1ZZ7A

Crystal structure of feii hppe in complex with substrate form 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
192
structure length
178
Chain Sequence
b'ASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyprophylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 41
structure length 178
sequence length 192
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz7A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz7A02
5FPZA 1JFTA 2GAUA 4MGIE 4XF1A 1X8MA 2AXUA 1X7NA 3WW1A 5HI0A 3CF6E 1ZREA 5KHJA 2OZJA 1ZZ8A 2E9QA 4RD7A 3BU7A 1SQ8A 1J3QA 2B9UA 4AVBA 1L3JA 2IXCA 4ONUA 4MUVA 4OB4A 5EZWA 4KL1A 3ACLA 4E2SA 1ZX5A 4H7LA 3CEWA 2O8QA 4I0BA 3L1PA 2V09A 3LZZA 1ZZ6A 2PUFA 2LCVA 1H1MA 2WFPA 2KEJA 3H1MA 2EWTA 1ZRCA 5FLHA 3I54A 3HQXA 1ZVFA 2CV6A 2ET1A 4XFIA 4IEXA 3RNSA 3M70A 1WETA 4Z5HA 4OFGA 3TNPB 4O9GA 2OFYA 5J7MA 2GRLA 2PHDA 1O3TA 3JXBC 2GU9A 2PA7A 4HMZA 2VECA 3SCFA 4QM9A 2XL9A 5CU1A 3DN7A 3KXAA 4IWRA 1CAVB 4ZU7A 2IU7A 3M3IA 3IBMA 1I5ZA 4XFCA 3NW4A 3BB6A 2PHLA 4LLOA 2C0ZA 1X82A 2IUOA 2AUWA 4DINB 4I09A 1PRUA 3IDBB 1R69A 1CGPA 1PRVA 3GN5B 3CLPA 3CO2A 4HLTA 1QY4A 4QGLA 5C8WA 2H0VA 3PNAA 2FQPA 3FX3A 3LA7A 4WBBA 2LYRA 3FWEA 4L2NA 1GQGA 3UKNA 4X4EA 3WW4A 3NJZA 5FDBA 4I8TA 1ZVVA 2GC0A 2CSFA 1UD1A 1HW5A 2MPFA 3FMYA 2UY8A 4P9GA 2UYAA 3IVPA 1VR3A 4PJYA 2PIJA 1UPIA 3ES1A 4JTOA 2B5HA 4XFGA 3WW2A 4I3PA 1EFAA 3RYRA 3RYPA 1PM7A 2B5AA 1XRUA 2LYLA 1Y7YA 3DV8A 3QACA 4LTAA 3F52A 1QQBA 2KEIA 4MGYE 1QPZA 4I02A 4AVCA 1RGSA 2BNOA 2EAAA 3MZHA 2PAEA 5I8YA 1J1LA 2D5VA 4Z82A 2ETEA 1WH6A 3DNVB 5JSOA 5E1RA 3PXPA 1Y9QA 4IEVA 3EJKA 2R63A 3KGLA 2Q4SA 4LEJA 1QP4A 3OQMA 1OD5A 4X4FA 4XF0A 1NEQA 2PPXA 1LQCA 4HVOA 1Q43A 1B0NA 2MNGA 3VHRA 2PUGA 1IPKA 4PU4C 1LLIA 3I59A 4IERA 2K9ZA 5FCCA 3ELNA 1CAWA 3H7JA 4KWLA 4QGNA 4YG7B 4X4IA 3LOIA 4JTNA 4EV0A 4MCTA 2KEKA 3L2HA 4UBGA 4WVZA 1U12A 3WW3A 2OR1L 2GC2A 3OD0A 5A7LA 3IIAA 4QXKA 3E5QA 1SQ4A 2XKPA 4D7TA 1Y3TA 2IXHA 2MQKA 4N9HA 5FQ0A 1O5LA 1QXRA 3EHKA 3LFPA 3QOPA 5J3UA 4BYYA 1RUOA 2BNMA 3RDIA 4MGKE 4OLLA 4JQDA 4Q29A 2JCGA 1GT0C 2ZCWA 4AXOA 4X4DA 2QDRA 1IPJA 3SMHA 2WIUB 1EY2A 2OPKA 1QP0A 2L49A 5KHGA 2B8MA 5BUVA 1VJ2A 3EO6A 3ZDSA 2KPJA 1ADRA 1WGPA 3E5UA 2AWIA 1CAUB 1WA4A 4NDWA 2IXKA 2IXLA 1CJGA 1OCTC 4Y42A 2PTMA 3BPZA 4K8FA 4META 3CJXA 2Z2SB 3S7IA 5I8SA 4QX5A 2UYBA 2HSGA 3OQNA 5JCTA 1JUHA 4FBFA 3TNQA 2EF8A 2QCSB 3U0ZA 4Z58A 1J3RA 4YNIA 4KWKA 3MYXA 3LA2A 3ST7A 1XE7A 4PU3C 4Q0VA 2OYZA 1NERA 1FXZA 4R8HA 3ETQA 4IEUA 3H7YA 4E2GA 3H9AA 3BS3A 4FBIA 4GQMA 4IEYA 4HVRA 3LISA 1YFXA 3LWCA 1POUA 5LEKA 2CROA 1NE4A 4XF4A 4YG1A 1O4TA 1LMB3 4IETA 4EWAA 1YUDA 1UXDA 3BCWA 5FPXA 4JVAA 3QWGA 5JSPA 1VP6A 5BV6A 1X57A 5LRRA 2ZKLA 3UKVA 1BDHA 3LA3A 2XLFA 4XFBA 5D1IA 3JZVA 5K8SA 1OMIA 3PLQA 1PERL 4X4GA 4GHJA 2CAVA 3E6CC 4Z5DA 2LYKA 3DL3A 4X6QB 1CAVA 5K98B 4ZU4A 1ZUGA 1LRHA 2IC1A 1ZZ7A 4MZUA 2IV1A 3RYKA 1ZRDA 2XLAA 5EFUA 1ZRRA 1LKNA 1YFWA 4XEZA 2HKXA 3RPQA 2GH2A 3GN5A 3QQ6A 1R63A 3D0JA 3BD1A 5AVPA 1X8EA 2H6BA 4I6RA 5KHIA 1JWLA 1FT9A 1EP0A 2PUAA 4I01A 1S7EA 2A6CA 4Z59A 2CAUA 3H8UA 3CECA 2IVBA 2F4PA 4YG4A 2O38A 3HT1A 4YBAA 1EPZA 4FAHA 4I2OA 2GC1A 3E97A 3NL1A 3B02A 1QWRA 4IEOA 4KU8A 4PU8A 1PRAA 4Q0PA 1H1IA 2PUEA 5LEJA 3D0SA 3GYDA 2AXVA 4O9EA 4QMAA 2KZ8A 5I0RA 2BNNA 2O1QA 3U10A 4MGZE 3R1FA 2XJ3A 4CYDA 1YFYA 4HSJA 4UXAA 4EWDA 5I91A 2LYQA 4XFHA 4PIYA 1QQAA 4Z07A 4BH9A 1OSLA 3OCPA 3FYMA 2MEZA 1ZZCA 2QNKA 1V70A 4F7ZA 3BALA 2BEOA 4QGMA 1AU7A 5I93A 4N9IA 3BDNA 4GULA 1CAXB 1JH9A 1YLLA 4KU7A 3EBRA 2O49A 3G7DA 2DCTA 3KZ3A 4FT8A 3JXCL 1DZRA 2QVSB 2ICPA 4ZU5A 2D5FA 1YWKA 5KHHA 3S0MA 1LCDA 5JR7B 4LUMA 3CROL 2PAMA 3IWZA 3FE5A 3H5TA 1LCCA 1UIJA 5BPXA 4TLFA 4MH0E 2Y0OA 3OF1A 2XCJA 4XETA 5E16A 1Q3EA 2LYSA 3SCHA 4JV4A 4X4CA 1NXMA 1RC6A 2PUDA 1J58A 4HSLA 3F51A 3FFQA 2BJCA 4F8DA 1PMIA 2MHFA 1RZRD 3D82A 5CADA 4B29A 5JAXA 4O8BA 1OFNA 1UTXA 2XGXA 4FAGA 1DWKA 3KJXA 2BYVE 2PAKA 4MX3A 4HVQA 1DGWA 3MDPA 4A2UA 3FJSA 4AQ2A 5LRSA 2WC2A 1RTVA 2ATFA 3EQEA 4E2QA 1XE8A 2Z69A 3F6WA 3ZKCA 2PUBA 3IDCB 4XFFA 4R52A 3H1WA 4JCXA 1RPEL 4Q0QA 1E3OC 2OA2A 4UBHA 4LA2A 2XL7A 2WUSR 4IVZA 3ZHIA 4HN1A 1OI6A 1XWRA 4MV2A 2LYJA 1NZCA 3TRBA 4IEQA 5FLJA 4WZCA 3OTFA 3UKTA 3UFDA 3KMHA 4MCXA 2FMYA 1CQTA 1ZAYA 2VPVA 1IC8A 4LUKA 2ICTA 2VQAA 3N4MA 2PQQA 5I8TA 3SXWA 1CAUA 1G6NA 2ET7A 1ZZBA 4PU7A 3OGJA 1DGRA 4L11A 1ZNPA 1SFNA 2FJRA 3HIFA 1UW8A 4YRDA 4LA3A 3QF3A 2O4AA 5T3NA 5KHKA 2I45A 2OZ6A 1UCXA 4JCYA 2P17A 4QM8A 4IEZA 5F1RA 1DW9A 1ZZ9A 1WLTA 2Q1ZB 5I0TA 3U11A 2HJIA 1UXCA 4ORFA 2PUCA 1NE6A 1O7FA 3O14A 3FHIB 4YARA 5I0SA 4Q0SA 3SCGA 2UY9A 3NSTA 5CVRA 3H50A 1LR5A 3S8QA 1YHFA 2IVQA 3C3VA 3O9XA 4IESA 3R6SA 4AVAA 4XF3A 3PVBB 2KXLA 4IEWA 2XHKA 1UIKA 2D93A 4YSFA 1BDIA 3LAGA 4YYOA 1EYBA 5I0UA 3EUSA 3USSA 1O3QA 1O3SA 1ZPQA 2IXIA 1HF0A 2H6CA 3MLFA 3ZHMA 1DZTA 4EWEA 4KWJA 3HT2A 3B7HA 3ROUA 3JXDL 2XIUA 3OP9A 4F8AA 3HZIB 2IXJA 1YSEA 2PYTA 2EVXA 3U3WA 2GZUA 3OMTA 2XKOA 2Q30A 3QYXA 1TQ5A 2D5HA 4LULA 2QJVA 3CL1A 1I6XA 1WH8A 4X6RB 4XF9A 5FLIA 4X4BA 5J48A 3KCCA 5KBFA 1JFSA 4HBNA 1Q5OA 5JSRA 2XSDC 2N7GA 1O4XA 4J1XA 4IEPA 4AQ6A 1O3RA 2EBYA 2R1JL 3H3UA 4Q0UA 2LYPA 2D40A 2GRMA 3D1NI 3CLCA 3S7EA 3E6DA 2HINA 5C6CA 3H3ZA 2GZWA 3I59B 2EA7A 1CAWB 2JVLA 5BXXA 3SHRA 3GBFA 1PNRA 4PIZA 3E6BA 4IA8A 3FZ3A 2AXZA 4EROA 1VPWA 1SEFA 2H8RA 3FYAA 1RZSA 1WIZA 2K0GA 3RZZA 2Q0AA 5FQ0B 2XI8A 2L8NA 1QP7A 1RUNA 1O5UA 4BIFA 5BY5A 4J1WA 3MPBA 1FI2A 4X4HA 1L1MA 4Z5CA 1J3PA 3ES4A 4BHPA 3H1YA 4I0AA 4I6TA 4NVPA 1YFUA 4XFAA 4I6UA 1CX4A 1RL3A 3OQOA 4FN3A 1CAXA 1LB2A 1ZRFA 4PIXA 4D7SA 1ZS4A 4HZFA 2AW6A 3NKTA 1GQHA 2XLGA 2PFWA 3DKWA 3I7DA 3KSCA 1RZRA 1RIOA 2IVGA 3G5GA 1J59A 3E5XA 1QXJA 2BGCA 3NVCA 3VK0A 2CGPA 1X2LA 1NYWA 2GC3A 4HN0A 3KGZA 2PE5A
chains in the Genus database with same CATH superfamily
2R1BA 1IGOA 5D21A 4GD4A 1AR61 4OI1A 5CKQA 3VBFA 3WNPA 5HI0A 5KHJA 2OZJA 1ZZ8A 1VBE3 4COVA 2YPJA 1J3QA 4KGQA 1COV3 5FBZA 5FP3A 2IZWA 1V6JA 2R49A 2ZGMA 2ZABA 5JXGA 3QBQA 5EZWA 4QT6A 3ACLA 4E2SA 1O3SA 1L7QA 1YCIA 5BNPC 1FOD1 4NRQA 4OUMA 4YW5A 1RMU1 1PZ8A 2PMWB 2XB6C 4LKFA 5DUXA 4RQPA 4OHZA 4AGRA 3OEBA 5DMYA 5IWFA 3CJIB 3LDKA 3LZZA 4MGSA 5FYVA 4CDXC 2PUFA 2G4IA 3GM8A 2LCVA 3ALQA 3OUIA 4LK6A 5CISA 2YU2A 2D6OX 4MADA 3SH4A 1AL0G 2ID4A 4KMQA 5JIAA 1ZRCA 4JGZA 4OMCA 5FLHA 3DCQA 3I54A 2NN8A 5FUIA 4JRAA 2CV6A 5HV0A 1DDLA 1OVSA 1WETA 2VC9A 3TNPB 1F35A 1Y43B 3OYWA 4PQQA 5FOJB 2DCZA 2GU9A 1LEDA 2PA7A 3FN9A 3NNFA 3SCFA 1S0GA 3DN7A 2BOIA 4CDWA 4OHYA 3ILRA 4PLMA 1H30A 2RS11 3RS6A 5A3PA 5IT6A 1R64A 2ZACA 3LIGA 4YWAA 4A45A 1RUF3 2AGSA 5DZFA 5DTRA 1X82A 1HV1A 2QFEA 3M2MA 2FDKA 1N1TA 4DINB 1QDOA 5FREA 1CGPA 3KV9A 3RVHA 4HLTA 1QY4A 5C8WA 1RINA 3VDCA 5JI7A 5KC6A 3ZYBA 2FQPA 5AFEA 3LSEA 4D6QA 1ULDA 4LBLA 4L2NA 1E5SA 1OLQA 3CZJA 4GAZA 5JI9A 2V5DA 1G9FA 4XDPA 2RS52 2XWBB 4Z2WA 5FMBA 5BNPB 4XMAA 4X4EA 1CJPA 4A7YA 1LHOA 4FPGA 4SLIA 5FO9B 2PHUA 1JU3A 4AGVA 1RUE3 2E63A 2G9FA 2ENRA 5DAQA 4Y4RA 1XNAA 4ER6A 2C5DA 4CDXB 1A34A 3VBRA 1CPMA 1YRZA 1NLSA 1VMHA 2UY8A 4FFGA 2XXPA 4LHSA 4P9GA 4DS0A 5A7OA 4MGTA 3Q9OA 2ZGKA 2W2IA 3IVPA 2ZX1A 1UPIA 2VTXA 3RYRA 1YIFA 5FAXA 1N3PA 2RR12 3AKRA 2ZMKA 1PZ9A 3I2KA 4FPFA 1QQBA 4LTAA 1MS4A 4LR4A 2KEIA 3JUUA 4UFMA 3S5QA 2FBEA 3WX5A 2ZTNA 4AWDA 3C7GA 4RGGA 4Q26A 1RGSA 1VBD3 4NRPA 2BNOA 5FMCA 4AHXA 3MZHA 2YY1A 1VRBA 4O7XA 1C4RA 1S0CA 3V0BB 1J1LA 1W6PA 1DHKB 2WO3A 1PX4A 3FFZA 4Z82A 3VD9A 1W0PA 4XC9A 1YQ6A 1OLRA 4GWMA 5C3RA 4M3CE 5JSOA 1UQXA 1W8HA 2ADEA 2B42B 3KF3A 3PTYA 4JAAA 2QTWB 4KG8A 4NOTA 3EJKA 4C1XA 5K4LA 3KGLA 2Q4SA 2XQXA 3WHUA 5A3UA 4X4FA 3POWA 4XF0A 1GOGA 3TYJA 1B35C 4XTPA 1Q43A 1B0NA 1RUJ3 1IPKA 3VHRA 1LLIA 3I59A 1SLBA 2K9ZA 2E7AA 3ELNA 2W52A 3PHMA 4A6SA 3H7JA 4XJ8A 2JDYA 1IS6A 1HJGA 2A71A 2W1SA 1EAH3 3LOIA 4JTNA 5FK8A 3NXHA 2PLV3 3I3EA 4EV0A 4LBMA 2WLQA 2Z42A 4FFFA 4UBGA 1ZA7A 1BEV3 1C8M3 2RDSA 1SBDA 3IIAA 5DAWA 1AF9A 2XONA 4N9HA 4ES9A 2WQ8A 4RSUA 4GALA 5EIYB 1IQAA 1QZXA 1WMFA 2CSGA 3NQHA 3VL8A 3WUDA 2NZ9A 5FQ0A 4YVSC 3WVJA 4PF1A 4AI9A 4Z2AA 3J8F1 2YBDA 1WW4A 4MGKE 3RDIA 1MPXA 1W0NA 4AR2A 1MS9A 3I97A 4OLLA 4JQDA 2JCGA 5DDJ3 3BI3A 2F6BA 3MIEA 4N90A 3PMSA 5C3SA 2YFZA 1I5PA 1MS1A 4Q8LA 1QJU2 2OPKA 3J7NA 1M4WA 1QP0A 2L49A 3ZXDA 2RJLA 2HCSA 3MIFA 3OJBA 2KR2A 5CFCC 3ZYFA 1HX6A 4AI0A 2FZ2A 5A1FA 2BJSA 1ADRA 1BBT3 2WSUA 2AWIA 2RR11 2WZR2 1WA4A 5E89A 4F3JA 2OXBA 2IXKA 1B35B 1H8VA 2XMLA 3TEWA 1OD3A 3O1RA 4Y42A 2E6VA 2NMOA 2PTMA 4META 5A80A 5DPNA 3POGA 1D2QA 2UYBA 3O5SA 1PVC3 1R082 2EIGA 2QCSB 3LQCA 4XMIA 4A7KA 4CXWA 5DZGA 1AXYA 4D3WA 4EZ4A 1JN2P 3MW3A 4IE7A 1J3RA 4M0HA 1TME2 3VBHC 2D6KA 2LS6A 3AZWA 4KWKA 4LBNA 4XILA 4CTEA 3PE5A 4W8JA 2Q8EA 4A3ZA 2EIDA 3VHOA 3VKOA 2MEV1 3PUSA 4FPOB 5AC91 3WQ7A 3BODA 4F83A 5C33A 3BS3A 4FBIA 5GAHi 3ENRA 3P6BA 4GH4C 3CJIA 4IEYA 4YVSB 5KXBA 4M0NA 5J3UA 1G9DA 2R063 4YG1A 1VLNA 2BBAA 4LOTA 3J7HA 1ENQA 3WG1A 4YFWA 3O1VA 4EWAA 1YUDA 4XQWA 5FZMA 5DQ0A 3T1LA 2ZBJA 4JVAA 2HWC2 5A7WB 1C1FA 5IJRA 4UYBA 4OI0A 2E32A 2OIIA 2SLIA 1LHNA 2WFF1 1BDHA 2PXEA 3B93A 4C0HA 4EN6B 2HWB2 5EV7A 4EJRA 2ZX2A 4GHJA 2CAVA 3E6CC 2JE9A 4QDRA 4CU9A 2Y33A 3NDBB 1S1AA 3M7AA 1CESA 4E4DX 3AMQA 1YQ2A 4UFIA 5ANNA 2LROA 4TTGA 4P00B 1LKNA 3OBZA 5FPLA 1YFWA 3SEPA 3I3BA 4PDWC 4YZ3A 1GSLA 2WNEA 5FXZA 3BD1A 5FKCA 3D6EA 2AH2A 1OSGA 1QJU1 1X8EA 4I6RA 2O8OA 2VCBA 3DKQA 3PUAA 3LDBA 3VBHB 1O8PA 1SBFA 2W3JA 5HCBA 1EV13 3CECA 2IVBA 3D5OA 1W6OB 5BNPA 1BK1A 2IVJA 4QKDA 3M3EA 3WNLA 4NMIA 2XPJA 2O38A 3HT1A 3WF2A 4B4PA 1UL9A 4YBAA 2WZR1 3RZMA 1QDCA 4GH4B 4FAHA 4I2OA 3E97A 3B02A 4S2FA 5GALA 3AP6A 4CDXA 5JOYA 4PU8A 1H1IA 3O0XA 3KWVA 1F4AA 3R4SA 4QMAA 3WF0A 4XDQA 1NOVA 4Q5OA 5D8AC 5FZAA 4KWUA 1R081 4LHLA 2A7AA 4NN0A 4AK3A 4JHTA 2E7QA 4Y5SA 4XFHA 1TME1 4LO8A 2NP0A 1OSLA 3OCPA 1ZZCA 4F7ZA 1V70A 1OBNA 5H9QA 2BEOA 4YZ4A 4BZ4A 3SR4A 4HKOA 4NIHA 2WA4A 4Q4W3 5I93A 3SKVA 4CUBA 5J36A 5IK5A 2XJSA 1JH9A 1S0EA 1AR72 1XYPA 3V0BA 3NV4A 4YM2A 5LA9A 3PDQA 4WVWA 1JZ2A 5IFPA 4LBQD 1F8VA 1DZRA 2WZEA 5F5AA 1K12A 5FPBA 5I0DA 2WUHA 4PDWB 3TEXA 3A22A 1T2XA 4LUMA 5IVJA 1RUI2 5F32A 3IWZA 2R0HA 2RS32 3POSA 1UIJA 5BPXA 1D0GA 3ZLIA 1Q8OA 3RZJA 1F5FA 4ZZ5A 2HWB1 2FZ1A 4LNVA 3Q8FA 1Q3EA 3SCHA 2BTVC 1AYM3 1NXMA 3BGAA 4MOAA 2PUDA 1J58A 2XWJB 3F2ZA 1X33A 4HSLA 3VB9A 3F51A 4NPMA 1OKOA 3B7MA 4F8DA 1A78A 2VOKA 5SV5A 3VN4A 3WLUA 1RZRD 2ORXA 1MZ5A 1FYUA 2RVAA 1PGW1 4YG0A 4Q4V3 2FDJA 1C28A 5F8PA 5J09A 4COUA 4TSVA 1OFNA 5D8AB 1UF2C 2AEZA 3KJXA 2W9XA 3OKZA 4Y33A 1DGWA 2BBVA 2XVLA 3ACHA 2VVDA 4GQ7A 4OQ9A 1AR92 1RTVA 3IB3A 5A6ZA 4E2QA 1JZ5A 2Z69A 3IDCB 1UAIA 1XU2A 2QBXA 4NHYA 4P08A 3CMGA 4R52A 1N1YA 4JCXA 2W94A 2OA2A 4TWTA 4XUNA 4CUCA 2XL7A 4IVZA 3AXEA 2DVFA 5JWPA 3JBG1 4ARYA 4TZDA 2UURA 3BTXA 3MV11 1QIQA 1LNSA 4LOSA 1ONAA 5B2GB 3OTFA 3UKTA 4BQ1A 5FP8A 5ACA2 2J7UA 5ERLA 4AZZA 1YYNA 2VPVA 1QMJA 4XJAA 1OURA 4KBBA 1G8WA 4BU2A 1W0OA 3SXWA 2ET7A 4QQ2A 5CB7A 1FMD2 1B35A 1DGRA 2YU1A 4AQTA 1ZNPA 3I2DA 1EUTA 4YRDA 1UW8A 2ZGOA 2JG9C 2JDPA 5T3NA 1WLCA 2ZOEB 2I45A 2DBNA 3A9XA 1MS5A 5L19A 3WF4A 3MW2A 1GKBA 2CY6A 2XH6A 1GZTA 4XE9A 1D4M1 2DYCA 4FTSA 5DTQA 2WBKA 1KRIA 2YC0A 3KV6A 2HJIA 2GNBA 1VAMA 1W28A 5JLVA 2FHRA 3MIBA 3IMMA 2PHTA 1GWKA 2UY9A 1OUSA 1RUI1 2FDHA 1IKQA 4H55A 4QX1A 4ES8A 1YHFA 2LRPA 4AVAA 1RUD2 4YVSA 1DZQA 4XF3A 4GMP0 3WG4A 2IFRA 2KXLA 4IEWA 5BYNA 4E8CA 3ZYGA 3U4XA 5IVEA 1H2MA 1UIKA 4YSFA 4P9YA 5C5UA 1RHI1 4KH9A 1H4GA 2ZHMA 3EUSA 2PHFA 1WCQA 5A7WA 3HEIA 4D6SA 3ZHMA 1DZTA 2E33A 4KWJA 3O1OA 5IHRA 3HT2A 3KQRA 3M1HA 4BQWA 2YC4A 3JXDL 3A0NA 2XIUA 3OP9A 4QPYA 1OUXA 2XUEA 4F8AA 3HZIB 1RVF2 2IXJA 1DQ2A 4P02B 3SC7X 2GALA 4JX0A 4UW6A 2BGPA 3BPSA 2Y34A 2YDEA 3DUIA 4GB33 4UT5A 1AR91 5CBLA 1KGYA 3QYXA 1AR83 1TQ5A 3OBAA 4RFRB 2TEPA 3VUOA 4IGQA 1WH8A 1QJY3 4CUAA 1QXPA 1JZ4A 1DU3D 4IW3A 2JG9B 1KQRA 2CNAA 3HR9A 4OYUA 5LBEA 4XVHA 5JSRA 4QX7A 4J1XA 4ZS3A 1OHFA 4KBZA 2YMZA 3B01A 5IUQA 2HINA 3VBHA 5ACA1 4J6GA 1CIWA 4PT6A 4DXTA 1I3HA 1AX2A 5FZEA 5IAXA 2EA7A 4MYEA 1CAWB 5F5QA 1TMF3 1W6OA 1NY72 3AVSA 2PXBA 1HXS3 3NWKA 4YPJA 1VIWB 1O8SA 2VR4A 4R9BA 4GH4A 3UV9A 5JPNB 1FMD1 1RUH2 1XU1A 1ZM1A 2HWE3 3FZ3A 3NKGA 3SNMA 2PXKA 5GZGA 2EIBA 1ASJ3 3A0KA 2ZGQA 4N7UA 2P3IA 3THPA 5KXCA 3FYAA 2VW1A 3VGIA 4UW4A 2NMNA 2Q0AA 3MF9A 1VBC2 1CD3G 2WZ8A 1GP6A 1UZZA 5FZIA 4J1WA 3WP6A 1X50A 3MPBA 4X4HA 1HQNA 4BQ5A 1G9AA 4BXFA 3I3MA 3H1YA 2YBKA 4I6TA 4NVPA 4XFAA 4DQAA 5FBJA 4YW2A 1XNDA 4LO5B 3ZMOA 2H0BA 3BVCA 1ZRFA 2VMEA 1RUD1 2CHHA 3NV2A 4HZFA 5JMCA 4AHYA 2PFWA 1QGLA 2AACA 2YFUA 4LE4A 2QUOA 1RIOA 4ZY9A 3G5GA 1N3QA 5H9SA 3EXUA 1QXJA 2BVVA 2L9LA 2WO1A 4PDWA 3AP5A 4FFHA 4BE3A 2XDVA 2XXZA 1VAVA 3BIWE 4JDNA 3KGZA 1UPSA 3LEGA 3FHIB 4PBPA 2BVBA 2Q8CA 2NYYA 2OX0A 4TXWA 1ZBA2 1WBFA 3L2YA 4ZXKA 2D3SA 1FX5A 2AXUA 1H1AA 3WW1A 1UKRA 1ZREA 1IKPA 1XNBA 2HCNA 3AZZA 3N7JA 4PI2A 3RFRA 2RMU2 3V65A 3VZOA 5C7GA 3SEEA 2K2SA 1SQ8A 1T6GC 2B9UA 5A7NA 3C7HA 4IGOA 5FYSA 3IIIA 2ZX4A 3KF5A 1PO23 2IXCA 2R7EB 1QU0A 2QKDA 4CDUC 5A6YA 1ZX5A 5C70A 5D8AA 3WY6A 4H7LA 5LK7B 1IS4A 3NJXA 1QQP3 1AJOA 3WDTA 4LPLA 2WSVA 5FFOC 4K1ZA 3L1PA 5IK7A 1C5IA 5FP7A 5ANQA 4Y5TA 1H1MA 2WFPA 2ZX3A 4LBJA 2KEJA 2P37A 3NV1A 3ZN5A 3FLPA 1DIWA 1JYVA 1NY71 1DFQA 3NJYA 1OT5A 3ZM8A 3WINE 4YZ5A 1XC6A 4O61A 3RNSA 1RUH1 2C26A 2HH9A 3MW4A 1E5HA 4FPKA 4OFGA 3OD4A 3UT0A 4JKMA 3PJQA 2W1UA 5IAVA 2PHDA 3BYWA 4DZGA 3WF3A 2VECA 2W95A 4QQLA 1A8MA 3FL7A 3I4IA 4QM9A 1VBB3 1S0IA 3KXAA 1VBC1 1CAVB 2DURA 4JRLA 4AI8A 2DVAA 1HRV3 4C1WA 4ZU7A 5A3MA 3M3IA 2P4EA 5F3CA 4XFCA 4XABA 1JBCA 4AEKA 5EJ1B 3VDBA 1WW6A 1Z7S3 3BB6A 2PHLA 3RSJA 2HYKA 1LHUA 3OGVA 4IE6A 2AUWA 4Q2FA 4V1PA 3NAPC 1CJDA 2ZXQA 1PRUA 3TN91 1R69A 2V4VA 3GN5B 3CLPA 4QGLA 5T52A 3AYDA 1PGSA 5JDBA 1OQEA 2WNUC 3PUHA 5C3QA 1BXHA 1RJ8A 1VRH1 4WBBA 4XTMA 1XE0A 1AXKA 3KVAA 5C3OA 3P1IA 2V5YA 4CDUB 3W58A 5C4WB 4DUVA 4FVVA 3KM5A 3VZNA 1CZSA 1ZRIA 2AREA 5FDBA 5KXDA 3NMBA 2P6HA 4I8TA 1HRI1 3O12A 1ZVVA 1LOCA 3BN6A 2CSFA 2O14A 4I30A 4IQPA 2MPFA 3FMYA 2YGMA 1H9PA 2Q1FA 5LASA 3T2QA 2WO2A 1GP5A 3DF0A 2UYAA 4UI9L 1VR3A 3OY8B 3ES1A 1SCRA 3ZKUA 1DP0A 2ZJCA 2HLEA 4I3PA 1AL22 5GKAC 3RYPA 3WW2A 1HQLA 1PM7A 3ZYPA 5HPOA 2LYLA 3ZOIA 4IDZA 1Y7YA 1WMDA 1V9U2 3DV8A 4KI5M 1BJQA 1XBFA 3F52A 3JD73 3KT7A 4K7JA 3VDDC 3ZXGA 4I02A 3GALA 3M3OA 4AVCA 4W6XA 4ASMB 1G9CA 3ZXAC 4D69A 2FDGA 5JXIA 1ZBE2 2PXTA 2OW4A 5EP9A 2PXUA 1OXCA 5I8YA 4RR3C 5FZLA 3R4UA 4DNYA 1V6NA 1WW5A 5T55A 3U14A 2D5VA 2XG3A 3MICA 3Q8BA 5GLZA 1TE1B 1W6NB 2ZGPA 1CONA 2JG9A 3NAPB 5E1RA 5EQUA 3SQOA 4IEVA 1TEIA 5F5IA 4HKWA 3W59A 2R63A 2QE3A 3RZKA 2I74A 2WNUB 2X53S 1QP4A 2XJPA 3IPVB 4LEJA 5DUVA 2RS12 4RHV2 2PPXA 1IG0A 1YEWA 2VAUA 3N35A 4HVOA 1N47A 1UOGA 3OOXA 4DUWA 1LHVA 4IERA 2J1EA 1YQ8A 1W8TA 1CAWA 1AR63 3W5NA 1JYTA 1COV2 4X4IA 3GHNA 3POFA 2V4AA 2FD8A 2XUMA 3B69A 2QZ3A 4EKGA 3VKNA 3WW3A 2KEKA 5FYIA 2JENA 5FY1A 3CQOA 3E5QA 4BK5A 2ZGNA 1Y9GA 3H0OA 3V64A 2VUJA 2ZS6B 3RJRA 4YW4A 1CZVA 1AHSA 3BOPA 1O5LA 5C3PA 1RMU3 3WDVA 3ECQA 2LW8A 2WKKA 2WQZC 5L36A 1RUOA 4BYYA 3A7QA 3VDDB 3AL5A 5C5TA 4GXLA 2D6PA 2HEVF 2YB7A 2JDNA 2YZ4A 1ENSA 2DDUA 4UAPA 3W21A 1RB8G 2V3CC 2ZCWA 3T30A 3W20A 4XQDA 3T4HB 4CCLA 5HCFA 4RR3B 2QDRA 3WNXA 2WIUB 3TOJA 3GZUC 5FYYA 3AX4A 4YW3A 4LBKA 4GMP1 5KHGA 4YGDA 1Q8QA 2B8MA 3FUQA 5FZ0A 5BUVA 1VJ2A 1U5IA 2KPJA 1AL21 4DOUA 2VOWA 3ZFGC 3VD4A 1WGPA 2ZKNA 3E5UA 4BJ0A 2VBPA 1CAUB 2DCYA 1V9U1 2IXLA 3HMYA 1W06A 1CJGA 1W99A 4Y26A 5A32B 4Q1PA 4FI9A 5F2SA 4EN0A 1PMHX 4K8FA 3CJXA 2R042 4XIOA 4BM8A 1ZBE1 4QX5A 4CU7A 2A6XA 2HSGA 5JCTA 2GNTA 1JUHA 4FBFA 3ZR5A 1VPHA 4EN9B 5K0UC 4RL7A 4DXSA 1UZ0A 3U0ZA 1D0HA 3K3OA 4Q2JA 3ME5A 4IXLA 2YXSA 1CQ9A 1OOPC 5FZBA 1ULOA 4XAEA 5KXEA 1WLWA 4YZ1A 3ACGA 1BHGA 3ST7A 1QOSA 1HQ1A 1NERA 1FXZA 4BMBA 4TLGA 4CU8A 3C8XA 5JOWA 4E2GA 1AUYA 2E7TA 4GQMA 4FOQA 1UU4A 4RHV1 4E27A 3LISA 5LEKA 3TELA 1NE4A 3IKWA 4NHMA 1DBNA 4IETA 2YC2A 2PELA 2ZMLA 4OUSA 1V0AA 3POIA 4E4HA 1VBE1 3H3LA 4IE4A 5FPXA 3GZEA 3UK9A 2GMMA 2W5FA 2XJUA 1COV1 4QX2A 1HB1A 1LOGA 1MEC2 4Y3OA 1DF0A 5GZEA 4EE2A 1DGWX 1S55A 2B7YA 4JCKA 4HONA 3ZPOA 1PNFA 4ZKTB 1HB4A 1S2KA 2J7MA 3I3QA 4LO7A 4XFBA 5D1IA 2OT7A 4QU1A 5EPAA 3ZXEA 4A4AA 4UWDA 2ZAAA 1JUIA 3PLQA 3J8F2 2CGOA 4X4GA 4DMIA 5B4NA 4Q4X2 1UMIA 5FZOB 3PVOA 2VG9A 3GHMA 3WUCA 1GLHA 3ZFGB 1CAVA 2X8KA 5CKMA 1FPN2 3K48A 3OWQA 1LRHA 2DTYA 1ZZ7A 2ZEZA 4UW5A 2GH8A 4NO4A 2WO7A 1ZRDA 1OH4A 5FZ1A 4XEZA 2HKXA 1CPNA 1GNZA 3CHXA 3P3NA 2QQPA 3GN5A 3R4DB 1JZ6A 1R63A 5LCWL 2XBO2 4OMDA 3D0JA 2B4KA 2FDIA 5FJKA 2JDUA 5K0UB 2GN7A 3OGSA 4XQ4A 5KHIA 1OOPB 1DLCA 4V2VA 1R1A3 1EP0A 5FZFA 5CZKA 4JKLA 5A7SA 4CDUA 2CAUA 2A6CA 4YG3A 5C4WA 4W4ZA 3VKMA 2FCUA 3M9LA 4YG4A 1VBA2 1W9WA 3KQ4B 1JTZX 5LBBA 4AF9A 1RUF1 1BEV2 2VOTA 2GC1A 3JXSA 3POJA 3ZFEC 4BQYA 5LEJA 1O59A 3D0SA 1JXNA 2AXVA 4GKYA 1IHMA 2KZ8A 1LTEA 2R041 5I0RA 3OY8A 5M0TA 4LORA 2VZOA 4LKDA 1BVP1 4AFAA 1XSRA 4Q1RA 2MEV2 5AC92 3A23A 2JQEA 5I91A 3ZSMA 1HIXA 3GZDC 5DSXA 2V73A 4Z07A 3U78A 2LNMA 1W6QB 5DN2A 2JWPA 1AYN3 4AVTA 2WAOA 1RUE1 1NT0A 2DVGA 4N7IA 3T2TA 3MPPG 2RS53 4LKSA 4Z1VA 4QKBA 3BDNA 4K1YA 1NA1C 2W92A 2VZRA 4XZPA 2WIIB 1SMVA 3MO4A 5GAGi 2DCTA 4FTBA 1W8ZA 4GWNA 5HXMA 2WFF2 4ZU5A 2ICPA 4W50A 3ZO0B 1W6NA 2PXVA 1HN1A 2D5FA 1W03A 3NAPA 1BBT2 3OBTA 3FHQA 4QHZA 1YWKA 4ET7A 1MEC1 3S0MA 1LCDA 4COYA 2WS93 4B7EA 3CROL 1SDWA 2PAMA 3K4AA 2WRAA 3TWIA 3QFIA 2WNUA 5AFBA 3IPVA 1LCCA 4TLFA 3ZYIB 1PK6C 1HJFA 1X9PA 4MH0E 5JOZA 5E16A 3IAQA 1VBD1 4Q4X1 1W2AX 4FO9A 4XW3A 1RC6A 1R1ZA 3NNLA 4UFHA 2ZMNA 1GNHA 5A3WA 1FPN1 3M3QA 3ZFEB 1W05A 2CL2A 2MHFA 2OPWA 3RG0A 3WD5A 4CVUA 4EZHA 1REFA 3C7EA 5JAXA 5CG8A 4ASLA 4G9SB 4FAGA 2PAKA 2XBO1 3KZ4C 3O0WA 4DE8A 4FPEA 1WMEA 4XXAA 2YBSA 3FJSA 4A2UA 4AQ2A 2R062 5G04L 5LRSA 3WNMA 3EQEA 5IATA 3VDDA 4OBMA 2OS2A 3ZVXA 4QHOA 3WHTA 4Q0QA 4WVMB 2RDQA 4LA2A 1B09A 1VBA1 1JOJA 1PIV2 4HN1A 1NA1B 2BU9A 1BEV1 4IEQA 3TRBA 2EXJA 4RR3A 1DQ4A 1APNA 5SV8A 4XBNA 5BV6A 2EXHA 5F7UA 1UWWA 1VB2A 1YO8A 2QQKA 3DEMA 4MCXA 3MIGA 2FMYA 3ETPA 1IC8A 4LUKA 4UF0B 1W8WA 1D4VB 1G7YA 1CAUA 4GA9A 4P9XA 1JZ3A 4CP9B 4PU7A 3HBKA 1PK6B 3G0TA 1SFNA 5A32A 3M4FA 2Y6FA 1NZIA 2OZ6A 2EXIA 1UCXA 2KM2A 2VZ1A 2ZEWA 4QM8A 4URAA 4BB3A 1DW9A 1ZZ9A 5KC5A 5I0TA 1N1VA 1WCUA 4LBOA 2Y6HA 1NE6A 1O7FA 1QJU3 2VD7A 2PXJA 1BBT1 4Y4YA 2J42A 2WWJA 2Q8DA 5LWBA 2XXQA 3WG3A 4W65A 5LBCA 2OQ6A 3NSTA 1KEXA 1QJX3 5CVRA 3I3DA 1GP4A 1LR5A 3S8QA 2W1WA 1MVEA 3C3VA 2IVQA 2BPA2 4FXGB 1NQJA 2TNFA 5GLTA 4CEWC 5FR3A 3K75B 4Q8KA 1PGW2 2J1VA 3AXDA 3LAGA 2DWRA 3DYPA 2JB8A 5I0UA 3WP3A 2L1PA 1E5RA 1IOAA 2IXIA 2YPDA 2H6CA 3AJYA 2JIJA 1DQ1A 3T09A 1R083 1YJKA 4EWEA 2R072 1W90A 4XCBA 3C2UA 1LOBA 1TME3 5FZ6A 3HJRA 4R4ZA 1OA4A 1ULGA 1S4CA 2YGLA 2C9KA 4G3YC 5FZOA 4B7KA 4CP1A 3ZFGA 2GZUA 2R061 1WZXA 2GP3A 3WT3A 2QQMA 3MLLA 2WN2A 3U75A 3JBG2 2P2KA 1UXXX 4FCAA 2HBUA 4N8MA 4CCDA 5JOXA 1NX9A 4X6RB 1OKQA 4XF9A 1JOBA 2JEMA 4B4RA 3SLIA 3NV3A 2WABA 4QD2A 5FTTC 5J48A 5KBFA 4QHBA 3FUOA 4NRMA 1WD4A 3A9ZA 2XSDC 1PIV1 2EALA 2N7GA 3KD4A 4HFSA 4IEPA 3VHPA 5DUWA 4C0BA 2ZGRA 2HWC3 5K0UA 3IZOA 5A6XA 2GRMA 5FY9A 4WVLA 1OOPA 2LALA 2I2SA 4YVWC 3H3ZA 2D43A 4OI4A 2AEYA 1AVBA 4XACA 5EJ3A 3AP7A 2HWB3 2PXPA 2JVLA 2AENA 4LO6B 5BXXA 3GBFA 1TG7A 3SITA 5DT2A 1S2BA 4M00A 1DULA 1D4M2 2VM9A 4M4RA 2VW2A 5FYCA 4Q4V2 4CEWB 1VPWA 2PXQA 4ZXEA 1REEA 2HYXA 3K3NA 1EPWA 1PMJX 3AZVA 3B94A 1RZSA 2K0GA 4FQ4A 3CIHA 3AJZA 4YZ2A 1RUNA 1O5UA 1KDKA 4DY3A 5CYYA 4Y24A 1FI2A 1H6YA 2BQPA 1J3PA 5J37A 1W6QA 4BHPA 2DUOA 4YW7A 3UJQA 4ARXA 2RM22 1RHI2 4EZIA 1LGCA 2WWSA 1RL3A 3WXPA 5J1XA 5FY4A 4FN3A 3PIJA 1KJLA 3MBWA 1ZS4A 1UY2A 2J1AA 1GQHA 2GDFA 3OGGA 1ULFA 3T2PA 3O1MA 2D44A 3ZMNA 2RDNA 3OPTA 2Y6GA 2DBIA 2J1RA 3E5XA 1GANA 3NVCA 3VK0A 4Y1XA 1NYWA 1N3OA 3WP5A 4HN0A 4B8EA 3MI8A 2R071 1W2OA 2HWD2 2E51A 5FPZA 4FPCA 1JFTA 4EN7B 2BW8A 1POV3 3USUB 3VBSC 2GAUA 4MGIE 3PL0A 4YVWB 5F5CA 3PTRB 3I2FA 3CNAA 4NR1A 5CA6A 3LFIA 1X7NA 5GJ6A 3CF6E 1URXA 3QOXA 2PXLA 1GV9A 1U2ZA 2VTXJ 2VQUA 3TRSB 3ZFEA 1ODNA 1AR73 4ER7A 1QH6A 4E9KA 1L3JA 3KVBA 3UESA 3WZ1A 4BLJA 2QQNA 5FY5A 4UFKA 4QXBA 2ZGTA 3QLQA 4AHWA 1HB2A 3JQXA 4ASKA 3P3PA 1FAYA 1SDDB 1RUI3 2V09A 3AP4A 1ZZ6A 2RS33 1RUG2 3GZDA 4HETA 4BISA 3N7KA 1SLTA 3AMHA 1E57A 3H1MA 2EWTA 3WDXA 4AI1A 1XJAA 4WVMA 5H9PA 5LBFA 2YROA 2FCVA 3EMRA 4YGCA 2JJ6A 4DB5A 4WVVA 1NA1A 4CRQA 5IFTA 4A42A 1JODA 3M70A 5HXVA 3LFMA 3S6PA 2VNOA 4Z5HA 2BV4A 2QDNA 1V6KA 2XVGA 1RITA 4JC1A 1E5IA 4Q4V1 4QWNA 4O9GA 2OFYA 4YLZA 3VBUC 1SLCA 2PXFA 3PVEA 3GUUA 1C5HA 4ZONA 5FXWA 4HMZA 1O3TA 5TSWA 2JKXA 2XL9A 4GB32 4K3UA 3SISA 2VO5A 2Y38A 1W8NA 2WL1A 4Q4Y3 2IU7A 1QNYA 4UF0A 4DRVA 3IBMA 2PN5A 3GCXA 2VMGA 4QX3A 4CP9A 1AR93 1PK6A 1W9YA 2PHXA 2QQVA 1K3IA 4LLOA 1S0JA 2C0ZA 2VOXA 1JMUB 2VZPA 4P14A 3VBSB 4UFLA 3BTZA 2RM21 2C1FA 3N9MA 4FXKB 2VZVA 1PRVA 1JHJA 3ME2A 5DABA 3ZYJB 3PNAA 3RJ2X 1ZYBA 1XOYA 2JG8C 1SLLA 2VCAA 1GOHA 5F3EA 1RYYA 3FX3A 3LA7A 5FPVA 3S30A 3DYOA 3ZX7A 3ZPYA 1J1TA 1I9RA 5FZ8A 5KR7A 4L9BA 3C7FA 5ISLA 4LK7A 3WW4A 3MF6A 2VY0A 1Y4WA 5CG9A 1JYWA 3AYCA 2HWE2 4J25A 2HWD1 2DFBA 2GC0A 2Y26A 3ITQA 3KB5A 1ASJ2 1HW5A 1UNBA 2VGDA 3WCSA 1OQDA 5HCAA 5JVVA 1FMD3 1JYXA 3AYEA 2VZQA 1H8TC 4NIAA 1CN1A 1OFSA 1X9TA 1NKGA 2B5HA 3GF6A 4CZSA 2B5AA 4EK9A 1XRUA 1S0FA 1NCRC 2C6SA 1KS4A 3U4SA 2M4HA 4AEDC 4GJYA 1K5MC 3QACA 4DEVA 4FOVA 5FZGA 2CTVA 1RUC3 2GN3A 3VBUB 4WM7C 5F39A 2B45X 2FCTA 1R093 1SG3A 5FZHA 3ILNA 2PAEA 1DYOA 4I3GA 3FBYA 1RUG1 4PQ9A 5BNOC 1W9SA 1W8FA 3AKSA 2ETEA 3RWKX 1WH6A 3ASIA 2J22A 4DO0A 1OA2A 2IWGB 2JG8B 4CA9A 5L73A 4S2HA 1PO13 2P6CA 4CCEA 2VNGA 3PMEA 1LQCA 1IQDC 2VQ0A 3B00A 3I2OA 4PU4C 1RXGA 2GNDA 2ORZA 2JKBA 5A33B 2A5ZA 4GB31 3EYPA 2B46X 3TN92 1JI6A 1RVF3 1US3A 4YG7B 2DUPA 2VUDA 1DLLA 3FC0A 2HEYF 1PO22 5FMOL 4WVZA 2D6LX 4CEWA 2GC2A 4WM8C 1U0AA 1VRH2 2ES3A 4O65A 4XOGA 5A7LA 1BVVA 1BKZA 1H8TB 1QQP2 2B39A 1MZFA 2ILMA 1Y3TA 2KA3A 2MQKA 2X5IC 2XKPA 1SFPA 4IE5A 4X8NA 1PGL2 1IS3A 4Q27A 4MHUA 2RE9A 1NCRB 3WNOA 4FOYA 2VZUA 4CSWA 1HRI2 3K77A 4AEDB 1K5MB 3KT1A 4LHNA 5EWSA 4PBOA 2YG0A 1TMF1 4WM7B 1HXS1 3GZCA 4Q29A 2MXDA 4QB2A 3POBA 4K40A 4CU6A 2QQJA 1GT0C 3KHBA 2HWE1 2AUYA 4AXOA 3A21A 1ASJ1 4Z8BA 5BNOB 1EY2A 3ON7A 4QPGC 2UWAA 2VJXA 1RUH3 2WNVC 1JOPA 4XAAA 1UU5A 4G4FA 1OPMA 5C4WC 4BK4A 3F95A 3EO6A 5GLUA 3ZDSA 3AMMA 5FUNA 3VL9A 4NHLA 3VLBB 1Z7S2 4IGPA 1VBC3 2KD7A 3FBMA 1F4HA 2CYFA 4FPLA 3USUA 4MGQA 4YVWA 1F31A 5L9BA 4AI2A 3BPZA 3HQRA 3KS7A 1GBGA 2VCCA 4IE0A 2Z2SB 3S7IA 2QQLA 4Y20B 4AE2A 5I8SA 4AGGA 2NPIA 4EQVA 2HWF2 2J1SA 1D7PM 4Z58A 3PJYA 4AAPA 4WM8B 1MS8A 3AFGA 3MEPA 3ZSJA 3WV6A 4A6OA 3MYXA 1C8NA 3CKHA 3PUIA 1WLDA 1UMHA 1V6LA 2X5IB 4PU3C 3K4ZA 3QH6A 2VEOA 4PLOA 4PF5A 1V6IA 4Q0VA 4MO3M 4R8HA 3T1MA 3ETQA 4IEUA 3H7YA 3H9AA 1ULEA 3ABZA 3LWCA 4JKKA 3LCPA 4FPYA 4INDA 4Y1VA 4COWA 1UU6A 4BDVB 1O4TA 4YGEA 2LLWA 3BCWA 5F2WA 3KCYA 3Q8EA 1ZBA3 4CDQC 4R9CA 4L92A 3QWGA 3SX0A 4FFIA 4FP3A 1VP6A 1PO21 1W2NA 2RMU3 2JDAA 2P1BA 1DYKA 5LRRA 1NCQC 3UKVA 3ZDVA 4YW1A 3LA3A 4QPGB 1UOJA 2LUWA 2GMPA 2WNVB 4YM1A 4D6RA 4YM3A 3WCRA 3JZVA 1OMIA 1QQP1 4LIUA 2Q5TA 5CNAA 1SHWB 3ILFA 3INAA 2JDZA 4PI0A 1A8DA 2CWMA 4QKNA 2BP6A 1PGL1 2ZX0A 4X6QB 4XIKA 5L7OC 1UXZA 1ZUGA 2IC1A 4MZUA 2WINB 2IV1A 3RYKA 2FMDA 3KV4A 2BFUL 3VBSA 1DQ0A 1BK0A 2E26A 3IM0A 3N9QA 5DXDA 3MLJA 3HAGA 3OPZA 5FMOS 3RI8A 3RPQA 4CCJA 3TEZA 3QQ6A 4DY5A 3ZYHA 3M3CA 1PVXA 5DAVA 2A1XA 4IUGA 3AZXA 5AVPA 5L9RA 2XHNA 4NPLA 2K46A 2H6BA 4NHXA 2OKXA 3ZXJA 4S2DA 2J7WA 1S0DA 2XJRA 4Y5Z0 3A4UA 3BUCA 1S7EA 4Z59A 1UZVA 3H8UA 4K8RB 1UX7A 3WQ0A 1AX1A 4GWJA 4JQRA 1Z7S1 3RWNA 1EPZA 2JIGA 4ZHNA 2RHPA 1CIYA 4KU8A 4IEOA 4QDQA 5FPUA 1PRAA 3JU9A 4Q0PA 2VZ3A 2WNOA 1WKYA 1H6XA 1QB2A 4LBQB 2BNNA 2ARAA 2O1QA 2VMDA 4GWIA 5JXJA 4MGZE 2G9ZA 2HWF1 4CDQB 3R1FA 3ZYRA 4BWOA 5DAXA 4DPNA 4HSJA 3FLTA 1QOOA 1NCQB 1QNWA 2LYQA 2CWSA 3J7MA 2W39A 3EB7A 3FYMA 2MEZA 3VBUA 2QNKA 5FKBA 4NIIA 1O6UA 4XUTA 3J9SA 3K2OA 4CUGA 2JX9A 4QQPA 1VBE2 1LJ7A 2W47A 4LT5A 1BYHA 4HRAA 2O0OA 1LODA 1CAXB 1UZWA 4JHZA 4B4QA 2JD9A 1YLLA 5L7OB 3KCXA 4CCCA 3EBRA 2O49A 2DVBA 4NIDA 3G7DA 4ER5A 3WDUA 5DRTA 3KZ3A 5JIUA 3JXCL 4AAXA 3K46A 2DFCA 4E4SA 1OF3A 4MXWB 2XOMA 2XJVA 4L0PA 5KHHA 3VZKA 2ARBA 3CU7A 1GICA 4UFJA 4BQ2A 2NQYA 1PZ7A 3LE0A 2JG8A 3JB4C 3WNKA 1FOD3 3JD71 1AL23 3FE5A 2ZGUA 3H5TA 3E1F1 1XXNA 3T0DA 5FZ9A 2A3YA 2EICA 3OF1A 2XCJA 1V9U3 4XETA 2Z79A 5A33A 2BGOA 4MLOA 2LYSA 4D94A 2DU1A 4JV4A 4X4CA 3ZKYA 4E4ZA 4XJUA 2ERFA 1HV0A 1PMIA 1YXWA 2HFZA 1WUVA 1WCKA 1WMXA 2V72A 1YQ5A 1FV3A 3D4KA 5GLWA 1NXD1 4A41A 5CADA 2PHWA 5A70A 3ZFFC 4LE3A 3O1SA 4O8BA 1LOFC 4HPKB 4QPIC 1H8TA 3RMYA 2XGXA 1UTXA 1JYCA 2BYVE 5LB6A 3T0BA 4MX3A 3SKJE 5IYYA 4OHXA 3MGUA 1NCRA 1XQNA 2WC2A 3VD3A 2PXDA 1RUF2 2DV9A 2UWCA 3N9PA 3UYJA 1K5MA 4AEDA 1XE8A 2RS13 3F6WA 2PUBA 1REDA 2VL4A 4RHV3 4XFFA 4BPZA 1WW7A 1MS0A 4WM7A 2QQIA 1V6OA 5FP9A 4C91A 2VH9A 1RPEL 4UBHA 1NW3A 1E3OC 2WT2A 5BNQA 2Y6LA 2WUSR 4IV3C 4AEJA 2BFUS 1XWRA 2C4XA 3HOBA 4LMFA 4V2WA 2LYJA 1NZCA 3J7LA 5FLJA 4ZZ8A 3NROA 4P9LA 5BNOA 1ALYA 3LEIA 3NO8A 4WZCA 3S5AA 2D6NA 3KMHA 5GZCA 2GSYA 5HCHA 1CQTA 1ZAYA 1GMMA 1RUE2 3LGRA 3TAYA 2OUJA 2ICTA 3DPRC 3N4MA 1TZOA 4RFT0 2PQQA 5I8TA 1G6NA 3UGGA 2WDBA 1ZZBA 1LESA 1D2SA 3OGJA 1N1SA 1GWLA 1OLMA 4L11A 3MUZ1 4S2GA 2FJRA 1SPPB 2PHRA 1HB3A 3HIFA 3KV5A 2O4AA 4D0QA 4Y1YA 5KHKA 1IZ3A 3LPFA 2WN3A 1SACA 4Y20A 4K21A 4JCYA 1IG3A 4MHRA 2VULA 1WLTA 2Q1ZB 3D8CA 5FJHA 3ZXLA 2ZGSA 2VNRA 1R1A2 1UXCA 4AG4A 3ZSKA 3O14A 3QD6A 4WM8A 3ZFFB 3VV1A 2SBAA 5LA1A 5GLVA 4QPIB 1TVGA 1OPOA 1DGRN 1VBD2 3JCIA 4NWWA 3URFA 5I0SA 2B9VA 2X5IA 5FRAA 3LEKA 2VOVA 1QOTA 5FYHA 4RS5C 1WBLA 5LK5A 1QKQA 3H50A 5IVCA 4GJZA 4QX0A 2XJTA 2IFWA 3PVBB 4ATFA 4CE8A 1GUIA 3MFAA 3ZIXA 2D93A 1XB9A 1W6MB 1G86A 4CP2A 4N43C 5DRYA 1EYBA 4YW6A 1PX3A 2WWUA 5AVAA 3USSA 2R043 4GIQA 2Y6JA 4IV3B 2JXAA 3WQ1A 2NLRA 2VMFA 3PU8A 3AL6A 3PVNA 1HF0A 1UN1A 3MLFA 1KXGA 1AXZA 4PHZA 4MSVA 1RUJ2 3THTA 1GZ9A 4QPGA 2WNVA 1AYN2 5EJZB 3P5BA 4QB1A 3RI9A 1EUUA 2ADDA 1YSEA 3MLKA 2PYTA 5EHDA 1EAH2 2EVXA 1JU4A 2R1DA 3G6JB 4DEQA 2PLV2 3OMTA 2Y0IA 3AC0A 3DPRB 2D97A 3RGBA 1OA3A 1GR3A 1LU2A 2XKOA 1C8M2 2D5HA 3LSDA 4QXCA 5LZ6A 4NPRA 1F5JA 2QJVA 3CL1A 1I6XA 2AYHA 3UNPA 2WJSA 3AMNA 4QPWA 2WS92 4HBNA 1POV0 2JDHA 1O4XA 2Y60A 2EBYA 2R1JL 4YG6A 1UMZA 1MEC3 1UY3A 3H3UA 2D40A 3D1NI 3CLCA 3S7EA 3E6DA 2WAAA 4XUQA 4AVVA 5C6CA 1QJFA 1VALA 1Z0HA 1UYYA 5DDJ2 4I0WB 3MUY1 4QQHA 3J8F3 2NM1A 1LECA 3THCA 2WT1A 2X29A 3DXTA 4Q4X3 4RS5B 5FZKA 3SHRA 3LOBA 3OSDA 2VZSA 3E6BA 4RA0A 3VKFC 1CX1A 5FUPA 4IA8A 1FPN3 2AXZA 4EKIA 4A3XA 2J1UA 5G05L 1SEFA 4YM0A 1DQ6A 3I2HA 2H8RA 2VUCA 4AI3A 5CKNA 2W87A 4LBQA 4N43B 1V00A 2G9GA 5F6LB 1UKGA 4BA6A 4CDQA 1WIZA 4L8QA 5A3LA 1F9KA 5CFCA 5F37A 3KLSA 4XXPA 2L8NA 2XBO3 5CAZA 1H2LA 1R1A1 3HBZA 1Q56A 1NCQA 2CDOA 3WDWA 3KL4A 4BQ3A 3RZGA 1OVPA 1JYNA 1L1MA 2RR13 2OQ7A 4R4XA 5C8CC 5FWEA 5FMDA 3ZN4A 1O91A 1YFUA 4HG6B 2RJKA 1PVC2 3OQOA 3H8RA 1CAXA 1CZTA 2VCMA 5LY1A 4H3WA 5L7OA 1VBA3 4A7ZA 1I1EA 4HKLA 3OEAA 3NKTA 1NAEA 4NROA 2XLGA 3AM2A 5FYUA 1BMV2 5BNNC 3I7DA 4LKEA 2VVFA 4QXHA 3UGFA 3KSCA 1RZRA 1J59A 2IVGA 4FOWA 2YBPA 4MXWA 1SFYA 2LLVA 4AQSA 5EYYA 1UOBA 5FO8B 2CGPA 3RZHA 1OF4A 1X2LA 3V0AB 1UY4A 2GC3A 5IK8A 1H9WA 2MEV3 5AC93 2YV8A 1RUJ1 2WR9A 2A3WA 2W0XA 4IV1C 1AYN1 4XHBA 4X8PA 5D2AA 5HV4A 2WA3A 2RS51 5JUWA 4XF1A 3HQUA 1X8MA 2P3JA 3DGTA 4C8DA 1EAH1 5F3GA 1O4YA 2PLV1 2E9QA 4RD7A 2PQSA 3BU7A 3FLRA 4Y22B 1C8M1 3GCWA 2F4LA 4OUEA 1LGBA 1MACA 4AVBA 2JE8A 4MG2A 1SCSA 1YI9A 2X10A 2CDPA 3HNMA 4MUVA 4ONUA 4OB4A 2WFF3 2ZHKA 2VXJA 4PLNA 2D3RA 4KL1A 2Q1MA 2RV9A 2WS91 3AFKA 1QJX2 4HPKA 3HWJA 5FYZA 1JZ8A 2OVUA 1F15A 3CEWA 3R05A 3N7LA 5JZGC 4HK9A 2O8QA 4I0BA 2DF7A 3V56A 2UWBA 3NNJA 1J84A 2DUQA 1OC1A 1MQTC 2A70A 2DCKA 5C8CB 1WA6X 3W9AA 4M3CB 5DDJ1 1MVQA 1ST8A 1GFF2 3OBRA 4FP2A 3IMNA 3KT4A 3JQWA 1POQA 3HQXA 1W8UA 1ZVFA 4ISQA 2ET1A 4XFIA 4IEXA 3S57A 3RZLA 4TYSA 2GMEA 5F9TA 5BNNB 3WF1A 2D6MA 2Y64A 5J7MA 5J96B 3HD8B 2GRLA 3ZPXA 1EV12 3JXBC 4OI2A 4URTA 5A1AA 3JB8A 2WT0A 4K9SA 3LB9A 3LEMA 4LJHA 4UOJA 3LIHA 2P34A 5CU1A 4IWRA 3J4UH 2A6ZA 4LQRA 1LOAA 1GZCA 3IN9A 1I5ZA 3NW4A 4IV1B 2WZR3 5T5LA 1CR7A 1GNYA 3VD5A 2IUOA 1SPPA 1W9TA 2VQTA 4DE9A 5C71A 3LKJA 4I09A 4OCTA 3UL2A 3IDBB 2JDMA 1NUKA 1PVC1 2XQRA 3CO2A 4H2AA 4M4PA 5A7PA 2H0VA 4DXRA 2A6WA 1PIV3 2ODRD 1DG6A 4JDOA 5T5OA 5CFDC 2G19A 2JICA 2W1QA 4OULA 5HBAA 3U37A 3KHCA 2LYRA 2VU9A 3BTYA 1BMV1 3FWEA 5FO7B 3OG2A 3ZFFA 1GQGA 2AZ5A 3MEJA 2Z4FA 4KGGA 1LOFA 4NHKA 4Q4W2 4QPIA 4XYXA 3UKNA 3ZN6B 5CFCB 1GWMA 4HT1T 3WOGA 5JZGB 4XJZA 3AB0A 3NJZA 4XJWA 4AYUA 3WNNA 4BMEA 1STMA 1GQPA 2R6QA 3QCWA 4FPJA 4GZ9A 3BTAA 4ZPIA 1UD1A 4AVSA 5JMOA 1MQTB 5FYMA 2VNVA 1W6MA 2JDKA 4PJYA 4LXLA 1FNYA 2PIJA 3I8TA 4XFGA 4JTOA 5FK7A 3IAPA 1EFAA 1QF3A 4IV3A 5FZDA 2VW0A 1DQ5A 1VAKA 2ZHLA 1YQCA 1U5YA 1MS3A 2ZAHA 4FQZA 1AYM2 4P5HA 5FZ7A 2VZTA 4B1LA 1QJX1 1MZEA 1AX0A 1QPZA 1A6CA 4MGYE 5LW9A 1UYXA 4NJ4A 1HN0A 2Y6KA 1K5JA 5FZ4A 3DPRA 2EAAA 2ZEXA 3SH3A 3N9LA 5A3NA 1S0BA 1TNFA 4LO4B 1K42A 1PNGA 3VZMA 2CU5A 1Q8PA 4D8MA 1LENA 4N53C 3DNVB 4P9JA 1NG0A 1L7RA 2R30A 1WD3A 4AFDA 1MFQC 3B3QE 3PXPA 1U5XA 1Y9QA 2ZGLA 4AFMA 4DXZA 3TEYA 2QQUA 4QU2A 5CFDB 3OQMA 1OD5A 5DZEA 2WQ4A 3A9YA 1NEQA 2DU0A 3O0VA 3CZUA 4HOOA 2MNGA 2PUGA 1EV11 2HBTA 2R073 1HDKA 4Y1UA 4RYDA 3VZLA 3WDYA 5FOBB 1NLQA 5FCCA 5IVBA 5FPAA 1LAJA 4QDSA 4KWLA 4QGNA 1F2NA 2W91A 4RS5A 5L9VA 1X36A 5GZFA 3CDZB 4MCTA 1IS5A 3L2HA 1U12A 1C1LA 2OR1L 1S2EA 1WWYA 3JBG3 3L9JT 3AVRA 3MIDA 2BWAA 3N9NA 3OD0A 3VD7A 4QXKA 4XURA 4ER3A 1Q8VA 1SQ4A 4D7TA 4K20A 3NJVA 2IXHA 2HWC1 4N43A 2RJ2A 3TBDA 3GBGA 2HEWF 2WZPP 1ZA4A 1US2A 1G9BA 1QXRA 5EXOA 1UX6A 3LFPA 3EHKA 2R32A 3OUJA 1LHWA 3QOPA 3WSOA 4BQ4A 2BNMA 5A6QA 1H2NA 2C9AA 1KJRA 2W46A 3D3AA 4Q4W1 4EYUA 4DUXA 5B4XA 4QAWA 1FV2A 1XNCA 1ENXA 2C24A 4AEMA 2XVKA 4X4DA 3ACFA 1IPJA 2BERA 3SMHA 1D4M3 5FIXA 3CBNA 3TEPA 1PM4A 4N53B 3NZLA 1ULPA 4L97A 3NNGA 2D98A 1JYIA 4Q4Y2 3C7OA 3UJOA 2A6YA 2ZEYA 1BCXA 3AK0A 5ABJC 3V0AA 3UGHA 1ND2C 3X29B 4BOWA 1M06G 1CVNA 4NDWA 3ZR6A 5FV3A 4XPVA 1AYM1 1XPWA 1OCTC 1YJLA 4EQZA 2VBBA 2X09A 2QQWA 3GJAA 4EN8B 1RJ7A 1RIRA 1LEMA 2RM23 3OQNA 3NNMA 5GM0A 1RHI3 4AHZA 2ARCA 2TBVA 3TNQA 4M01A 2EF8A 4Y22A 3THDA 4E8DA 3H8XA 5F6KA 4U36A 3SH5A 4YNIA 1W3VA 4DFSA 1LU1A 3U07A 2ZZQA 4CPBA 3LA2A 3VBOC 2P3YA 3R09A 1XE7A 1W39A 2OYZA 5C9AC 4OVEA 3B5LB 1AR82 1POV1 1BQPA 4HVRA 5DG1A 1YFXA 1QJY2 1POUA 1BLZA 2CROA 1ULCA 4XF4A 5E6HA 5JUVA 2HWD3 1LMB3 5C8CA 2LM3A 3GJBA 4M3CA 3O1PA 3K51A 1W04A 1UXDA 3B9IA 4OHWA 1CWPA 4JZRA 4UW3A 3N7MA 3QH7A 1AR71 2QQOA 5JSPA 4JGYC 1T6BX 3HN3A 1X57A 3LQXA 2CGNA 2ZKLA 2AC1A 2I07B 1RUC2 1WCDJ 2VMHA 5A7QA 2XLFA 4B1MA 3WR0A 1LOEA 5BNNA 4CCMA 4XBQA 5K8SA 1QJZA 1C57A 1R092 3GDBA 1PERL 3LPGA 5IVYA 1TMF2 2BRTA 2YHJA 5JR2A 4Z5DA 4XDOA 4YFZA 2LYKA 1HXS2 3DL3A 5CIRA 1LGNA 3AMPA 5ACA3 5ABJB 2RS31 2QZ2A 2VTFA 4BXSV 1ND2B 5K98B 2P3KA 4ZU4A 3ZXFA 5A3OA 4NWVA 1VB4A 2OUHA 3OB8A 4IV1A 5FY0A 2XLAA 1RUG3 5EFUA 3RMXA 1ZRRA 3PUQA 2P5BA 1ND3C 4CEYC 5K9YA 2YUEA 2WLPA 2GH2A 1AZDA 2ZA9A 1PO12 4XUOA 2GP5A 4QB6A 3HNYM 2BDRA 4P5YA 2JECA 3VHNA 4Z92B 1JWLA 1FT9A 5KWRA 2PUAA 2XXAA 3DM5A 3Q8CA 2RDRA 4I01A 4GKXA 4JQTA 1UZYA 3VBOB 2Z5WA 4Q4Y1 3VBFC 3ZN6A 3ZXKA 2F4PA 1UY0A 1LCLA 4CCKA 1KFUL 5C9AB 5JZGA 4C90A 3LDRA 1YIPA 2VMCA 1SZBA 3NL1A 4LIVA 1QWRA 3HN1A 2XR4A 2PUEA 1MQTA 1RUD3 4ISRA 3AYAA 3GYDA 4O9EA 5K7PA 3PU3A 5FY7A 1OLME 5FYTA 4IL7A 4TN7A 3POYA 3U10A 3APBA 3T3YA 4BCUA 3IDEA 2R16A 4RQPC 2XJ3A 4CYDA 1YFYA 4JGYB 4UXAA 4AFCA 4EWDA 5GZDA 3OGRA 4PIYA 1QQAA 3H42B 4BH9A 3LF7A 4ATEA 2JD4A 5LA2A 2WYFA 3BALA 4LHKA 4QGMA 3LD8A 1AU7A 4JGZC 2Q8OA 4FPHA 4N9IA 4GULA 1DGLA 4JDMA 4M3CF 4PCRA 1AR81 1A3KA 4KU7A 1QJY1 1MZ6A 3H8OA 1VMFA 2EXKA 3ORJA 3HNBM 3ZSLA 1W9FA 4FT8A 1NQDA 3WP4A 4COZA 2QVSB 1H2KA 1ND3B 1YI7A 4CEYB 4B3NA 2A75A 3BU0A 4XCAA 4XUPA 3I49A 3AKQA 4BLIA 5JR7B 4R9AA 4CDWC 1YNAA 1GZWB 4KQ7A 1RUC1 5CFDA 1RXFA 4LITA 2Y0OA 5DAPA 1R091 4RGKA 4W6YA 1KS5A 3K4DA 4XBLA 5FXVA 4P9IA 2TUNA 2EF6A 3VBFB 4CCNA 3TFLA 1W8OA 4K6BA 4RGAA 4ITCA 3FFQA 3T08A 1P8JA 2ARXA 2BJCA 2EAKA 2R0FA 1PHMA 3D82A 1L7LA 3OUHA 4MXVA 3IT8A 4OHVA 4B29A 3OPWA 3ZSEA 3FHAA 3N3HA 1Y9MA 2VXRA 4NAMA 5FP4A 4BQXA 1VBB2 2VVEA 1DWKA 4WZFA 1PO11 2VUAA 4HVQA 1HRV2 4RQPB 2F17A 3MDPA 1DYPA 1Z78A 4H7MA 5T5JA 2ATFA 1AJKA 1QH7A 3VBRC 5IVVA 2GNMA 3ZKCA 3VWSA 3DYMA 4CXXA 1RVF1 1KDMA 3H1WA 2D7FA 1QJEA 3HVDA 5J98B 4P9WA 4JGZB 5IW0A 4L99A 3GXUA 5A1LA 5IK4A 1C3HA 5FY8A 5LA0A 3ZHIA 5DTMA 1GU3A 1OI6A 4MV2A 3TN93 5JPMB 4DRRA 3QOWA 2VBDA 4RN5A 3OYWB 1O4ZA 4HXCA 3UFDA 4U2AA 2UU8A 4N53A 1VRH3 3POEA 4XHXA 4SBVA 2A3XA 3I2GA 1WCSA 2DVDA 5CEHA 4CDWB 1JH5A 1SLIA 2VQAA 2LTNA 3AKTA 3Q8AA 3MIHA 1JW6A 2ZHNA 2XJQA 2FDFA 5A3TA 3DECA 1LULA 1HRI3 4Y1ZA 3ACIA 4FTEA 4OQ8A 1SBEA 3N36A 3QF3A 4LA3A 4KNCA 3ZIWA 2DCJA 2JE7A 2P17A 5JXHA 2BZDA 4IEZA 5F1RA 3T4VA 3BOWA 2A6VA 3WG2A 2AR6A 3U11A 2IVIB 3JD72 3U1XA 4CPBD 4ORFA 5FXXA 2PUCA 4XJ9A 1MR5A 5T5PA 4YARA 4NE9A 4Q0SA 1XSQA 3SCGA 5E88A 1GYKA 3W5MA 2A73B 3IDAA 1Q8SA 3AKPA 1GOFA 3O9XA 4IESA 3R6SA 3M8LA 4OZOA 4W6WA 3VBRB 2IUWA 2XHKA 1UYZA 1KFXL 1BDIA 4FSJA 4XZUG 4YYOA 2W08A 5IVFA 2RG4A 1O3QA 2J1TA 1ZPQA 4YGBA 2HWF3 2VE1A 2WYSA 3GBWA 2ZZJA 3RQ0A 1TNRA 4NIGA 4HANA 1JZ7A 5H9RA 3B7HA 3ROUA 1HLCA 1K45A 1OQ1A 1VBB1 3DXUA 4WV8A 1AR62 1HRV1 1J83A 3U3WA 5FZ3A 3O7OA 4HL0A 4QQOA 3VKLA 5ABJA 1W3XA 1ND2A 2Q30A 1UO9A 3I2JA 1W2TA 1XNTA 3AP9A 1IPSA 1W6PB 4LULA 4KG0A 1ACCA 5FLIA 3UETA 5FZCA 3B9CA 1ZBA1 5FYBA 4X4BA 1QEXA 2W68A 3MV01 1HQWA 3PIGA 3KCCA 1JFSA 1YC61 2BOJA 1Q5OA 2RMU1 1U5ZA 1FOD2 1KD7A 5T54A 1O3RA 4AQ6A 1RMU2 4CXYA 2G1MA 4ZS2A 3MHZA 2D3PA 4Q0UA 1VE0A 2LYPA 1JS9A 2X05A 3WQBA 4BIOA 4AW7A 2GZWA 3I59B 2BUKA 2E31A 3VBOA 3O1TA 1UY1A 1DCSA 3PURA 4NUBA 1XYNA 5C9AA 1Y7BA 3HPNA 1JHNA 1PNRA 3WEZA 1FNZA 4PIZA 1HKDA 4MVTA 4OZXA 3BKZA 2ZPXA 1H4HA 5LY2A 1ENRA 4EROA 4QKFA 5F3IA 3T2OA 5DUUA 5DG2A 3TB0A 5LATA 3GGLA 1UOFA 3RRDA 1QHDA 2Y8KA 1NLRA 4ER0A 4LLFA 4GMP3 3GZAA 2JB4A 4NAOA 3RZZA 3N9OA 2DTWA 5FQ0B 3T0AA 2XI8A 1UYPA 4D7YA 4JGYA 1QP7A 3CJIC 4HK8A 4BIFA 5BY5A 4CCOA 3R0RA 4Z5CA 1VMJA 3ES4A 3GZTB 5FWJA 4AL9A 3MFCA 1H0BA 3NRUA 4I0AA 1BZWA 3J26N 2VMIA 4I6UA 5APAA 1FATA 1CX4A 1LB2A 1KITA 3FMGA 4A44A 3VDAA 4DIQA 1XNKA 2FFHA 1OH3A 1ZBE3 3I2IA 1V6MA 2AW6A 4PIXA 4D7SA 2BWCA 5EYXA 5T50A 3DKWA 1ODMA 3GNEA 2EIEA 3AZYA 5E8AA 2YYOA 1ND3A 4R9DA 4CEYA 1XYOA 4AOCA 3VZJA 2BGCA 2E53A 4AFBA 4H14A 3BIEA 3UWPA 1SLAA 4CP0A 3O1UA 4QX8A 1W2UA 3ATGA 1GZWA 2PE5A
chains in the Genus database with same CATH topology
2R1BA 1IGOA 1AR61 4OI1A 3VBFA 5HI0A 5KHJA 2OZJA 1ZZ8A 1VBE3 4COVA 2YPJA 1J3QA 4KGQA 1COV3 5FBZA 2IZWA 1V6JA 2R49A 2ZGMA 2ZABA 3QBQA 5EZWA 4QT6A 3ACLA 4E2SA 1YCIA 5BNPC 1FOD1 4OUMA 4YW5A 1RMU1 1PZ8A 5DUXA 2XB6C 4RQPA 4OHZA 4AGRA 3CJIB 3LZZA 4CDXC 2PUFA 2G4IA 2LCVA 3ALQA 2D6OX 3SH4A 1AL0G 5JIAA 1ZRCA 4JGZA 5FLHA 3I54A 2NN8A 4JRAA 2CV6A 1DDLA 1WETA 3TNPB 1Y43B 3OYWA 5FOJB 2DCZA 2GU9A 1LEDA 2PA7A 3SCFA 1S0GA 3DN7A 4CDWA 4OHYA 3ILRA 4PLMA 1H30A 2RS11 3RS6A 5IT6A 2ZACA 1RUF3 2AGSA 5DZFA 1X82A 1HV1A 2QFEA 3M2MA 1N1TA 4DINB 1QDOA 5FREA 1CGPA 4HLTA 1QY4A 5C8WA 1RINA 5JI7A 5KC6A 2FQPA 5AFEA 3LSEA 1ULDA 4LBLA 4L2NA 1OLQA 5JI9A 1G9FA 2RS52 2XWBB 5BNPB 4XMAA 4X4EA 1CJPA 4A7YA 1LHOA 4FPGA 4SLIA 5FO9B 2PHUA 4AGVA 1RUE3 2E63A 2G9FA 2ENRA 4CDXB 2C5DA 3VBRA 1CPMA 1YRZA 1NLSA 2UY8A 4P9GA 4DS0A 3Q9OA 2ZGKA 3IVPA 2ZX1A 1UPIA 3RYRA 1YIFA 5FAXA 1N3PA 2RR12 3AKRA 2ZMKA 1PZ9A 4FPFA 1QQBA 4LTAA 1MS4A 4LR4A 2KEIA 3JUUA 2FBEA 3WX5A 2ZTNA 4AWDA 4RGGA 4Q26A 1RGSA 1VBD3 2BNOA 4AHXA 3MZHA 2YY1A 3V0BB 1C4RA 1S0CA 1J1LA 1W6PA 1DHKB 3FFZA 4Z82A 1W0PA 4GWMA 1OLRA 5JSOA 4M3CE 4JAAA 3PTYA 3VUOA 2B42B 4C1XA 4KG8A 4NOTA 3EJKA 3KGLA 2Q4SA 3WHUA 4X4FA 3POWA 4XF0A 3TYJA 1B35C 4XTPA 1Q43A 1B0NA 1RUJ3 1IPKA 3VHRA 1LLIA 3I59A 1SLBA 2K9ZA 2E7AA 3ELNA 2W52A 3PHMA 3H7JA 4XJ8A 1IS6A 3LOIA 2A71A 4JTNA 1EAH3 2PLV3 4EV0A 4LBMA 2WLQA 2Z42A 4UBGA 1BEV3 1C8M3 1SBDA 3IIAA 1AF9A 4N9HA 4ES9A 4RSUA 4GALA 1IQAA 5FQ0A 1WMFA 3VL8A 3WUDA 2NZ9A 4YVSC 3WVJA 3J8F1 1WW4A 4MGKE 3RDIA 1MS9A 4OLLA 4JQDA 2JCGA 5DDJ3 2F6BA 3MIEA 4N90A 3PMSA 1MS1A 4Q8LA 1QJU2 2OPKA 1M4WA 1QP0A 2L49A 3ZXDA 2RJLA 3MIFA 3OJBA 5CFCC 1HX6A 4AI0A 2FZ2A 1ADRA 1BBT3 2WSUA 2AWIA 2RR11 2WZR2 1WA4A 5E89A 4F3JA 2IXKA 1B35B 1H8VA 4Y42A 2E6VA 2NMOA 2PTMA 4META 1D2QA 2UYBA 3O5SA 1PVC3 1R082 2EIGA 2QCSB 4XMIA 4A7KA 4D3WA 5DZGA 1AXYA 1JN2P 3MW3A 4M0HA 1J3RA 1TME2 3VBHC 2D6KA 3AZWA 4KWKA 4LBNA 4XILA 4CTEA 3VHOA 3VKOA 2MEV1 5AC91 4FPOB 5C33A 3WQ7A 3BODA 4F83A 3BS3A 4FBIA 3ENRA 4GH4C 4IEYA 5KXBA 3CJIA 4YVSB 4M0NA 1G9DA 2R063 4YG1A 1VLNA 3WG1A 1ENQA 4YFWA 4EWAA 1YUDA 4XQWA 3T1LA 2ZBJA 4JVAA 2HWC2 1C1FA 4OI0A 2SLIA 2OIIA 2WFF1 1LHNA 1BDHA 3B93A 4C0HA 4EN6B 2HWB2 5EV7A 4EJRA 2ZX2A 4GHJA 2CAVA 3E6CC 2JE9A 1S1AA 3M7AA 1CESA 4E4DX 3AMQA 1LKNA 1YFWA 4PDWC 4YZ3A 1GSLA 2WNEA 3BD1A 3D6EA 2AH2A 1OSGA 1QJU1 1X8EA 4I6RA 2O8OA 3VBHB 1SBFA 5HCBA 1EV13 3CECA 2IVBA 3D5OA 1W6OB 5BNPA 1BK1A 2XPJA 3M3EA 2O38A 3HT1A 4B4PA 1UL9A 4YBAA 2WZR1 4I2OA 1QDCA 4GH4B 4FAHA 3E97A 3B02A 4S2FA 5GALA 3AP6A 4CDXA 5JOYA 4PU8A 1H1IA 3O0XA 3R4SA 4QMAA 4XDQA 1NOVA 5D8AC 1R081 4LHLA 2A7AA 4NN0A 4AK3A 2E7QA 4XFHA 1TME1 4LO8A 2NP0A 1OSLA 3OCPA 1ZZCA 4F7ZA 1V70A 5H9QA 2BEOA 4YZ4A 4BZ4A 4HKOA 2WA4A 4Q4W3 5I93A 5IK5A 5J36A 2XJSA 1JH9A 1S0EA 1AR72 1XYPA 3V0BA 3NV4A 4YM2A 4WVWA 4LBQD 1F8VA 1DZRA 4PDWB 4LUMA 1RUI2 3IWZA 2R0HA 2RS32 3POSA 1UIJA 5BPXA 1D0GA 1Q8OA 1F5FA 2HWB1 2FZ1A 4LNVA 1Q3EA 3SCHA 2BTVC 1AYM3 1NXMA 2PUDA 1J58A 2XWJB 4HSLA 1X33A 3F51A 3B7MA 4F8DA 1A78A 2VOKA 5SV5A 3VN4A 3WLUA 1RZRD 1MZ5A 1FYUA 1PGW1 4YG0A 4Q4V3 1C28A 5J09A 4COUA 4TSVA 1OFNA 5D8AB 1UF2C 3KJXA 1DGWA 2BBVA 2XVLA 2VVDA 4GQ7A 1AR92 1RTVA 4E2QA 2Z69A 3IDCB 1UAIA 1XU2A 4R52A 1N1YA 4JCXA 2OA2A 4TWTA 2XL7A 4IVZA 3AXEA 2DVFA 5JWPA 3JBG1 4TZDA 2UURA 1ONAA 5B2GB 3OTFA 3UKTA 4BQ1A 5ACA2 1YYNA 2VPVA 1QMJA 4XJAA 4KBBA 1G8WA 1W0OA 3SXWA 2ET7A 4QQ2A 5CB7A 1FMD2 1B35A 1DGRA 4AQTA 1ZNPA 3I2DA 4YRDA 1UW8A 2ZGOA 2JG9C 5T3NA 1WLCA 2ZOEB 2I45A 1MS5A 5L19A 3MW2A 1GKBA 2CY6A 2XH6A 4XE9A 1D4M1 2DYCA 4FTSA 1KRIA 2YC0A 2HJIA 2GNBA 1VAMA 5JLVA 2FHRA 3MIBA 2PHTA 2UY9A 1RUI1 1IKQA 4H55A 4ES8A 1YHFA 4AVAA 1RUD2 4YVSA 1DZQA 4XF3A 4GMP0 3WG4A 2IFRA 2KXLA 4IEWA 5BYNA 3U4XA 3ZYGA 1H2MA 1UIKA 4YSFA 4P9YA 1RHI1 4KH9A 1H4GA 2ZHMA 3EUSA 2PHFA 3ZHMA 1DZTA 4KWJA 3HT2A 3KQRA 3M1HA 3JXDL 3A0NA 2XIUA 3OP9A 4QPYA 4F8AA 3HZIB 1RVF2 2IXJA 1DQ2A 2GALA 4UW6A 3DUIA 4GB33 2YDEA 1AR91 5CBLA 3QYXA 1AR83 1TQ5A 2TEPA 1WH8A 1QJY3 1QXPA 1DU3D 2JG9B 1KQRA 2CNAA 3HR9A 5JSRA 4J1XA 1OHFA 2YMZA 3B01A 5IUQA 2HINA 3VBHA 5ACA1 4J6GA 1CIWA 1I3HA 1AX2A 2EA7A 4MYEA 1CAWB 5F5QA 1TMF3 1W6OA 1NY72 3NWKA 1HXS3 1VIWB 4R9BA 4GH4A 3UV9A 5JPNB 1FMD1 1RUH2 1XU1A 1ZM1A 2HWE3 3FZ3A 3NKGA 3SNMA 5GZGA 1ASJ3 3A0KA 2ZGQA 4N7UA 2P3IA 3THPA 5KXCA 3FYAA 2VW1A 3VGIA 4UW4A 2NMNA 2Q0AA 3MF9A 1VBC2 1CD3G 1UZZA 3WP6A 4J1WA 1X50A 3MPBA 4X4HA 1HQNA 1G9AA 3H1YA 4I6TA 4NVPA 4XFAA 4DQAA 4YW2A 3ZMOA 1XNDA 4LO5B 2H0BA 1ZRFA 1RUD1 3NV2A 4HZFA 5JMCA 4AHYA 2PFWA 1QGLA 4LE4A 2QUOA 1RIOA 3G5GA 1N3QA 5H9SA 3EXUA 1QXJA 2BVVA 4PDWA 3AP5A 4BE3A 1VAVA 3BIWE 4JDNA 3KGZA 1UPSA 3FHIB 4PBPA 2BVBA 2NYYA 1ZBA2 1WBFA 3L2YA 4ZXKA 2D3SA 1FX5A 2AXUA 1H1AA 3WW1A 1UKRA 1ZREA 1IKPA 1XNBA 3AZZA 3N7JA 3V65A 3VZOA 2RMU2 2K2SA 1SQ8A 1T6GC 2B9UA 2ZX4A 1PO23 2IXCA 1QU0A 2QKDA 4CDUC 1ZX5A 5D8AA 3WY6A 4H7LA 5LK7B 1IS4A 1QQP3 1AJOA 3WDTA 2WSVA 5FFOC 4K1ZA 3L1PA 5IK7A 1C5IA 1H1MA 2WFPA 2ZX3A 4LBJA 2KEJA 2P37A 3NV1A 3ZN5A 3FLPA 1DIWA 1NY71 1DFQA 3WINE 4YZ5A 3RNSA 1RUH1 3MW4A 4FPKA 4OFGA 3OD4A 3PJQA 2PHDA 4DZGA 2VECA 4QQLA 1A8MA 3I4IA 4QM9A 1VBB3 1S0IA 3KXAA 1VBC1 1CAVB 2DURA 4JRLA 4AI8A 2DVAA 1HRV3 4ZU7A 5A3MA 3M3IA 4XFCA 1JBCA 4AEKA 1WW6A 1Z7S3 3BB6A 2PHLA 3RSJA 2HYKA 1LHUA 2AUWA 4Q2FA 4V1PA 3NAPC 1CJDA 3TN91 1PRUA 1R69A 3GN5B 3CLPA 4QGLA 5T52A 3AYDA 1PGSA 5JDBA 1OQEA 2WNUC 1BXHA 1RJ8A 1VRH1 4WBBA 4XTMA 1AXKA 2V5YA 4CDUB 3W58A 5C4WB 4FVVA 3KM5A 3VZNA 2AREA 5FDBA 5KXDA 4I8TA 1HRI1 3O12A 1ZVVA 1LOCA 4IQPA 2CSFA 4I30A 2MPFA 3FMYA 2YGMA 1H9PA 3DF0A 2UYAA 1VR3A 3OY8B 3ES1A 1SCRA 2ZJCA 3WW2A 4I3PA 5GKAC 1AL22 3RYPA 3ZYPA 1HQLA 1PM7A 2LYLA 1Y7YA 1WMDA 1V9U2 3DV8A 1BJQA 3KT7A 3F52A 3JD73 4K7JA 3VDDC 3ZXGA 4I02A 3GALA 3M3OA 4AVCA 4W6XA 4ASMB 4D69A 1ZBE2 2OW4A 5I8YA 4RR3C 3R4UA 4DNYA 1V6NA 1WW5A 5T55A 2D5VA 2XG3A 3MICA 5GLZA 1TE1B 1W6NB 2ZGPA 1CONA 2JG9A 3NAPB 5E1RA 4IEVA 1TEIA 4HKWA 3W59A 2R63A 2QE3A 2I74A 2WNUB 2X53S 1QP4A 2XJPA 3IPVB 4LEJA 5DUVA 2RS12 4RHV2 2PPXA 3N35A 4HVOA 1N47A 1LHVA 4IERA 1CAWA 1AR63 1COV2 4X4IA 3GHNA 2XUMA 3B69A 2QZ3A 3VKNA 3WW3A 2KEKA 2JENA 3E5QA 2ZGNA 3H0OA 3V64A 2VUJA 2ZS6B 3RJRA 4YW4A 1AHSA 3BOPA 1O5LA 1RMU3 3WDVA 3ECQA 2WKKA 2WQZC 5L36A 1RUOA 4BYYA 3VDDB 4GXLA 2D6PA 2HEVF 2YZ4A 1ENSA 1RB8G 2ZCWA 4XQDA 5HCFA 4RR3B 2QDRA 3WNXA 2WIUB 3TOJA 3GZUC 3AX4A 4YW3A 4LBKA 4GMP1 5KHGA 4YGDA 1Q8QA 2B8MA 3FUQA 5BUVA 1VJ2A 1U5IA 2KPJA 1AL21 4DOUA 2VOWA 3ZFGC 1WGPA 2ZKNA 3E5UA 1CAUB 2DCYA 1V9U1