA 1JU3A 4CDQA 2QQMA 3OD4A 5C3SA 1CVNA 4BZ4A 4P08A 1VAKA 4LTAA 2R0FA 1GP4A 1CN1A 4P9IA 5I8TA 2GP3A 4HK8A 4QQPA 4HN0A 5E88A 2ZMNA 4DEQA 5F37A 4CA9A 4CXXA 4E2GA 1CX4A 1U12A 2WLQA 1QJX2 2HEYF 1VRH3
chains in the Genus database with same CATH topology
1AR82 1F9KA 3AFGA 2D93A 5GLVA 1OCTC 4HVQA 1FXZA 3VBOB 2IXCA 5FOBB 2HWF1 1XNCA 3IDEA 2O8QA 4M3CB 1N3PA 5LEKA 2WKKA 5K0UC 2CAVA 1S0EA 3QYXA 2MNGA 1LULA 4MGYE 4JCYA 3V0BA 4RHV2 4FPJA 4OI4A 4QPIB 4Z5DA 1YLLA 4PIXA 1RUI1 3WX5A 3S7IA 3EO6A 3LKJA 5EJ3A 1LHOA 5J09A 4MCXA 2ZHKA 5L7OA 3MW2A 3L9JT 3VBUC 1Y3TA 3AKPA 2HWE1 1V9U2 1H30A 1KQRA 2WT0A 1XE8A 4LHKA 4BLIA 2A6CA 1IOAA 1S0CA 5KC6A 3RRDA 1N3QA 4S2GA 2K9ZA 3USUB 4CDXA 1KDMA 2YGMA 3WQ1A 1BJQA 2PN5A 2IVBA 4EROA 1DIWA 3OYWA 1UW8A 5KXCA 1RUC3 4IA8A 1PHMA 3ZFFA 4X4IA 4NR1A 1Y7YA 3ZYGA 5K8SA 4EN7B 1WBLA 5T52A 2B39A 4AVBA 3FWEA 2RS13 4ISRA 1O4XA 1ZZ7A 4KGGA 1V6KA 1YI7A 1MS5A 2A6XA 2BWCA 2VOKA 2GN3A 5FLJA 5BNNC 1VBD3 3BDNA 3KD4A 2VGDA 4MXWB 2EA7A 1FOD3 2A3XA 2JXAA 2CWSA 4IV3A 5JDBA 2QDNA 3EQEA 1LKNA 1QF3A 1DQ4A 1LOCA 4GWMA 1BXHA 2HWD1 4PBOA 4LBKA 3WCRA 1LTEA 3WCSA 1SLTA 4EWDA 1HXS3 4AFAA 2VMIA 1AYN2 2YPJA 4ZU4A 4YZ3A 1GZCA 5SV8A 1UAIA 2R6QA 3SCHA 3AZXA 4JAAA 2E6VA 1IKQA 1ADRA 4GA9A 1SACA 5CFCA 1U5XA 1B09A 1AXKA 4BQ1A 1W6PA 2VU9A 4WM7A 4YW3A 3V64A 3MIHA 2VVDA 2ZGSA 4X4CA 4HT1T 1LR5A 4IQPA 3WP3A 1YFUA 4DMIA 2RE9A 4RL7A 2MEV3 4XZPA 4IEYA 3I59B 1AYM2 4IETA 4LBQD 4Q4X3 2B7YA 2LYJA 2PLV3 4CEYB 1GLHA 3WDUA 4C0HA 1NEQA 1UPSA 2LTNA 2GZUA 1G6NA 2EXJA 2BEOA 2UWCA 1NCQB 2TUNA 3GZUC 3U4XA 1MS0A 4K7JA 4FTEA 3VHOA 4H7LA 1UKRA 1QQP1 3VKMA 2OZJA 1DYKA 3AMPA 1G9BA 1COV3 4Q1RA 3VBSB 4XF3A 2WC2A 2WSVA 5JOXA 4OI1A 1LOAA 3N35A 2WNUA 5GZDA 4YG0A 1PO21 1GANA 1ND2A 3EBRA 3VBRC 2YC0A 1ULFA 1A8DA 3ZSMA 4QHBA 1OA3A 1W6OB 1REDA 2UYBA 5BNOA 1HV0A 5DZFA 1H8TC 5I93A 5KHIA 1ZBA2 1GT0C 1ZM1A 1AHSA 2RJLA 5KXBA 4Z58A 1EV11 2WINB 4CP2A 2KEJA 1R093 3OQMA 2ICTA 1RUI2 2CNAA 4N53B 3ZXGA 2JICA 1ZZBA 4YG4A 4OUMA 3GBFA 3WW3A 2FBEA 1JN2P 1GKBA 4LO7A 1F5FA 1ND3B 4AEDB 5GZGA 4IEVA 1DLLA 1H1IA 3J8F3 5B2GB 3B93A 1DGWX 4XF1A 3FUQA 1Q43A 5E16A 5D8AA 1PIV2 5BNPC 2IXKA 3KGZA 2DCTA 2QDRA 4FPGA 2EWTA 2ES3A 1WLCA 3RYRA 5FQ0B 2VY0A 1CQ9A 4FP2A 1NLRA 4XEZA 3PJQA 1AR81 4JGZA 4XYXA 3ZIWA 4COUA 5I0UA 1YJKA 2QJVA 3OP9A 2JVLA 4RGAA 4I30A 4L11A 2GAUA 3NVCA 3V56A 4AE2A 2Q5TA 5LK5A 2A6YA 4LO5B 4AEDA 1DQ2A 3I8TA 5J37A 1CIWA 4NWVA 2JENA 1Q8QA 2DYCA 4MH0E 1ND2C 1G9CA 2IVGA 2UU8A 2GN7A 2G9FA 4LO8A 3ELNA 2XJTA 3PVNA 4N90A 4Q4W1 1V6JA 4N43C 5H9SA 1QMJA 1SCSA 1B0NA 1IS6A 2WIUB 1ZVFA 4ATEA 4GULA 3LISA 4FPCA 1MQTA 2LCVA 2ARBA 3ECQA 4K21A 4M0HA 3NSTA 1IS5A 4NPRA 4Y1VA 3IMNA 3E6BA 1DYPA 3PJYA 2UYAA 3B7HA 1KD7A 3DPRC 4KWLA 4QPGC 1RUG3 1AX2A 2I74A 1POV3 1S2KA 2LYKA 1V9U3 2QKDA 2ZHNA 2FMDA 4QU2A 3ZFEB 2ENRA 2RHPA 3VZKA 5T5PA 1WH6A 3MICA 3MLFA 2BNNA 4K40A 3LAGA 3NKTA 4Q8KA 1ZREA 4HBNA 3AJZA 4BE3A 4PU3C 4IEZA 1BEV3 4GH4B 4XJ9A 3E97A 2R63A 1QGLA 1RUC2 2IZWA 2V5YA 3RWNA 4HVOA 1XNBA 4HFSA 5L73A 4RFT0 1PZ9A 1WD3A 4Y1UA 1C5IA 3HN1A 2ZAAA 5DXDA 2WZR1 3OQOA 3K51A 4K9SA 1W6OA 4I6UA 3JXBC 1VR3A 4BIFA 4JQRA 1RUG1 1OA4A 2D97A 2HWC2 1DFQA 3USUA 4CDXB 1UU6A 2HEVF 3KMHA 2NYYA 1HQNA 4RHV3 5IUQA 2EIGA 4YSFA 1VBA2 2EXHA 2JECA 1OOPB 1RUE3 3N7JA 1NA1C 5KWRA 1F5JA 4OHXA 1SLAA 1MZFA 5CAZA 3TN93 2GNDA 3POYA 3DPRA 4FBIA 4HZFA 3WDVA 5C9AC 1ZBE3 2W68A 4Q4V1 4LULA 2CGNA 1AL0G 5ACA3 4OZXA 1DGWA 1QHDA 4YYOA 3ZFGA 1AR73 2H0BA 2OIIA 4JDOA 1VAMA 1QJU1 2DWRA 1AR62 2CYFA 3JD72 2XWBB 2VNGA 4N9HA 3UFDA 4KU8A 4PU7A 2JKBA 4I02A 1MS9A 1URXA 1CJPA 5GKAC 2R072 3HMYA 1OOPA 1QXPA 1RZSA 5FTTC 3ZXDA 3X29B 5GJ6A 3J8F2 2IC1A 1RMU2 3B94A 2WZR3 2WSUA 1IS4A 4JGZC 3D4KA 5J7MA 3FYMA 4W6YA 2XJPA 4KL1A 3VBUB 3ZSJA 1RUF1 3JD71 3NAPA 5T55A 1REEA 3N7MA 1PO13 1VB2A 1C8M1 3NV3A 1Q3EA 4YM1A 4XF4A 4P14A 3KJXA 4XE9A 1DZRA 2NMOA 1RB8G 3JUUA 4HKLA 4IV3C 4O9GA 3WP4A 2ZACA 2D3PA 4I01A 4ES9A 4HVRA 3J26N 1VP6A 2XKPA 1ULDA 4XXAA 4R52A 2VQAA 3IM0A 4Q0SA 4KNCA 5DUXA 3U0ZA 1DU3D 1FV2A 4X4EA 4AFCA 2HJIA 4Z5HA 1NE4A 3RSJA 3WUCA 4QM9A 2HYKA 5BV6A 3FFZA 4PBPA 4XMAA 2DTWA 1RUH2 1EYBA 4IXLA 2PAKA 4H7MA 3AP7A 3LA7A 1ENQA 1EPZA 4UW3A 1H8TA 1CGPA 1RHI3 1YRZA 1KJLA 1COV1 1BBT1 5JPMB 1EPWA 2EAAA 2IXIA 1BVVA 3MLLA 2MQKA 5I8YA 4CP0A 3CF6E 1B35B 4X6RB 5JVVA 3D0SA 5EFUA 1PMIA 3KQRA 4CDUA 4L8QA 4COYA 2PHWA 3QBQA 3ZIXA 3QLQA 5FLHA 4F8AA 2NN8A 3GZTB 4EWAA 3H1YA 4OI2A 1WUVA 3I4IA 1PGW2 5GLUA 3N4MA 1DZQA 3JB8A 5K0UB 3ZDSA 5IK5A 4FN3A 3VZLA 1R69A 1CAVB 4K20A 4KWJA 1QJY2 3FBYA 1DGRA 3VZNA 2F6BA 3P3NA 1W6QB 4M3CF 5FOJB 3ZHMA 3OMTA 4LBNA 2ZA9A 2RS51 5F6LB 3AYAA 3TBDA 2EXIA 3ZYIB 2GRLA 1I3HA 1IHMA 3T1MA 3LFPA 3ZN6B 3JD73 4MYEA 1VBC3 3ZN4A 2WQ4A 4S2DA 3GNEA 2ZGLA 5SV5A 1T6GC 3O14A 1R091 2EVXA 3I59A 5T5OA 3KGLA 1CR7A 4GB32 3VDDC 1LU2A 5JSOA 2P34A 4V1PA 4L2NA 3D82A 1KJRA 1BBT3 4QGLA 2GH2A 1K5MC 3KZ4C 3AXDA 3M70A 2HKXA 2R49A 2PYTA 4KG0A 4F3JA 3H3ZA 5CNAA 3CJIB 3P3PA 2K2SA 4AI2A 2H0VA 5FMOS 4DFSA 3RDIA 2WNUB 2A75A 2C0ZA 2OW4A 4WVMB 3QACA 1Q8SA 2VOWA 1AXZA 3WY6A 2WZPP 1LODA 1N1SA 1S0BA 1PVXA 2B8MA 4RR3C 2OZ6A 3ZFGB 2WNVA 2TNFA 4SLIA 4EJRA 4JGYC 3PTYA 4I0AA 1OLRA 5J3UA 1SCRA 3USSA 4PIYA 4Q4X1 3ZVXA 5LRSA 2UWBA 1SFNA 1YFXA 5JOYA 4LHLA 4YW2A 3W58A 1B35A 3OF1A 4YZ5A 2A3YA 5A7LA 2O1QA 4F7ZA 4FOWA 3BU7A 3UV9A 1GQGA 1MZ6A 2MHFA 1BMV2 3RI9A 1NYWA 2BFUS 2VVEA 1XWRA 2JCGA 4XQ4A 2AENA 2DUOA 3S6PA 4YG7B 1MS1A 1XRUA 4DQAA 4XBLA 1UIJA 3V0AB 3VBUA 3ZFEA 1HRV3 3MDPA 1ULEA 4PDWB 4AVSA 1HRI2 2AYHA 4JQDA 3AJYA 2HWE2 3A0NA 4OLLA 5ACA2 3VK0A 1JH9A 3OD0A 5BXXA 3CROL 2X5IB 2E7QA 1XYNA 4LEJA 3G7DA 4I8TA 1D2SA 1LESA 4GH4A 3VBOC 4EN9B 4JC1A 1HRV2 1QJU3 5HI0A 2WT1A 3ALQA 1RUH1 3B9IA 4XDQA 3WW2A 3SISA 4KU7A 1G9DA 1DZTA 1JYIA 3ZN5A 4D69A 5H9PA 3IT8A 4AHZA 4FAHA 1NE6A 3JB4C 3I7DA 4MXVA 1QDCA 5FAXA 4Q8LA 2ET7A 5EWSA 3UKTA 5AC93 3MGUA 4YZ2A 1V6OA 1X8MA 5L36A 2NPIA 1M06G 2BJCA 4XBQA 1BKZA 4AG4A 2PA7A 1YYNA 1UF2C 3MPBA 2PFWA 3ILNA 2LALA 3AFKA 3IN9A 1AJKA 4J6GA 1RIRA 1PO22 2LUWA 1R1ZA 3D0JA 3M3QA 1WMEA 2ZABA 1AU7A 4DY5A 2HINA 1OKQA 4ITCA 2WT2A 4IV1A 1LJ7A 5BNNA 1PVC2 1S0JA 2EF6A 4AI3A 4URTA 4AVTA 1FOD2 2JG8A 1Y7BA 4GH4C 3TN92 3O9XA 3R4DB 3FFQA 3MW3A 1MZ5A 1OSGA 3LCPA 5FFOC 1JH5A 1HIXA 3A4UA 3MYXA 2ZMLA 5CIRA 1ND3A 3C3VA 2D43A 2D6KA 1H1MA 1J3RA 2CTVA 2XL9A 2H6BA 4FOVA 4ASMB 4BIOA 5BNNB 2WJSA 3GF6A 4XQWA 4G4FA 3VV1A 3WDYA 1I9RA 1FX5A 4XHXA 1HLCA 5FREA 5A32B 2XCJA 1DF0A 1EAH1 3B9CA 4UXAA 2JE7A 4Q4W2 2OR1L 2IXLA 3ZXFA 5JIUA 3WNXA 2CROA 3UL2A 4YM3A 1TMF3 3M4FA 3TWIA 4YVWB 2DF7A 1R63A 4Q4W3 5JIAA 1SLCA 1RUF2 4PLMA 3AMQA 1D4M3 3ZSLA 4Y22A 2PHDA 1ND2B 1Y9QA 1F2NA 3DGTA 3CLCA 1AR71 3ZXEA 1GZWA 3AXEA 3WG2A 4OFGA 3O0WA 4CDQC 1AJOA 3ZSKA 3MIDA 3RS6A 2W39A 2HSGA 1FPN1 2WFPA 2W0XA 2OA2A 5C4W