1ZZ7A

Crystal structure of feii hppe in complex with substrate form 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
192
structure length
178
Chain Sequence
b'ASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyprophylphosphonic Acid Epoxidase
molecule tags Oxidoreductase
source organism Streptomyces wedmorensis
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
total genus 41
structure length 178
sequence length 192
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz7A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz7A02
5FLHA 1TQ5A 2UYAA 1RTVA 2H6CA 3ZDSA 1DZRA 3EJKA 1ZRCA 3IVPA 2LYKA 1GQHA 1Q43A 3DNVB 5JSPA 4IVZA 2BNMA 1U12A 3LFPA 3JXDL 1BDHA 1X2LA 2D40A 3WW1A 2HKXA 3BCWA 2C0ZA 1V70A 1ZX5A 2OFYA 1RC6A 2UY9A 1PNRA 1CAVA 4HVQA 1HF0A 1Y7YA 4LLOA 2LYLA 3HT1A 4LUKA 5KHGA 1O3SA 5A7LA 3KCCA 4IEPA 3C3VA 5FLIA 1LR5A 4FAHA 4UXAA 2GH2A 4HVRA 4XFAA 1RGSA 1X8EA 2IXKA 3E5UA 4KL1A 1SEFA 3SXWA 3N4MA 5J48A 4L2NA 3S8QA 4IWRA 3UKVA 2UY8A 4IETA 2AW6A 3UKNA 4Q0QA 3OF1A 2IC1A 2XCJA 4O8BA 1R69A 1RPEL 1ZRDA 2CSFA 3FYAA 2IXLA 5I0SA 2MQKA 4IEOA 3GN5A 3ZHMA 1DW9A 4Z59A 1ZZ6A 3ZHIA 2BYVE 2XKOA 2OZ6A 4MGZE 2IV1A 5KBFA 1VP6A 4XFBA 3PXPA 4B29A 2A6CA 2OA2A 4ORFA 4XF9A 4HSJA 3LOIA 3PLQA 2ZCWA 4LUMA 3BD1A 2EWTA 1LRHA 3I7DA 4I02A 2PAMA 4LTAA 4YG4A 1LLIA 1I5ZA 3E6DA 1XWRA 1NZCA 3D0SA 2LCVA 4IEWA 1O5UA 5FDBA 2ZKLA 4HVOA 2XLAA 4PJYA 3LA2A 3RDIA 1RZRA 3I54A 4PU3C 3ZKCA 4Z5CA 2F4PA 2IXCA 3O9XA 4XFCA 2HJIA 4X4HA 1QQAA 2H8RA 2BGCA 1BDIA 2PUEA 2XLGA 1Y9QA 1QP0A 1UIKA 4BIFA 5FQ0A 3F52A 4GHJA 2K0GA 5I91A 3E6CC 1PM7A 3ES4A 3B7HA 3MDPA 4EWDA 3OGJA 2QDRA 5D1IA 2PIJA 1FXZA 1O7FA 3FFQA 5E16A 1QP4A 2K9ZA 2H0VA 4BHPA 4I2OA 5E1RA 1CAWA 1EP0A 1ZUGA 3OQOA 1PRUA 1L1MA 2D5VA 4MGIE 2B8MA 3H50A 1IPKA 4D7SA 1UD1A 1UTXA 2O4AA 5K98B 2VPVA 1RL3A 4X6QB 3BPZA 2BNOA 1OD5A 2Y0OA 4HSLA 4XF1A 1WGPA 3FE5A 2IVQA 4HZFA 5JSRA 2CROA 3HT2A 3WW2A 2AXZA 3O14A 2PAEA 2GU9A 1Y3TA 1ZREA 1PRAA 1O5LA 1UPIA 3LA3A 3D0JA 1J3RA 4I6UA 4QGMA 2CAVA 5I8SA 4I0BA 2L8NA 4IEVA 2EF8A 2ATFA 4I0AA 1FI2A 5JAXA 2PUGA 4I3PA 2ET7A 4AXOA 2H6BA 2UYBA 4MZUA 5I0UA 1R63A 4R8HA 1HW5A 1DGRA 4OFGA 1RIOA 4OB4A 3H3ZA 1Q5OA 3BDNA 4QMAA 5LRSA 1RZSA 5JCTA 2D5FA 4HN0A 2PE5A 3U3WA 5I8TA 5I8YA 1RZRD 3F6WA 4X4DA 2XGXA 1CJGA 4N9HA 2O8QA 3H1MA 3ETQA 2D93A 4IA8A 2B5AA 4KU7A 4A2UA 2HINA 4Q0VA 1O4XA 1X57A 3BS3A 3OQNA 2PAKA 2LYSA 3KGZA 1DZTA 1H1IA 2BEOA 1LQCA 4MGYE 4MCXA 1YFUA 3CL1A 3RYPA 4YSFA 3S0MA 3LISA 3SCGA 4RD7A 3IBMA 2KEKA 1POUA 3GN5B 1CAXA 1ZRRA 4WVZA 3KXAA 1I6XA 3GBFA 3H5TA 2EBYA 2KPJA 4EWEA 3BU7A 3CLCA 1CAXB 1Q3EA 3EUSA 3TNQA 3S7EA 3QYXA 3DV8A 2ICTA 2GZWA 1ZZCA 1LCDA 4MUVA 2WC2A 2IXJA 3OTFA 2PHLA 1LKNA 4XF3A 5I0TA 4Y42A 3M3IA 2I45A 5BY5A 1LB2A 5EFUA 4X4FA 2Z2SB 5C8WA 1NXMA 2OPKA 2Q0AA 4Q0UA 3LA7A 3KZ3A 4GQMA 5I93A 2OR1L 2FJRA 3RZZA 2OZJA 4MH0E 2PQQA 3H7JA 2ETEA 4GULA 3LZZA 1YHFA 2L49A 4JTNA 1FT9A 3I59A 1NE6A 4X4IA 4P9GA 4XFFA 3CJXA 2KZ8A 4JCYA 3CO2A 4ZU4A 1LMB3 4IEYA 4YRDA 2MEZA 1CX4A 3EO6A 5AVPA 2PUCA 4DINB 3I59B 2GRLA 4XFHA 3NKTA 3OP9A 1S7EA 3JZVA 3S7IA 2IVGA 2IUOA 2AUWA 1WA4A 3U11A 1RUOA 2O38A 2QCSB 2Q1ZB 2CV6A 4HN1A 5BXXA 2R1JL 3RYRA 3H9AA 2E9QA 5LEJA 2LYPA 5HI0A 1YWKA 2O1QA 2O49A 3EBRA 5BUVA 5KHKA 2B5HA 2R63A 3ROUA 2HSGA 3DL3A 1O3QA 3EQEA 3VHRA 1NE4A 3KMHA 3QF3A 1SQ4A 5KHIA 3NSTA 1J59A 4WBBA 4QGNA 1QQBA 3KGLA 4Z5HA 4YG7B 1SQ8A 4CYDA 2AXUA 3LAGA 1ZPQA 4AVBA 4Z58A 5FCCA 4XF0A 1O3TA 3H3UA 3QQ6A 1ZZ8A 3TRBA 1JWLA 3NW4A 2PYTA 3QWGA 4ONUA 1JFSA 3LWCA 1J3PA 3FMYA 5I0RA 5CVRA 4QX5A 1OMIA 3MYXA 4IEUA 5FQ0B 1CAUB 4LA3A 2OYZA 3MZHA 3HQXA 3GYDA 4PIZA 2XHKA 3USSA 2V09A 2IXHA 3SMHA 5KHJA 5J7MA 3HIFA 3EHKA 4ZU7A 1H1MA 2P17A 2EVXA 2AWIA 3FWEA 2GC1A 1AU7A 3U0ZA 2PTMA 1PRVA 2JCGA 3R1FA 2EAAA 4IEQA 1JH9A 4IESA 3E97A 4OLLA 1CAVB 4PU4C 3ST7A 4JVAA 3IIAA 1J3QA 1WH8A 3IDCB 1XRUA 3OD0A 4ZU5A 4YBAA 5T3NA 4AVCA 4I09A 2MPFA 1PERL 1DGWA 3KSCA 1YLLA 2WFPA 2PFWA 5FLJA 2XIUA 1OSLA 3NVCA 1J58A 4PIXA 4WZCA 4MGKE 4X4GA 4KWKA 4IEXA 2GZUA 3RYKA 2GAUA 4KU8A 3WW3A 4F7ZA 1ZZ7A 3IWZA 5KHHA 1YFXA 2BNNA 3M70A 5CU1A 5K8SA 4XETA 2CGPA 3QACA 3G7DA 4J1WA 1VPWA 1E3OC 4E2SA 1ZRFA 4NDWA 4N9IA 1UXDA 3OQMA 3L1PA 4Q0SA 2XL9A 1ZAYA 5JSOA 1ZVFA 1QY4A 2WUSR 1QPZA 4L11A 4I01A 4PU8A 4X4CA 5BV6A 4FBFA 1OCTC 2PPXA 4UBGA 1NERA 1X7NA 3H7YA 4E2GA 4FN3A 2IVBA 2JVLA 3MLFA 4YG1A 3DKWA 3H8UA 3ACLA 3NL1A 4JV4A 1O3RA 3G5GA 4JCXA 1CAUA 1ZNPA 2LYJA 1XE8A 4FBIA 1YFWA 4Z5DA 2GC3A 3E6BA 1EPZA 4J1XA 1QP7A 2GC0A 4HMZA 4XEZA 1UIJA 1SFNA 4XF4A 1IPJA 1UW8A 2PUFA 1UCXA 4X4EA 3CF6E 4MCTA 3ES1A 1VR3A 3BB6A 4HLTA 4PU7A 4NVPA 3CECA 3KJXA 2WIUB 4QM9A 4F8DA 5FPXA 4KWLA 4O9GA 4R52A 2GC2A 5J3UA 1YUDA 4H7LA 3QOPA 2Q30A 5EZWA 3H1YA 1GQGA 2VQAA 3CROL 5LRRA 4X6RB 4X4BA 4TLFA 3SCHA 3RNSA 2ICPA 3L2HA 1WH6A 2IU7A 4FT8A 1ADRA 3VK0A 1J1LA 5FPZA 1UXCA 4I8TA 2MNGA 4IEZA 1X82A 4MX3A 4Q0PA 1WIZA 1CQTA 1L3JA 2ET1A 1DWKA 2LYRA 2QNKA 3DN7A 4YNIA 4O9EA 4PIYA 1VJ2A 4LEJA 4AQ2A 2D5HA 4META 3TNPB 1CGPA 4EWAA 2XLFA 2QVSB 4HBNA 5F1RA 4BYYA 4E2QA 1CAWB 1NEQA 4Z07A 1EYBA 2B9UA 4BH9A 3ELNA 4EROA 2KEIA 2KXLA 3CLPA 2EA7A 4F8AA 3D1NI 4JQDA 4Z82A 1QXJA 1QWRA 3WW4A 3B02A 5BPXA 3H1WA 3PVBB 3JXCL 4UBHA 3IDBB 1YSEA 2QJVA 3FJSA 1G6NA 1OI6A 4LA2A 2CAUA 3HZIB 1PMIA 4D7TA 2DCTA 1WLTA 2VECA 2MHFA 4K8FA 2BJCA 5JR7B 4QXKA 4AVAA 2Q4SA 3F51A 2KEJA 2PUDA 2FQPA 3JXBC 3D82A 4LULA 4QM8A 3MPBA 1ZVVA 2AXVA 4KWJA 3OCPA 4QGLA 2PHDA 4MV2A 3RPQA 1B0NA 2XI8A 3FZ3A 2PUAA 3UFDA 4YYOA 4XFIA 4EV0A 2XSDC 2N7GA 1WETA 4IERA 4AQ6A 1JFTA 3E5XA 2GRMA 1YFYA 2PUBA 5CADA 1OFNA 3SCFA 1ZZ9A 1GT0C 5C6CA 3FX3A 3BALA 3NJZA 2XL7A 2PA7A 3CEWA 3E5QA 2XJ3A 1ZZBA 4I6TA 1EY2A 4XFGA 1EFAA 3U10A 2IXIA 1ZS4A 3OMTA 2LYQA 3PNAA 3FYMA 4I6RA 1RUNA 3SHRA 3R6SA 1O4TA 1IC8A 2Z69A 1NYWA 3UKTA 3FHIB 4FAGA 1X8MA 1LCCA 1QXRA 1JUHA 4Q29A 2XKPA 4YARA 5LEKA 2FMYA 1XE7A 4JTOA
chains in the Genus database with same CATH superfamily
5A6YA 2AH2A 4OQ8A 3OWQA 2ES3A 2UYAA 3ZR5A 1U5YA 4CXXA 5F3CA 3T30A 5LW9A 5JLVA 5JSPA 4IVZA 1QQP2 4FPEA 3VKNA 2BNMA 1RUI3 1Y4WA 2VBPA 3JXDL 3VBRC 1XPWA 3LDBA 1X2LA 3VV1A 5L9BA 1ST8A 1UU5A 5GKAC 2LS6A 3VBFA 1PNRA 1SLIA 4LHKA 4QX1A 2V4VA 3SITA 1JOJA 3HT1A 5KHGA 2HBTA 5JMOA 4C0HA 1FPN2 1K5JA 1SCSA 4LR4A 4RR3C 2ZOEB 3VKOA 3JCIA 3N9MA 1LR5A 5A7OA 2RS13 4FAHA 1ASJ3 2VE1A 1WMEA 1U5XA 1X8EA 1X9PA 2D3RA 1RMU2 2WZ8A 4CCDA 3QOWA 3K4DA 4CDWC 1ZBE1 1U0AA 4RFT0 3PMEA 4GXLA 5CBLA 1AL0G 4FCAA 4LBKA 3RJRA 4B3NA 4B1LA 2HWE2 3SR4A 2P2KA 2HWB3 2X5IB 1EUTA 3DYOA 1GZCA 4LKFA 3TOJA 2IC1A 3FUOA 4ZY9A 3WCRA 1ZRDA 1LHVA 2A3YA 3UGHA 2MQKA 4ARYA 3ZHMA 3KHBA 3I49A 4IE7A 2XBO1 2BYVE 1MS1A 3LEIA 5GM0A 1W6QB 2R1DA 2IV1A 2AREA 5FP8A 3QBQA 1BHGA 2W92A 3PXPA 4IGPA 3Q8EA 4QQHA 1PO21 1DLLA 2DYCA 2I74A 2P6HA 2OA2A 3ACFA 3K75B 4B29A 4GQ7A 1OOPB 1AXZA 3BD1A 3IDEA 4C90A 1VBB2 2XXAA 1AR72 2PAMA 4LTAA 5K7PA 1XWRA 3CZUA 5A3TA 1NZCA 3D0SA 2LCVA 1O5UA 3B3QE 1VMHA 1GP4A 1WD4A 2RM22 4HVOA 5FDBA 1PIV1 3LA2A 3NNJA 4PBPA 5GJ6A 3PU8A 1RZRA 3I54A 1JH5A 2DU0A 4PU3C 4YW2A 5LA0A 2E7QA 5CIRA 2DFBA 4ES8A 1S0GA 4XFCA 4D94A 3ME5A 4XOGA 1ZM1A 2PUEA 3VKMA 4BIFA 1UIKA 4OULA 5FQ0A 5IYYA 2JB4A 4CU9A 4LBQB 1W28A 4AFAA 1H6YA 3WF1A 4EN8B 2C24A 2I07B 3B7HA 3CJIA 3KCXA 3ON7A 3QD6A 1T6BX 5D1IA 2PIJA 1PIV2 5E16A 5FZEA 4LKEA 1H8TC 1GLHA 1QP4A 1UWWA 3AMNA 3EB7A 4XPVA 3ZXJA 5E1RA 4G4FA 4UFIA 4ZZ5A 3KS7A 1CAWA 5DUXA 5EJ3A 3ZYFA 1GNHA 2A3XA 5DG1A 3QH7A 2CDOA 3AKPA 2VMEA 1YJLA 4QPGC 4EKIA 2B8MA 1VRH2 1G86A 2O4AA 2XJSA 5FZGA 5HXMA 3VDAA 5JPMB 2FCVA 4K8RB 4OHZA 2AC1A 4XF1A 1WGPA 4M3CB 1E57A 2IVQA 5A3OA 3DECA 2BWCA 4FTSA 2BZDA 1WMFA 2YY1A 3O14A 2VTXJ 3IB3A 1MVQA 2GU9A 2JQEA 1ZREA 2NPIA 1GBGA 3BGAA 3PTYA 4BQWA 1RUE1 2ARXA 2ZAHA 2CAVA 4LK7A 4N53C 4IEVA 5A6QA 1FI2A 3MLKA 2PUGA 3W58A 4E9KA 3RZKA 3LQCA 4Y20B 4MZUA 1NAEA 1PVC1 3KT4A 3KF3A 3VZJA 2B4KA 1DGRA 3Q9OA 3WSOA 2DTWA 3UJQA 1RIOA 4ZPIA 4OB4A 3H3ZA 3B9IA 3HJRA 3POFA 4XDQA 1U5IA 1Y9GA 4O7XA 4YLZA 4LO4B 1VMJA 4A6SA 1FPN3 3GCXA 1LTEA 1RZRD 1U5ZA 5EP9A 2ORZA 4X4DA 1PHMA 1CJPA 2QQLA 2WBKA 1ASJ2 1KXGA 1OQ1A 4N9HA 3H1MA 4BDVB 3TEZA 3ETQA 2E51A 5FPLA 3U75A 4IA8A 5JIAA 2RJKA 3VBSA 3ZYPA 1OHFA 3AXEA 2XJRA 4A2UA 2ZKNA 4Q0VA 4OI2A 2A6YA 5FUIA 4IGOA 2QQOA 5E88A 2YBDA 3BS3A 2JDKA 2LYSA 5E89A 4EN6B 1OQDA 4OHYA 2BEOA 1H1IA 4W6YA 3ME2A 4MGYE 1YFUA 3FC0A 3I2GA 3TFLA 4Q4Y2 3SCGA 5LASA 5EWSA 1VBA1 1POUA 1WCKA 1CAXA 1ZRRA 3HAGA 4X8PA 5F6LB 3T4HB 1RUD1 1SDWA 3PUHA 4XMAA 2EBYA 1AXKA 3BU7A 4W4ZA 3CLCA 4MLOA 3EUSA 4CEWA 3A22A 2RMU3 2W1UA 2W5FA 4FOYA 5FZ9A 1CD3G 2GZWA 4CDWB 5JXJA 4MUVA 4QXHA 1I1EA 2IWGB 4NROA 3WDTA 2VNVA 4FPLA 1LKNA 4P9YA 3VGIA 3V0AA 4R9AA 4QDQA 4DUXA 3SLIA 4L8QA 3ZPXA 5C9AB 1T6GC 1W2TA 1NLSA 1XU2A 2CHHA 4PDWA 3M1HA 2QQVA 3FHQA 4H2AA 2BUKA 3BODA 3I8TA 3LA7A 4Z92B 3KZ3A 4GQMA 1FMD2 1TMF1 5I93A 2OR1L 4EYUA 5DDJ1 4YVSC 2PQQA 2VULA 3KVAA 4AG4A 5C33A 2AZ5A 4GULA 1REFA 3RZGA 2YUEA 4UW6A 3B5LB 2L49A 4LHSA 3G0TA 1NE6A 4ZS3A 2DF7A 4JCYA 4UF0A 4ZU4A 1LMB3 4IEYA 4A7KA 5AVPA 1LGBA 3EO6A 2BP6A 4EN9B 3MICA 2GRLA 2A3WA 3OP9A 2UWBA 3S7IA 1VAVA 3MHZA 4NHKA 1LHNA 1QJY2 4H55A 2UWAA 3GALA 3U11A 1QNWA 4P9WA 5A7PA 4JC1A 2Q1ZB 4Y5Z0 5BXXA 4DEVA 2R1JL 4YGEA 3RYRA 3VBRA 3FMGA 4Y3OA 1NCQA 2E9QA 5A32A 2LYPA 5HI0A 5BNPC 5BUVA 5KHKA 1V00A 1N1YA 4CE8A 5FZLA 2HSGA 4NRPA 3DL3A 1AR83 2G1MA 1NE4A 1W0OA 2EXJA 2VL4A 1SQ4A 2ZGKA 3R0RA 2PHTA 4PI2A 3O12A 4LIUA 4A4AA 3NSTA 5KHIA 3ZYHA 2X29A 4QGNA 4WVWA 2LRPA 4TWTA 3ZXAC 4GKYA 1SQ8A 4X8NA 5DUUA 3AL6A 1XYPA 3I3QA 1ZPQA 3VL8A 4AVBA 1QJX1 5A3UA 1JYIA 3BOPA 1BZWA 3QQ6A 1ZZ8A 2HEYF 2PYTA 4WVVA 3U14A 1PZ7A 2X8KA 3DXTA 4CU7A 3T2OA 1J3PA 3FMYA 4XBQA 4CCEA 1TME2 1COV1 2GN3A 3GNEA 4QX5A 1OMIA 3LE0A 4COWA 3GJAA 5FQ0B 1D7PM 1NZIA 4LA3A 1C3HA 3R4SA 5LBCA 3GYDA 5CB7A 3ZOIA 2XHKA 4FOWA 4FQZA 4M4RA 1VBD1 2OVUA 3POYA 3QH6A 1DDLA 4IXLA 2RS12 1MFQC 2ZGLA 2J1EA 1QF3A 2Z5WA 2HWC1 1Y9MA 1OOPC 2VCBA 1S55A 3IMMA 3T0AA 4CDXA 5CISA 3AX4A 1CZSA 1MZ6A 4A41A 1VBE3 4JQRA 3K51A 4RHV1 1AYM3 2XDVA 5JMCA 2HWB2 3FLTA 1TMF3 4R4XA 1C28A 2RDRA 4QU2A 3HWJA 4NWWA 2JDMA 2OQ7A 2XUMA 3THDA 4AI9A 3R1FA 1L7LA 1V6MA 2VCAA 1R1A3 4Q4V1 1KS5A 1YQ5A 2XVLA 4G3YC 3M2MA 2LROA 4IESA 1GOGA 4W50A 2P3JA 1V6IA 5LBBA 4JVAA 1MS9A 1GANA 2VMHA 1J3QA 1WH8A 3AYEA 1PO12 4ZU5A 5ABJC 5CFDA 1DYKA 4CUBA 5J96B 5T3NA 4AVCA 3TB0A 5CEHA 4LJHA 3ZFGB 1W9SA 4CRQA 2Y6HA 4ER7A 5H9SA 2W08A 3FN9A 1VBB3 1Z0HA 1JW6A 3I3MA 5FY0A 4S2HA 4K1YA 4Q4X1 2QQMA 2YPDA 4CDXC 3O1RA 2K46A 5KC5A 2GZUA 2VO5A 2JD4A 1C8M2 1JI6A 1W8ZA 5L36A 4KU8A 3AYCA 5K4LA 1QH6A 4F7ZA 4FQ4A 4LO8A 1ZZ7A 2NZ9A 3IWZA 4XXPA 5FV3A 1YFXA 2CY6A 1HIXA 2JDUA 4AFMA 2R32A 4NPRA 3ZSJA 4AZZA 4CP9A 3WLUA 1RUI2 4L92A 3NNGA 4P14A 3U4XA 2VMGA 3TEYA 3G7DA 4XW3A 4QKFA 2VJXA 4K7JA 3O7OA 4EQVA 1HRI2 1N47A 5BNOA 3T1MA 3L1PA 4S2DA 4FPCA 4GAZA 1ZVFA 1GR3A 1AJKA 1LOGA 1JU3A 3PL0A 4UW3A 1QPZA 4G9SB 4L11A 4PU8A 4KNCA 2Q1FA 3B94A 3MIDA 4FN3A 2DVFA 1W8WA 3N9NA 3VHPA 2JVLA 3DKWA 1YI9A 2XVGA 3VN4A 3ACLA 4MXWA 1V9U3 2P34A 1O3RA 1BK0A 5HV4A 3RFRA 1DULA 5J1XA 3CU7A 3C7FA 5LB6A 4CZSA 1YFWA 3BKZA 4Z5DA 4WM7B 1LOFC 2GC3A 3E6BA 3RVHA 3S5AA 1ND3C 4XEZA 1JOPA 2FZ1A 3MF6A 3O1OA 2PUFA 2RDQA 3CF6E 2D98A 5SV5A 1ZRIA 5F5IA 2WO3A 4QPWA 2J7UA 5BNOC 1CN1A 2WNVC 3WP5A 1H2MA 3DYMA 1YQ6A 3MV11 5GZFA 4PT6A 3WDYA 2GALA 4F8DA 4QM9A 1MS8A 5FPXA 1UQXA 4R52A 2OXBA 5J3UA 2JIGA 4QX7A 3QLQA 3ZMOA 5ANQA 5EZWA 3ZSKA 1V6OA 1TME3 2VQAA 4NHLA 5EJ1B 3VBUC 2Q8DA 1CVNA 3VDDA 4X6RB 3GJBA 2BVVA 5K9YA 1YI7A 3RNSA 2WZEA 4MADA 4KWUA 1FNZA 4JHTA 4AFBA 1M06G 2DVDA 4XIKA 5CFCC 3GZUC 1LGCA 4FT8A 5KXCA 4HRAA 1XB9A 4L99A 5FY1A 1Q8OA 1DWKA 2LYRA 2CGOA 4ZHNA 4YNIA 3NJVA 4O9EA 4PIYA 2BTVC 2E26A 2VMDA 1UAIA 2VZ3A 2OKXA 5FZKA 4D8MA 3TWIA 5CZKA 5C70A 3MGUA 5FZBA 1S4CA 5FY8A 2WN3A 2QQNA 2VZUA 5F1RA 2PXQA 2WZPP 2Q5TA 1CAWB 4Z2AA 4OI0A 1GU3A 4EROA 2ZX2A 3OB8A 4AHXA 2PXFA 4Z82A 1D0GA 2QBXA 3B9CA 4YG0A 3WW4A 3H1WA 1F5FA 1MEC2 1BJQA 1CX1A 2VZ1A 1NXD1 5FZIA 1AUYA 1S0FA 4U36A 4AWDA 5DTRA 1OI6A 3OBRA 5LA9A 4BB3A 1OUXA 4P5YA 1PMIA 4ER3A 4HKOA 1DQ6A 1WLTA 2XJTA 3AZYA 3RGBA 3VKLA 4AYUA 4Z8BA 4GIQA 5JR7B 5B4NA 2Q4SA 5FYZA 2KEJA 5FYVA 2JG9B 1ENSA 3D82A 4Y1XA 3ZXLA 4AI3A 1XOYA 4AVTA 4LULA 3ZN4A 2HWE1 4QM8A 2AXVA 2G19A 4ET7A 4AL9A 4ATEA 2C4XA 4QGLA 2WA4A 4N8MA 5DZGA 1B0NA 2WYSA 4YM3A 4YYOA 4A3XA 2N7GA 1Q8QA 1ZBE3 1ALYA 4L97A 5TSWA 2FBEA 4LBQD 4DNYA 2W46A 5AVAA 5C3QA 2XJVA 1W0PA 2YBPA 2PUBA 4M3CF 4NMIA 3J8F3 3U1XA 4ISQA 4TLGA 5CADA 3SCFA 2AUYA 3FX3A 2ZGRA 1IHMA 2XJ3A 4CDXB 3WP3A 1FX5A 4RL7A 3ENRA 1SZBA 4R9CA 1EFAA 1BYHA 4Q5OA 4GA9A 3GZAA 3UV9A 2IXIA 1QQP1 2QE3A 3V64A 4DXRA 1ZS4A 1XNTA 5D2AA 3OMTA 2LYQA 1OC1A 1QGLA 1WCDJ 1O6UA 2XB6C 4D7YA 2GN7A 2GNMA 1RUNA 4RS5C 3SHRA 3MO4A 1SBEA 1KD7A 1WUVA 1C8NA 5FMOL 1V9U2 5SV8A 2G9FA 2Z69A 5D8AC 4S2FA 1POV3 1PO11 4DIQA 1QXRA 4XBNA 3CJIC 4Q29A 3N9OA 3GXUA 2V5YA 3R05A 4LPLA 5A7QA 4DY5A 3R09A 1TQ5A 1RTVA 2H6CA 4LBLA 2YC0A 4Y24A 5FZFA 3J7HA 3ZDSA 2I2SA 3EJKA 1DU3D 1OLMA 2OW4A 3VZNA 4XZUG 1YNAA 1GQHA 1Q43A 1V6NA 2ERFA 3DNVB 2XOMA 2ZZJA 3O0VA 4GB31 3WNMA 1U12A 2CNAA 2RMU2 2WWJA 3VL9A 1BDHA 2D40A 3WW1A 4CDQC 3BCWA 4R9DA 3U4SA 1OLRA 1V70A 4E8CA 3DPRC 3CQOA 1ZX5A 2UY9A 1LECA 2HEVF 2WT2A 1D2SA 5GLTA 5JOZA 5KR7A 1QDCA 1HRI1 3OGGA 2WAAA 1NQJA 4LLOA 3CZJA 1ND3B 3KCCA 5F7UA 3R4DB 5H9PA 2D3SA 5FLIA 1DLCA 4BQ1A 4UXAA 1ZBA2 2HLEA 2W1WA 4HVRA 1H2LA 1RGSA 4YM2A 3ZFFA 5A70A 4KL1A 3U07A 1UL9A 1RYYA 2RS53 3C7EA 3SXWA 4KI5M 5J48A 3N4MA 1GFF2 2W0XA 4EZ4A 3HQRA 5I0DA 4IWRA 4IETA 1MACA 2VR4A 3UKNA 2KR2A 4HK9A 3RG0A 1R69A 3HNBM 5I0SA 2L1PA 5DAQA 3NV2A 4DXZA 4ZZ8A 5BNNA 2EIEA 4Z59A 2VMCA 2XQXA 1ZZ6A 1W9TA 4AOCA 4MGZE 1Z7S1 2PHUA 1MEC3 5KBFA 4IQPA 4XAAA 3WNKA 1LENA 4CP1A 1MQTB 4PF1A 3PUQA 4WZFA 4Q1RA 1RB8G 4L9BA 1IKQA 3ACIA 3POWA 4HSJA 4MO3M 5EPAA 3BVCA 1REDA 3PLQA 5FXVA 3WD5A 2RG4A 3CDZB 1LESA 4I02A 1H8TA 2VUDA 4XYXA 4CUGA 4AGRA 4GH4B 1BQPA 1XBFA 2FDHA 3E6DA 2DV9A 3LD8A 3MPPG 2ADDA 2RJLA 3EYPA 4CDUB 3LOBA 3LPGA 5IJRA 5GZCA 2XMLA 3NRUA 4H7MA 2ZX4A 3ACHA 4LK6A 2AGSA 4LOTA 3SKJE 2BJSA 3ZKCA 1GWMA 2C5DA 5F37A 1NUKA 3PUIA 2IFWA 2YBKA 2IXCA 2QZ2A 1OF4A 1UKRA 3AZWA 1UMHA 4X4HA 1V6LA 2H8RA 1AZDA 3ALQA 4JZRA 4YG6A 5T50A 4DO0A 4ER6A 1IG0A 2JG8C 1W8TA 3F52A 3Q8BA 2W47A 1OF3A 2K0GA 2Y0IA 4OHWA 5I91A 3E6CC 2ZEXA 4A44A 3ES4A 2E7AA 4IV3C 1TVGA 5FYIA 4AI2A 1WCQA 4CUAA 1N3PA 2QDRA 2RS33 1V6JA 3LGRA 4IV1C 1ULCA 2H0VA 4BHPA 1K5MA 5FZ1A 1RUH3 2WUHA 4HETA 3TN93 1KDKA 2G4IA 2D43A 3I97A 1AYN1 2D5VA 2ZEYA 4MGIE 3ZYGA 5J09A 1Z7S3 5FYBA 3MUY1 1UY3A 4KBZA 4D7SA 1UD1A 1UTXA 1PNFA 2VCCA 1D4VB 4Z1VA 2VNOA 5FP4A 4A3ZA 5A33A 1QDOA 1AR91 3W21A 3FE5A 3NO8A 2Q8CA 4OI4A 4P9IA 4CCKA 2WO1A 3K4ZA 1VBA2 5JSRA 2VEOA 3HT2A 4MYEA 5IATA 5F2SA 3WW2A 5KC6A 1F35A 3ZX7A 4EK9A 1R1A2 2ZBJA 3GZEA 4F3JA 5LWBA 4LKSA 5G04L 1O8PA 2ZTNA 3LA3A 4BQ5A 2GP5A 2RR13 3PURA 2VQUA 2A70A 5I8SA 5IWFA 3VBRB 3OBZA 4FFIA 5JAXA 3M7AA 4I3PA 1UOBA 4QX3A 3C8XA 3R4UA 1G9BA 4QPGA 1ENRA 1F4AA 1XE0A 4CP2A 1GOFA 1HW5A 4MHRA 4OFGA 2FHRA 5LY1A 2R1BA 1S0CA 2DU1A 4QMAA 3BDNA 2FMDA 3NXHA 1RZSA 4K1ZA 2D5FA 5JCTA 3GGLA 5LRSA 1NG0A 3HBZA 4AVVA 3U3WA 3W9AA 1W3XA 5FXZA 3OBTA 1ZBA3 3BUCA 3MBWA 2O8QA 3AZVA 4XJUA 5GLWA 1ZYBA 2D93A 4H14A 1GSLA 3TELA 1LOCA 3LCPA 4JGYC 2VW0A 1CZVA 5DTMA 1R082 3ZYRA 1QXPA 3JD72 3OUHA 3OUIA 3ASIA 4E27A 3DPRB 2A6WA 4UW5A 4GWIA 5FJHA 2W91A 3KGZA 4HFSA 1DZTA 3RYPA 3WG3A 1LQCA 2G9GA 3VD9A 3IBMA 2KEKA 4QKDA 2G9ZA 1OFSA 1R092 1DF0A 5A6ZA 1BEV1 2GMMA 5F5CA 4YZ1A 2XJQA 1HXS2 2BV4A 3QYXA 4YW5A 1SLCA 3DV8A 3J9SA 1RUD2 5E6HA 4SLIA 1UYYA 1KQRA 2WC2A 1K42A 1RIRA 3MW3A 2RDSA 3I4IA 4Q4Y1 2P3YA 5LY2A 1CWPA 3FHAA 5BY5A 5DQ0A 4JDNA 1UZVA 3B7MA 5DT2A 1WD3A 3MIBA 1AXYA 2OPKA 3LEKA 4UFHA 5LATA 1OVSA 4FTEA 1FV2A 4Q0UA 3NV4A 1W3VA 4Y1ZA 5T5LA 5FO8B 4OUSA 3GZDA 2FJRA 2XPJA 2EF6A 2OZJA 4MH0E 3GDBA 1KEXA 1F31A 3TAYA 3ZKUA 5HCFA 3C7GA 3FFZA 5JUWA 4JTNA 3I59A 3AP4A 4X4IA 3ILFA 4KQ7A 4SBVA 3ZKYA 5C8CB 3AKQA 2ADEA 3CJIB 5JOWA 5KXBA 3O0XA 1RUF1 1MVEA 1CESA 3KVBA 4LKDA 1DZQA 3LPFA 1UNBA 3JZVA 3F95A 2IVIB 1OXCA 3J8F1 3S57A 2IUOA 1WA4A 4IV1A 1AR71 5LBFA 4AW7A 1UMIA 3ZFEC 4BOWA 1RUOA 4I3GA 2VMFA 1LOEA 3A9XA 1BBT1 2QCSB 4QPGB 3W59A 2HH9A 2QDNA 2D6NA 4FPKA 4HN1A 5FZ7A 1H4GA 1RUE2 4D0QA 1MZFA 4YGDA 1AHSA 4MVTA 2ZABA 2VBBA 1JZ6A 3TEPA 1QIQA 4V1PA 3NAPB 1YWKA 2O1QA 1XNDA 2XUEA 1H0BA 2ARAA 3EBRA 2LTNA 4GD4A 4PLOA 2B5HA 2TBVA 3ZSMA 2HWE3 2XBO2 4MHUA 4JKLA 4B8EA 1O3QA 3VHRA 1DGRN 3ETPA 1KDMA 1C4RA 1QQBA 3KGLA 2IVJA 1QKQA 1B35B 1VRH1 4Z5HA 2FZ2A 4XACA 4CYDA 2V73A 4LITA 2YC2A 3VHOA 5DAXA 4YVWB 3B69A 3KQ4B 4DUWA 1UU4A 5EYXA 1R1ZA 4K40A 3TRBA 5CKMA 1JWLA 3NW4A 4HPKA 2ZGPA 4COVA 3QWGA 4ONUA 5FYYA 1JFSA 2E31A 4EZHA 3GZDC 2VOVA 4IE5A 2R041 4NAOA 1SPPA 2Y38A 3AP6A 3IDAA 5I0RA 4PLMA 1JYVA 1FPN1 5IFTA 3DEMA 4QWNA 3RZLA 3HQXA 3KM5A 3USSA 5FR3A 4RN5A 2NLRA 2IXHA 3SMHA 5KHJA 4DMIA 1VAMA 1VMFA 4HOOA 3IPVB 5J7MA 3RZMA 2CTVA 1PVC3 4YW4A 2BERA 4AHZA 3V0AB 2WNVA 3KB5A 5JZGA 5FOBB 1H1MA 1YXWA 4CDWA 1HB2A 2P17A 2ZGNA 3INAA 3PVOA 2B45X 3T2TA 4BQXA 3J4UH 3KV9A 1F2NA 2BFUL 4IGQA 4AEDB 3JU9A 4OUEA 2PTMA 5ACA1 2WNEA 2NM1A 1Q8SA 3CNAA 3WXPA 5C9AA 4IEQA 2J7WA 3UK9A 4B7EA 4OLLA 1W90A 1CAVB 2RV9A 1PGL2 1F4HA 4PU4C 4GMP0 3ST7A 1R093 1VRBA 4BJ0A 5FUPA 3OD0A 5DXDA 3P3NA 3VBUA 5IK7A 2W68A 3AM2A 4AF9A 2MPFA 1PERL 1DGWA 1QMJA 2XQRA 3KSCA 3HNYM 3OEBA 4WVMB 1PNGA 5FO9B 3PIJA 4ITCA 2BFUS 4IV3B 4ISRA 4UW4A 1OBNA 3WF3A 1B09A 4PIXA 1J58A 4C0BA 4FOVA 3DM5A 3OY8A 3NDBB 2QQPA 1QOSA 2ZHMA 5HPOA 4OBMA 5FP7A 3IN9A 3AJYA 1C57A 2P3IA 4KMQA 4RS5A 3WW3A 3VBFC 5A7NA 1UYZA 1C1LA 2BNNA 3M70A 1CR7A 1J84A 1NA1C 5GZDA 3QCWA 5ABJA 2WR9A 2DVGA 1WW6A 5HCBA 3QACA 4RYDA 5DUWA 3THTA 4J1WA 2AYHA 5T5PA 4UI9L 4NDWA 4DE9A 1QZXA 1RUC2 3OQMA 2RS32 3POSA 1EAH1 3DGTA 5FYHA 2QUOA 2YGMA 2C6SA 5FUNA 4BU2A 5C3SA 2LUWA 2RJ2A 1RUH2 3WR0A 1LOAA 1BMV1 3ZFFC 3TEWA 4P9LA 3PVEA 4I01A 3PMSA 1QJU1 2X5IA 1OCTC 1A3KA 5ANNA 1X7NA 3H7YA 3VBOC 4LBMA 4MG2A 2IVBA 3H8UA 3MLFA 4FXKB 4M00A 2YDEA 4JV4A 4LQRA 5EHDA 1AYN3 1LEDA 5DAPA 5BNPB 1R1A1 1CAUA 1VB2A 2VTFA 1V0AA 2RR11 3N35A 1XE8A 1A8MA 1PM4A 4FBIA 3GM8A 4QPYA 2BBAA 2YHJA 1EPZA 1QP7A 1YCIA 2JE8A 1DQ4A 4HMZA 5KXEA 4NOTA 1IPJA 3IIIA 1MS5A 5FPBA 3CIHA 3ES1A 3WINE 1JN2P 2HWB1 2FDJA 4PU7A 1XNBA 1D0HA 2Q8EA 3USUB 3WDUA 2ODRD 3CECA 3KJXA 1PZ8A 1LU2A 2WS92 4XTMA 5A80A 3KD4A 3K77A 2GC2A 4UYBA 1VBC1 4C8DA 2RS11 2L9LA 1ULGA 3AJZA 2Q30A 3OGSA 4RQPA 3H1YA 2BGOA 1GQGA 4XABA 1ENQA 1JYCA 3QOXA 4YW1A 4Q4W2 1L7RA 5LRRA 1HJFA 3JBG3 1VLNA 4CA9A 2BOJA 4OVEA 1YJKA 2JDAA 3GF6A 1SCRA 1WH6A 2ILMA 2SBAA 3WVJA 4DFSA 4Q4W1 4ZS2A 1R64A 1COV2 1VBE1 4WVMA 1ND2C 1UXCA 4I8TA 4IEZA 1WIZA 3DN7A 4LOSA 5LK7B 3DXUA 4B7KA 1K12A 5JXIA 3ZXGA 1RXFA 4Y4YA 4OYUA 3RQ0A 2D5HA 3H3LA 1R083 1I5PA 2E6VA 3G6JB 4IW3A 3THCA 3TNPB 4BZ4A 1LGNA 2Q1MA 2EIDA 3JB8A 5L9VA 1SHWB 2QVSB 4COYA 2PHWA 1CZTA 4E2QA 1SLAA 1H9WA 4Z07A 2W52A 2R6QA 3MLJA 3NQHA 4BH9A 3ELNA 4H3WA 3MLLA 2KEIA 1H1AA 3WP4A 3VDBA 3ORJA 3TYJA 3MI8A 1QWRA 2QQKA 2ZGMA 3N7KA 2EAKA 3TN92 5ABJB 3B02A 1QJY3 1UN1A 5BPXA 2JDNA 1NCRB 3IDBB 1YSEA 4KH9A 3LF7A 4N90A 4NRQA 3WZ1A 2RS51 1CONA 2B39A 2HWF1 1Z7S2 1BK1A 3HZIB 1BEV3 1KFXL 2FDKA 2MHFA 4K8FA 1ODNA 4AVAA 1Y7BA 2P6CA 3F51A 1GNZA 3H8XA 5IFPA 3A9ZA 1X33A 1BMV2 2YMZA 3MPBA 4XUTA 4EN7B 3GBWA 4KWJA 4F83A 1EAH2 3PUAA 5K0UB 4XIOA 1V6KA 1CQ9A 4JQTA 4Y26A 1ULFA 3GBGA 3I2FA 3FZ3A 4OZOA 4XUQA 3UFDA 4XFIA 2XWJB 4IDZA 2XSDC 5L9RA 2JDZA 3VUOA 1GZWA 4NIDA 3NAPC 2PHXA 4IERA 2CWSA 3OG2A 5EYYA 1YFYA 1RVF2 3BTAA 2BWAA 1OFNA 1X36A 4J6GA 1GT0C 1RUC3 2R071 2YFZA 5EIYB 4BMBA 1NLRA 3NJZA 4QX8A 1K5MB 4CCJA 1W6MB 4I6TA 1E5IA 1EY2A 2ZGSA 3WNNA 3KWVA 1YIFA 3O0WA 4BLIA 2VUAA 1A34A 2WS91 2FDFA 4YVWC 3K4AA 5FJKA 3N7MA 2YC4A 1EUUA 5F3IA 2HWF3 2VH9A 5A6XA 5C3RA 1IC8A 3O1UA 5FZ8A 1SACA 3UKTA 4KG8A 3JD73 2XBO3 3OEAA 1JUHA 4YARA 2BVBA 3HD8B 5LEKA 1VAKA 1H2KA 5C8CA 1PGL1 2Y8KA 4JTOA 3M8LA 1IKPA 1MS3A 3T2QA 2W9XA 2HWD2 1DZRA 3AMHA 4BQ4A 3PUSA 4XC9A 3S30A 3IVPA 1PO13 1DCSA 2PXJA 3N36A 3LFPA 3AFGA 4FFGA 5G05L 3EMRA 3S6PA 2C26A 4JX0A 2TUNA 1UF2C 2C0ZA 1JYWA 4YWAA 4N43B 2YYOA 4AAXA 2A5ZA 5HV0A 1RC6A 3ZYBA 1F8VA 2RS31 1TE1B 1HF0A 1Y7YA 2QQWA 3SEEA 2D7FA 4LUKA 1WKYA 4HXCA 5A7LA 5F3EA 2WYFA 1HV0A 4IEPA 4NO4A 5FPUA 5LA2A 5L7OC 3C3VA 3WUCA 2VOWA 2R042 4RR3B 1K45A 5FIXA 1PVC2 2P4EA 2V5DA 5E8AA 1EV11 1ND2A 2IXKA 3E5UA 1SLTA 5FO7B 4IUGA 3OJBA 3P5BA 2K2SA 1S0DA 4L2NA 3UNPA 4QHZA 3RZHA 2J7MA 3AMQA 5F5QA 1DP0A 5BNNB 4Y4RA 2R061 4KG0A 1FNYA 4C1WA 2XVKA 2XH6A 2XCJA 4O8BA 2FFHA 2Y26A 3AKRA 2CSFA 2XXPA 3FYAA 3VZMA 4YFZA 1ONAA 4HG6B 3WNXA 2XR4A 3GN5A 2VZRA 1JZ2A 3ZHIA 4AI1A 3AYDA 5FFOC 4QAWA 2YGLA 3T2PA 1VP6A 4HL0A 3X29B 4BQ2A 2JDHA 4CEYA 2CU5A 2KA3A 1C1FA 3ATGA 1MEC1 1RUE3 2PELA 4XF9A 4AK3A 3LOIA 1KJLA 2ZCWA 4NHMA 1LRHA 2JG9C 1QJU3 4YW6A 2JXAA 4C91A 4BXFA 4Y1YA 1LLIA 1I5ZA 3OPZA 3VBSB 2OS2A 5FP9A 2Z79A 5FYUA 1YC61 4IEWA 4RGKA 4QXCA 4AEMA 1KRIA 3CHXA 2J1VA 2ZKLA 2XLAA 2OX0A 4PJYA 3N7JA 5F32A 4B4PA 3M3QA 3VDDC 1DIWA 3ZVXA 5IT6A 3EXUA 2WABA 2OIIA 5J37A 4KGQA 4RQPC 4XHBA 3O9XA 1ACCA 2DWRA 2BGCA 1BDIA 5C3OA 2PHRA 3C7HA 4JRAA 5FBZA 4URTA 2Q8OA 4GHJA 3OGRA 1PM7A 4CCMA 1MS0A 1QNYA 2YU2A 5AC92 3MDPA 2J1RA 3RWKX 4BXSV 4EWDA 2XJUA 3OGJA 5FMBA 1EPWA 1FXZA 1O7FA 3FFQA 3DCQA 2K9ZA 2RM21 4XJZA 4I2OA 4NR1A 4AQTA 1DBNA 1RHI2 1OQEA 5EXOA 1XYOA 5FPVA 5HCAA 1EP0A 4YGCA 3UESA 3OQOA 4FFFA 1HN0A 1G9CA 1PRUA 1UPSA 4R4ZA 4RS5B 2W95A 2D6MA 3UYJA 1DQ1A 1IPKA 3RI9A 1DQ2A 1OLQA 3FBYA 1TNFA 5K98B 2VPVA 5GAHi 1RL3A 4MGQA 2XXZA 5D8AB 3K46A 1WW7A 3BPZA 2BNOA 4MOAA 4YVSA 3ZXDA 2PXEA 5DRTA 2Y0OA 4HSLA 4PBOA 3SKVA 3MW4A 1FV3A 4YZ5A 1R091 5T5OA 4HZFA 2R063 2CROA 3DUIA 1LEMA 3FUQA 4RFRB 1PGW1 2VVDA 1POQA 2AXZA 1ND3A 1HQ1A 2VXJA 1PRAA 1O5LA 5IUQA 3VHNA 1W9WA 2D6PA 4N53B 4I6UA 4FPOB 5CKQA 4AI0A 2FDGA 3WV6A 2EF8A 4I0AA 2WKKA 4Q27A 2ET7A 4HK8A 4HPKB 4AXOA 2H6BA 2UYBA 5I0UA 3WUDA 4BQYA 4D7TA 3M4FA 4NIIA 4R8HA 1GYKA 1HLCA 1MR5A 1JHJA 1WCUA 4Q4W3 1D4M1 1YIPA 2Y60A 4Q4X3 1W2OA 4CXYA 1FAYA 2J42A 4OHVA 1OA2A 4P02B 4QDRA 1RUI1 4XHXA 1VALA 4W65A 3KT7A 4L0PA 2JIJA 4QKNA 1AL21 3VBHB 3KV4A 4W6XA 2XGXA 4Y1UA 1UY4A 2XXQA 1PVXA 1OA3A 2M4HA 4OUMA 2B5AA 3V0BB 1IGOA 5FXWA 3MIFA 2ZGUA 1S0EA 4CCLA 1UX7A 2NQYA 1OKQA 2P37A 4N43C 4DRVA 4B1MA 2PAKA 2HWD1 1AR62 1DHKB 1W6PB 3S0MA 1G9DA 5DTQA 4MCXA 3CL1A 1OPMA 4RD7A 3VLBB 1XNKA 3LB9A 3P3PA 4JGZB 5C5UA 3KXAA 1I6XA 2LNMA 1AR92 3H5TA 2E32A 1UZYA 5L7OB 3ZM8A 4BQ3A 4EWEA 4GALA 1RJ7A 1MQTC 4QDSA 2FDIA 1HXS1 1Q3EA 1SLLA 2GP3A 4NAMA 2D44A 3S7EA 1N3QA 3TNQA 1BEV2 2ICTA 2VNRA 2JDYA 3AVSA 4CUCA 2WWSA 2EXKA 1BBT3 2PHLA 3OTFA 4N7UA 2R073 1UOFA 4XF3A 5L19A 4Y42A 2GNBA 3M3IA 2I45A 2JENA 4YGBA 1JTZX 3KQRA 4PF5A 3GZTB 4X4FA 5JZGB 1U2ZA 1AX2A 2QQJA 5C9AC 1YEWA 2W94A 1EAH3 1NCQC 4XDOA 3WF0A 5CNAA 4IE0A 3BOWA 3VDCA 2JKBA 2Q0AA 2WQ4A 3J7NA 2PLV3 2FCTA 3M3OA 3USUA 5IAVA 4YVSB 1HN1A 3RMYA 1UO9A 4AR2A 1H6XA 1QJX3 2ETEA 3H7JA 3LZZA 4NHXA 2WS93 1FT9A 1WCSA 3WDVA 4P9GA 4RGGA 4UFKA 2V4AA 4XFFA 5DZFA 1UXZA 2WT1A 2KZ8A 3WHUA 4FP2A 4YZ4A 2MEZA 3PE5A 3H0OA 4IV1B 2PUCA 3VBSC 1TME1 3I59B 2GNDA 4XFHA 1UY2A 1QB2A 1S7EA 2WZR3 2Y6FA 3JBG2 4XMIA 4Y22A 5FZOA 2IVGA 4FTBA 4XUNA 2HBUA 2Y6GA 1RHI3 3U37A 1COV3 2PXBA 4Y20A 5IK5A 3VZKA 4XAEA 4EKGA 1Q8PA 2HWF2 1UOGA 1M4WA 3I2JA 4IL7A 3H9AA 5BYNA 1T2XA 2RS52 2WSVA 4FPYA 4YW3A 2DCZA 3KT1A 2VW2A 3NNMA 4IE4A 4TXWA 3SISA 1PK6A 4OMCA 3ZFGA 2O49A 1DFQA 4GMP1 3KL4A 4YPJA 3N7LA 1UYXA 4M3CE 5F2WA 3ROUA 5JWPA 4DRRA 3ILRA 4K6BA 3EQEA 3P6BA 1LAJA 3QF3A 3HVDA 2AR6A 3B93A 3PU3A 1QU0A 1IS6A 3HOBA 1GWLA 4FVVA 4WBBA 1J59A 4FPGA 2YXSA 1AR81 2EXIA 2QQUA 5LZ6A 2AEYA 4NPLA 4PLNA 4YG7B 4OZXA 1S0BA 3ECQA 4EQZA 3LAGA 4NRMA 1O8SA 1NQDA 5FCCA 4DY3A 5GAGi 1YRZA 4HT1T 1PX4A 1W6PA 3W5NA 3LWCA 4YVWA 5BNNC 3VZLA 4CU8A 3DYPA 3JBG1 5A7WA 3SC7X 5A1LA 4DE8A 2ZX1A 3Q8CA 2XHNA 5C71A 2OYZA 1KFUL 1SPPB 5A1FA 3ZN6A 2R49A 2A71A 1CPMA 2V09A 1J1TA 2R043 2W1QA 3RJ2X 4PI0A 4E4ZA 5DRYA 4Y33A 4MGSA 2WFF3 4YW7A 2FCUA 4XCAA 4ZU7A 1US2A 5GZGA 4JGYA 1MZ5A 4JDMA 4LLFA 5IVBA 4TZDA 4GH4A 3JB4C 3O1VA 2EVXA 1G8WA 4DQAA 3FWEA 2YZ4A 4QU1A 4ATFA 1AR63 5HXVA 2J22A 4UFJA 4A45A 3E97A 3L9JT 3VDDB 4AGGA 3FLRA 2WLQA 2JG8A 3NKGA 2V3CC 1XRUA 3POIA 1NKGA 4RQPB 3BIWE 4LO7A 1F9KA 4BIOA 4QHBA 2QKDA 3I2HA 2VOKA 3AFKA 1QEXA 3NV3A 2YG0A 1VB4A 1YLLA 2JICA 4RR3A 1MS4A 2GDFA 3WNPA 1NY71 2PFWA 1WMXA 3AYAA 4QQ2A 4DOUA 5B2GB 5FLJA 4AFCA 3IKWA 1QJU2 4Y22B 5FZOB 1HV1A 3NVCA 4INDA 4BK5A 3HNMA 1LODA 1AR61 4WZCA 3I2OA 4MGKE 2CSGA 2EALA 4X4GA 2ZMKA 1RUH1 2GSYA 3GZCA 4WVLA 1VBA3 4IEXA 4QT6A 3RYKA 3SH3A 3WG2A 3AZXA 1BXHA 5JVVA 2HWD3 4E4SA 1NCRA 1US3A 3AP5A 1LU1A 1OVPA 4M01A 4NE9A 1W6QA 3AP7A 3A0NA 5K8SA 4XETA 2CGPA 2WO2A 2ZEWA 1E5RA 1S2EA 3N9PA 4FPFA 1XC6A 4I0WB 4S2GA 5F6KA 1VPWA 3LIHA 3ZSEA 1E3OC 4E2SA 1ZRFA 3O1TA 4N9IA 4ASMB 4E4HA 3LEMA 2VG9A 4LMFA 2NMNA 4NJ4A 4Q2JA 4J25A 2EXHA 3NMBA 3D4KA 5JZGC 4AI8A 1APNA 1NX9A 1UY0A 2JDPA 5K0UA 1JZ4A 4XILA 5DMYA 1JHNA 4X4CA 4FBFA 3SNMA 2ZGOA 5IK8A 1NERA 4E2GA 1NW3A 1QOTA 2JECA 3AMMA 1W8UA 4KGGA 4LIVA 4XJ9A 3PDQA 2X05A 4BISA 1PGSA 1W6NB 4LBJA 4UWDA 3NROA 4JCXA 3LSDA 4WM8B 1KGYA 4AEJA 3OUJA 4LORA 2VVFA 1PGW2 1KS4A 2ARCA 2VBDA 3IPVA 4GJYA 1OH4A 1OURA 1PK6C 4CEWB 3O1SA 1C5IA 1UX6A 2RM23 2CDPA 4J1XA 2GC0A 4WM7C 4GMP3 1GQPA 1SFNA 4XF4A 1V9U1 3K48A 1UCXA 4X4EA 1B35C 3PJYA 4CEYB 3WG4A 1RINA 1VR3A 5JPNB 5FK8A 4QD2A 5JOXA 4HLTA 2CL2A 1PZ9A 3HMYA 2BRTA 1OD3A 1UYPA 2WNVB 3AB0A 4Y5TA 1G9AA 3T0DA 4O9GA 1RHI1 3VBOA 2MXDA 1AX0A 1ULDA 1ZA7A 1G7YA 4H7LA 2B46X 2WZR1 3VBUB 4EJRA 3BI3A 1WWYA 4W8JA 3CROL 5IVVA 1GWKA 5FKCA 3WNLA 4AHYA 1UZZA 4P5HA 4XCBA 3SCHA 4JHZA 2ICPA 2IUWA 1FATA 3L2HA 2WL1A 4QKBA 1JUIA 2ZZQA 2VTXA 3LIGA 3BPSA 4FI9A 2VOXA 1ADRA 3VK0A 1J1LA 5FPZA 4A6OA 2MNGA 1IQAA 2O0OA 4Q0PA 1GOHA 1CQTA 1L3JA 1WBLA 2ET1A 2QNKA 3OD4A 1WW4A 4FFHA 3SH5A 4BCUA 1DYOA 3T4VA 5FWJA 1JZ3A 5GLUA 2Y64A 2PLV1 3C7OA 3OSDA 4LEJA 4AQ2A 1JMUB 4META 5DPNA 3WDXA 4AEDC 4URAA 1CGPA 4EWAA 4Y5SA 2XLFA 4LO5B 2PXPA 5AC93 2BQPA 1UOJA 5M0TA 1NEQA 2HEWF 1WA6X 1G9FA 3GUUA 4ER5A 3T3YA 3MW2A 2EA7A 2X53S 3D1NI 4JQDA 1S0JA 3O5SA 4RGAA 1ULOA 4ZXEA 5T5JA 4AHWA 5IHRA 2WWUA 1HB1A 4LE4A 2QZ3A 1PO22 5GLZA 3PVBB 3JXCL 1Q56A 1H30A 4NIHA 2QJVA 3FJSA 1QH7A 5DG2A 5C7GA 1G6NA 3DKQA 3UWPA 4LA2A 2UU8A 3UT0A 2CAUA 2DCTA 1WW5A 1HRV3 2VM9A 5FKBA 1D2QA 3WG1A 1BBT2 2PUDA 1HB4A 1JXNA 1OLME 4FPHA 1SDDB 1HB3A 3JXBC 1TZOA 1UZWA 4AGVA 2ARBA 2R062 5JDBA 2DCJA 4TTGA 1ZVVA 3APBA 3WX5A 3VD4A 1RUF2 3S5QA 5DN2A 1IG3A 4MXVA 5HBAA 2PLV2 4AAPA 4MV2A 2PN5A 2ZACA 2NP0A 3SH4A 2XI8A 1NA1B 2PUAA 1A78A 5JUVA 5C5TA 1BVVA 1W8FA 2DCKA 3VD3A 4ZONA 1A8DA 5HCHA 1JFTA 1W2UA 1DG6A 3E5XA 3NJYA 4AQSA 1HDKA 2R30A 2MEV3 2BDRA 4PHZA 2Y6LA 2VQ0A 2OT7A 2PA7A 2WZR2 3CEWA 4OMDA 4DXSA 1H8TB 4FPJA 4XFGA 1GMMA 5A3PA 1X50A 5IK4A 3U10A 5EV7A 3QFIA 3TBDA 2UWCA 3WDWA 2PXDA 2Y6KA 3DPRA 3VBOB 4YZ2A 1NY72 1HRV1 2LLWA 3FYMA 4I6RA 2AACA 5FY7A 4CVUA 1NT0A 4GWJA 1MPXA 1GICA 2C9KA 2R0HA 2XG3A 4NN0A 1AVBA 4FAGA 1X8MA 4B4QA 5EJZB 1W05A 2XKPA 3OYWA 4ZXKA 2KM2A 4IV3A 5DAVA 5CFDC 3THPA 2YBSA 5L7OA 5FLHA 2C9AA 3SEPA 1JYXA 3PVNA 3MEJA 1E5SA 1HQWA 4QB2A 2VUJA 3ZPYA 1ZRCA 3JD71 3ZLIA 1S1AA 2PMWB 4DEQA 2LYKA 4EN0A 2VCMA 1IOAA 4BK4A 1W8OA 3RZJA 2ZEZA 3ZSLA 2WO7A 3H8OA 2A6ZA 2HKXA 1W2AX 4DB5A 5AFEA 1UKGA 4DPNA 2OFYA 3I2IA 5DUVA 2FD8A 3MIHA 2LALA 2R072 1CAVA 1PK6B 2ZMNA 3AC0A 4LBNA 4HVQA 2W87A 5FBJA 2LYLA 2ENRA 2YROA 4UAPA 1O3SA 5GZEA 1ND2B 1P8JA 1Q8VA 1RUJ2 4AE2A 4CEYC 1RUG2 3MFAA 3CBNA 4PQ9A 4D6RA 1FYUA 1XJAA 2GH2A 1H9PA 2WFF2 3N9LA 4K3UA 3MF9A 4XFAA 4LHLA 1SEFA 4NIGA 2ORXA 1HQLA 3KF5A 4A42A 2VY0A 1QJX2 2D3PA 4K21A 3M3EA 3S8QA 3UKVA 2DUOA 2UY8A 3Q8AA 2AW6A 2F6BA 3MEPA 1AR82 4Q0QA 3OF1A 1XQNA 2VZTA 1RPEL 2A1XA 1I9RA 1WLCA 2IXLA 4E8DA 2OPWA 5L73A 3IM0A 2Z4FA 4IEOA 1GZWB 1DW9A 2WJSA 3HPNA 4JGZA 5IW0A 4JCKA 5JI7A 4D6SA 1ULEA 1ULPA 2DURA 2TNFA 1NCRC 2OZ6A 2VOTA 2XKOA 4UT5A 2AENA 2BU9A 1CPNA 1PO23 3MIGA 4GKXA 4AFDA 4XFBA 4DXTA 2DVAA 5C3PA 3I3EA 1S0IA 5A3LA 2E63A 4TYSA 2A6CA 3IAPA 4ORFA 1PMHX 5FY9A 1GP5A 3TN91 2DTYA 5F5AA 4CXWA 2WQ8A 4LUMA 1AYN2 1BLZA 1HQNA 2EWTA 1TNRA 2QTWB 3I7DA 2DCYA 1GNYA 2WNUA 5GLVA 3W5MA 4YG4A 1QJY1 5A3NA 2DBNA 2EIGA 2ZMLA 4GH4C 4CCNA 1XSRA 4Q2FA 3OKZA 1GZ9A 4ER0A 1XNAA 2X09A 3HN3A 4CDQA 5C4WA 1W39A 2WA3A 4YG3A 1URXA 2MEV1 2RHPA 3RDIA 3J26N 3BYWA 1E5HA 4Z5CA 1N1VA 5IVYA 1SLBA 2F4PA 3VB9A 1QHDA 1W2NA 2DUPA 2HJIA 1QQAA 5IVJA 2JG8B 2XLGA 1Y9QA 1QP0A 2P5BA 4UFMA 4XBLA 2O8OA 2X10A 2Y33A 3TRSB 1TMF2 5JOYA 3V0BA 1JYTA 3D3AA 4UF0B 1DQ0A 3PIGA 5FZ4A 3ZO0B 4A7ZA 2MEV2 4CEWC 2PXLA 5FYCA 1W6MA 2JE7A 1VBC2 1O59A 4JKMA 4PDWC 2AEZA 2ID4A 5H9RA 4W6WA 4N43A 1VIWB 3UETA 1ZUGA 2JD9A 4XQDA 1L1MA 1LOBA 1NOVA 2D6OX 3H50A 4N7IA 2DDUA 1IS3A 3LDRA 4K20A 3B00A 5DABA 5C4WC 1XXNA 4X6QB 4OHXA 2Z42A 5DSXA 1W6OB 2RE9A 3POJA 1OD5A 1DGLA 5FAXA 3TEXA 1H8VA 1WLDA 2VVEA 3KV5A 3ILNA 3WOGA 5D8AA 4LBOA 1S2BA 5FZ6A 3FL7A 3BU0A 3UGGA 3AVRA 2YFUA 1C8M3 2ZGTA 3CKHA 4HONA 1LULA 1VE0A 3OPWA 3A9YA 2PAEA 4Q4V3 2CWMA 1Y3TA 2W39A 5FYTA 5FXXA 1UPIA 2NN8A 3ACGA 3D0JA 1J3RA 2R16A 4XTPA 3LFIA 2D97A 4QGMA 2JEMA 2J1SA 3IAQA 2A6XA 2VW1A 4I0BA 2L8NA 3ZDVA 2ATFA 2HWC3 1ZA4A 1JS9A 3JUUA 4PQQA 2ZPXA 2WFF1 4NIAA 3PTRB 1BVP1 1R63A 5F8PA 1HRI3 1AL22 1LHOA 1RUG1 2PXTA 1RUJ1 5CA6A 1L7QA 1H4HA 1VBD3 5FMCA 4XVHA 4WM8A 3NAPA 1Q5OA 4Y1VA 5CYYA 1JZ8A 4HN0A 4XURA 1D4M2 1LHUA 2PE5A 1XU1A 3WQ0A 5I8TA 5I8YA 5IVCA 5GALA 3F6WA 3NJXA 1MZEA 2A6VA 5DDJ2 1CJGA 1W99A 1KJRA 2E33A 2VC9A 1FMD1 2XJPA 4HKLA 4P9JA 4YZ3A 1UY1A 2ZGQA 4JGYB 1GKBA 2B7YA 1GP6A 2HFZA 1CIYA 4B4RA 3WF4A 1FOD1 1OOPA 2RDNA 2W1SA 4GB32 4KU7A 4XJWA 2HINA 2C1FA 1O4XA 1X57A 3MFCA 5A7WB 1DQ5A 3OQNA 2WNOA 1I3HA 3GHNA 1N1TA 1RVF3 3POGA 4FOQA 4GZ9A 5FRAA 5FREA 3VD7A 1POV1 4YSFA 5JXGA 3LISA 4ARXA 3WF2A 3GN5B 1W9FA 3A7QA 4WVZA 4QPIB 3GBFA 2WLPA 2ZHNA 3UL2A 5IAXA 2KPJA 1CAXB 1QOOA 1QQP3 5A3MA 2JJ6A 5J36A 1W04A 1KITA 4FXGB 2P3KA 2UURA 1HRV2 1ZZCA 1LCDA 1ENXA 1O91A 1UU6A 3IT8A 4CP0A 2HCNA 1O4ZA 2IXJA 3M9LA 4WM7A 5FYMA 1WLWA 2OUJA 3N3HA 4HANA 4NPMA 5FWEA 5A7SA 5I0TA 1LB2A 5ACA2 4BPZA 1AJOA 2A75A 5EFUA 2J1UA 2Z2SB 5C8WA 3K2OA 1NXMA 2WRAA 5LA1A 1IS5A 5FZAA 5FY5A 3E1F1 4M3CA 3SQOA 1Z78A 2W2IA 1N3OA 1ASJ1 5F39A 5CG8A 1W6OA 2BOIA 1YQ8A 3RZZA 2VU9A 1IS4A 4OQ9A 4BM8A 1X9TA 2LM3A 1SBDA 1YHFA 3WHTA 2WDBA 5A3WA 3ZYJB 1SG3A 5C8CC 4KBBA 3C2UA 4QQOA 3CJXA 2BBVA 3HBKA 3CO2A 4QX2A 5CFDB 4YRDA 1CX4A 2GNTA 4DINB 2LW8A 2ZA9A 4AVSA 3I3BA 1W06A 2IZWA 3NKTA 3O1PA 1W8NA 3AXDA 2WAOA 2AUWA 1VBC3 5LBEA 2F17A 4GWMA 1BKZA 1N1SA 1VBB1 2O38A 2W3JA 3AK0A 4A7YA 3ZFEB 3AKSA 1JU4A 3I3DA 1POV0 3WQ1A 2CV6A 2VNGA 2VZOA 1JODA 1TG7A 1W6NA 2JX9A 2O14A 3RSJA 3VKFC 5LEJA 2WN2A 5JI9A 1YYNA 2H0BA 3ZXFA 1AR73 4Q1PA 3VBHA 4QB6A 2LLVA 3D5OA 2R63A 3LSEA 3RS6A 3HEIA 3HR9A 5ERLA 5A32B 1LNSA 3WT3A 2EICA 3KMHA 4XJ8A 4Q8LA 3O1MA 2B9VA 3IMNA 4UOJA 1OPOA 4O61A 1JYNA 3A23A 4DUVA 4QHOA 5LCWL 4RHV3 2AXUA 1O4YA 4N53A 5FYSA 5BNOB 1OUSA 4Z58A 4XUPA 1CJDA 1RXGA 1UZ0A 1ZBE2 4GWNA 4XF0A 2R0FA 3H3UA 5FK7A 2HYXA 3T1LA 4BA6A 1O3TA 1SFPA 3VD5A 5C4WB 1EV12 1GZTA 4D6QA 1F5JA 3MZHA 5CAZA 3J8F2 2OQ6A 5CVRA 1AL23 4R9BA 2DBIA 3P1IA 3BN6A 3H42B 4LBQA 4QPIA 1NLQA 5JR2A 4EZIA 3MYXA 3OPTA 3UGFA 4IEUA 5A1AA 1CAUB 3FLPA 3KZ4C 5AC91 3ABZA 3LQXA 4PIZA 1NA1A 1JZ7A 1D4M3 1LHWA 5CFCB 3VBHC 1RUF3 4COUA 2D6KA 2VMIA 5FZ3A 4M0HA 1QJFA 3HIFA 3Q8FA 2BW8A 3EHKA 3LFMA 1W9YA 3K3OA 3A21A 4XJAA 1XNCA 5FTTC 2ZXQA 2ZS6B 5T55A 4CTEA 2AWIA 3PHMA 2WNUC 2GC1A 1AU7A 3U0ZA 5ISLA 2QFEA 1PRVA 1OKOA 4U2AA 2JCGA 3M3CA 3AKTA 3JXSA 2HYKA 2EAAA 2JWPA 4QQLA 4JGZC 1JH9A 4OI1A 2RVAA 2PXVA 3VWSA 3N9QA 3L2YA 2DUQA 4CSWA 3NNFA 3IIAA 4NUBA 5T54A 4XDPA 3IDCB 1WBFA 5DZEA 5B4XA 1JBCA 3NZLA 2GMEA 2SLIA 1QJEA 1WMDA 1HJGA 1K3IA 4YBAA 3B01A 4UFLA 4XUOA 1GV9A 4I09A 2E53A 2J1TA 5FZHA 1AF9A 4WV8A 5IVFA 2WFPA 1SBFA 4BLJA 3OYWB 2XIUA 4CU6A 2PXUA 4D69A 1OSLA 1OSGA 2JG9A 3AMPA 4IE6A 4DZGA 4ZKTB 2VZVA 1IZ3A 5FZCA 3SX0A 3WP6A 2KD7A 2BGPA 3J7MA 3ZFEA 4Q26A 1NCQB 2IFRA 4KWKA 3WQBA 2GMPA 1AX1A 1R081 2A73B 4PDWB 2GAUA 1FOD2 4OCTA 4CCOA 5KXDA 2NYYA 3T09A 4JRLA 4QPIC 4TSVA 1IPSA 2V72A 2XWBB 1RVF1 4M0NA 1RMU1 3VBFB 5KHHA 2WIIB 2R7EB 3U78A 1RJ8A 4BWOA 5CU1A 3WEZA 3V65A 1MQTA 3MUZ1 4YFWA 3W20A 4LT5A 1BCXA 2Y34A 3I2KA 3ITQA 1LCLA 1UXDA 5J98B 5AFBA 3WQ7A 1C8M1 2XL9A 4Q0SA 1B35A 1ZAYA 3RWNA 4QQPA 5JSOA 4MSVA 2ZJCA 4Q4X2 1QY4A 2ZX0A 2WUSR 4V2VA 5JXHA 2E7TA 4LE3A 3ZFFB 2VXRA 3LEGA 5BV6A 4FO9A 1RUJ3 4K9SA 1HKDA 3WY6A 3K3NA 2PPXA 1RUG3 4QB1A 2ZHLA 2PXKA 4UBGA 3ZN5A 2WSUA 5CKNA 1JZ5A 4MGTA 4YG1A 3V56A 3NL1A 2PQSA 1C5HA 2YPJA 2ZX3A 5F3GA 2CYFA 3G5GA 1ZNPA 4LXLA 3NV1A 4E4DX 1ODMA 2LYJA 4PCRA 4P00B 1F15A 2HCSA 2VGDA 5CFCA 5FP3A 3POBA 4V2WA 3ZPOA 2TEPA 2YB7A 3A0KA 1UIJA 4Q4V2 1Y43B 3ZN6B 3PJQA 1LOFA 1UW8A 3URFA 3JQWA 5T52A 3T0BA 4MCTA 3A4UA 1WZXA 3BB6A 1AR93 1SFYA 3AP9A 4RHV2 3BTXA 1VPHA 2P1BA 2XONA 3FBMA 4NVPA 3T08A 3RI8A 4I30A 4AEDA 2WIUB 2HWC2 3KLSA 4KWLA 4M4PA 3D8CA 1EV13 5APAA 1YUDA 2X5IC 3QOPA 4CDQB 1GUIA 3ZR6A 4GJZA 2YU1A 3DF0A 1VBD2 3HQUA 3OGVA 4BMEA 1W8HA 5A33B 4X4BA 4TLFA 5CG9A 3OOXA 1W03A 2IU7A 5LK5A 1AYM1 3BIEA 4JKKA 3H8RA 4AEKA 4XQ4A 1OA4A 2EIBA 4XE9A 3IZOA 1X82A 4MX3A 3NNLA 1UXXX 2WQZC 1RMU3 2GH8A 1STMA 4HKWA 4D3WA 1VJ2A 4XXAA 4FSJA 1CIWA 3RMXA 4YM0A 3OY8B 2B42B 4NWVA 1OT5A 1IQDC 3KCYA 2VZPA 4HBNA 4P9XA 4BYYA 2PHFA 1EYBA 2B9UA 4Q4Y3 3ZFGC 2VZSA 2WT0A 3D6EA 4NHYA 2KXLA 3CLPA 5FMOS 3GCWA 4CP9B 4ES9A 3KV6A 1QXJA 3HN1A 4F8AA 3BTZA 2RR12 4QXBA 4UBHA 2CGNA 1UMZA 3LKJA 4Q8KA 3NWKA 1HX6A 5JIUA 2QQIA 3J7LA 2JE9A 5FZ0A 2VECA 4TN7A 4DS0A 2ZHKA 2BJCA 4QXKA 4XQWA 5BNPA 2VAUA 3VZOA 5IVEA 4O65A 2WNUB 2FQPA 5ACA3 1XYNA 2ZAAA 3CMGA 2F4LA 3I2DA 3ZXKA 4C1XA 2JKXA 5F9TA 3BTYA 3RRDA 5K0UC 5FZDA 5BNQA 4P08A 3ZIWA 4CDUC 1FOD3 3MV01 3OCPA 1RITA 1RUC1 2PHDA 1REEA 1XSQA 4RA0A 3POEA 4JAAA 4XZPA 3RPQA 1W0NA 5FZMA 1FMD3 3ZMNA 1LJ7A 4CPBD 1PMJX 5FY4A 1ZBA1 3LDKA 3KHCA 3UJOA 4EV0A 1OH3A 3AL5A 4LNVA 1YQCA 1VBE2 2Y6JA 5FPAA 1WETA 1AYM2 1H2NA 2VD7A 2VZQA 4AQ6A 4COZA 2GRMA 2BPA2 3AZZA 3WCSA 1PX3A 2NMOA 1ZZ9A 1DGWX 1SMVA 1PIV3 4BE3A 5C6CA 3OBAA 1QJZA 3BALA 2OUHA 3GHMA 2XL7A 3MIEA 5EQUA 5DAWA 3E5QA 4ASKA 1ZZBA 4LHNA 1K5MC 4Z2WA 4ASLA 3JQXA 2RMU1 3ZXEA 1HXS3 2VUCA 5D21A 5FOJB 1TEIA 2VQTA 2D6LX 4QX0A 3PNAA 2A7AA 5FMDA 1S2KA 2DVBA 5DDJ3 1VRH3 1RUD3 4CDUA 4CCCA 3R6SA 4MXWB 1YO8A 1J83A 1O4TA 2WINB 1DYPA 2DFCA 4WM8C 4JDOA 1NYWA 4FP3A 2YV8A 3ZIXA 4EE2A 4GB33 4YM1A 3FHIB 1A6CA 3WNOA 1LCCA 3F2ZA 5H9QA 3ZYIB 5KWRA 1JOBA 4LO6B 4RSUA 4CPBA 2JB8A 2FMYA 1YQ2A 1XE7A 2J1AA
chains in the Genus database with same CATH topology
2AH2A 2ES3A 2UYAA 1U5YA 5JSPA 4IVZA 1QQP2 4FPEA 3VKNA 2BNMA 1RUI3 3JXDL 3VBRC 1X2LA 3VV1A 1UU5A 5GKAC 3VBFA 1PNRA 1SLIA 4LHKA 3SITA 1JOJA 3HT1A 5KHGA 4C0HA 1FPN2 1SCSA 4LR4A 4RR3C 2ZOEB 3VKOA 3JCIA 1LR5A 2RS13 4FAHA 1ASJ3 1WMEA 1U5XA 1X8EA 2D3RA 1RMU2 4CDWC 1ZBE1 1U0AA 4RFT0 3PMEA 4GXLA 5CBLA 1AL0G 4FCAA 4LBKA 3RJRA 4B3NA 2HWE2 2X5IB 2P2KA 2HWB3 3TOJA 1GZCA 2IC1A 3FUOA 3WCRA 1ZRDA 1LHVA 2A3YA 2MQKA 3ZHMA 2XBO1 2BYVE 1MS1A 5GM0A 1W6QB 2R1DA 2IV1A 2AREA 3QBQA 3PXPA 4QQHA 1PO21 1DLLA 2DYCA 2I74A 4B29A 2OA2A 4GQ7A 1OOPB 1AXZA 3BD1A 3IDEA 4C90A 1VBB2 2PAMA 1AR72 4LTAA 5K7PA 1XWRA 1NZCA 3D0SA 2LCVA 1O5UA 3B3QE 1WD4A 2RM22 5FDBA 4HVOA 1PIV1 3LA2A 4PBPA 5GJ6A 1RZRA 3I54A 1JH5A 2DU0A 4PU3C 4YW2A 2E7QA 5CIRA 2DFBA 4ES8A 1S0GA 4XFCA 4D94A 4XOGA 1ZM1A 2PUEA 3VKMA 4BIFA 1UIKA 4OULA 5FQ0A 4LBQB 4AFAA 4EN8B 2I07B 3B7HA 3CJIA 3KCXA 3QD6A 5D1IA 2PIJA 1PIV2 5E16A 1H8TC 1GLHA 1QP4A 3AMNA 4XPVA 3ZXJA 5E1RA 4G4FA 3KS7A 1CAWA 5DUXA 5EJ3A 1GNHA 2A3XA 5DG1A 3QH7A 3AKPA 1YJLA 4QPGC 2B8MA 1VRH2 1G86A 2O4AA 2XJSA 5JPMB 4OHZA 4XF1A 1WGPA 4M3CB 1E57A 2IVQA 2BWCA 4FTSA 1WMFA 2YY1A 3O14A 1MVQA 2GU9A 1ZREA 2NPIA 1GBGA 3PTYA 1RUE1 2ARXA 2ZAHA 2CAVA 4N53C 4IEVA 1FI2A 3MLKA 2PUGA 3W58A 4E9KA 4Y20B 4MZUA 1PVC1 3KT4A 3VZJA 1DGRA 3Q9OA 2DTWA 3UJQA 1RIOA 4OB4A 3H3ZA 3B9IA 4XDQA 4YLZA 3ZFGB 1U5IA 4LO4B 1FPN3 1LTEA 1RZRD 1U5ZA 4X4DA 1PHMA 1CJPA 3ZYGA 1ASJ2 1KXGA 1OQ1A 4N9HA 3H1MA 3ETQA 2E51A 4IA8A 5JIAA 2RJKA 3VBSA 3ZYPA 1OHFA 3AXEA 2XJRA 4A2UA 2ZKNA 4Q0VA 4OI2A 2A6YA 5E88A 3BS3A 5E89A 4OHYA 2LYSA 4EN6B 1OQDA 2BEOA 1H1IA 4W6YA 3ME2A 4MGYE 1YFUA 3FC0A 4Q4Y2 3SCGA 5EWSA 1VBA1 1POUA 1WCKA 1CAXA 1ZRRA 3HAGA 4X8PA 5F6LB 1RUD1 1SDWA 4XMAA 2EBYA 1AXKA 3BU7A 3CLCA 4MLOA 3EUSA 4CEWA 4FOYA 2RMU3 1CD3G 2GZWA 4CDWB 1I1EA 4MUVA 2IWGB 3WDTA 4FPLA 1LKNA 4P9YA 3VGIA 3V0AA 4R9AA 3SLIA 4L8QA 5C9AB 1T6GC 1NLSA 1XU2A 4PDWA 3M1HA 2BUKA 3BODA 3I8TA 3LA7A 4Z92B 3KZ3A 4GQMA 1FMD2 1TMF1 5I93A 2OR1L 5DDJ1 4YVSC 2PQQA 2VULA 5C33A 4AG4A 2AZ5A 4GULA 1REFA 2YUEA 4UW6A 3B5LB 2L49A 1NE6A 2DF7A 4JCYA 4ZU4A 1LMB3 4IEYA 4A7KA 5AVPA 1LGBA 3EO6A 4EN9B 3MICA 2GRLA 2A3WA 3OP9A 2UWBA 3S7IA 1VAVA 4NHKA 1LHNA 1QJY2 4H55A 2UWAA 3GALA 3U11A 1QNWA 4P9WA 4JC1A 2Q1ZB 4Y5Z0 5BXXA 2R1JL 4YGEA 3RYRA 3VBRA 3FMGA 1NCQA 2E9QA 5A32A 2LYPA 5HI0A 5BNPC 5BUVA 5KHKA 1V00A 1N1YA 2HSGA 3DL3A 1AR83 2ZGKA 1NE4A 1W0OA 2EXJA 3R0RA 1SQ4A 2PHTA 3O12A 5KHIA 3NSTA 2X29A 4QGNA 4WVWA 4TWTA 3ZXAC 4GKYA 1SQ8A 4X8NA 5DUUA 1JYIA 1XYPA 3VL8A 1ZPQA 4AVBA 1QJX1 3BOPA 1BZWA 3QQ6A 1ZZ8A 2HEYF 2PYTA 4WVVA 1PZ7A 2X8KA 1J3PA 3FMYA 4XBQA 1TME2 1COV1 2GN3A 3GNEA 4QX5A 1OMIA 4COWA 5FQ0B 4LA3A 1C3HA 3R4SA 5CB7A 3GYDA 3MZHA 2XHKA 4FOWA 4FQZA 1VBD1 2OVUA 3POYA 3QH6A 1DDLA 4IXLA 2RS12 2ZGLA 1QF3A 2Z5WA 2HWC1 1OOPC 1S55A 4CDXA 3AX4A 1MZ6A 1VBE3 4JQRA 3K51A 4RHV1 1AYM3 5JMCA 2HWB2 3FLTA 1TMF3 4R4XA 1C28A 4QU2A 3HWJA 4NWWA 2XUMA 3R1FA 1V6MA 4Q4V1 1R1A3 1KS5A 4G3YC 2XVLA 4IESA 3M2MA 2P3JA 1V6IA 4JVAA 1MS9A 1GANA 2VMHA 1J3QA 1WH8A 3AYEA 1PO12 4ZU5A 5ABJC 5CFDA 1DYKA 5T3NA 4AVCA 3TB0A 4CRQA 5H9SA 2W08A 1VBB3 1Z0HA 1JW6A 4S2HA 4K1YA 4Q4X1 4CDXC 5KC5A 2GZUA 2JD4A 1C8M2 4KU8A 3AYCA 1QH6A 4F7ZA 4FQ4A 4LO8A 1ZZ7A 2NZ9A 3IWZA 4XXPA 1YFXA 2CY6A 1HIXA 4AFMA 2R32A 4NPRA 3ZSJA 3WLUA 1RUI2 4L92A 4P14A 3U4XA 2VMGA 3G7DA 4XW3A 4K7JA 3O7OA 1HRI2 1N47A 5BNOA 3T1MA 3L1PA 4S2DA 4FPCA 1ZVFA 1GR3A 1AJKA 1LOGA 4UW3A 1QPZA 4G9SB 4L11A 4PU8A 4KNCA 3B94A 3MIDA 4FN3A 2DVFA 3VHPA 2JVLA 3DKWA 1YI9A 2XVGA 3VN4A 3ACLA 4MXWA 1V9U3 2P34A 1O3RA 3CU7A 1YFWA 4Z5DA 4WM7B 1LOFC 2GC3A 3E6BA 1ND3C 4XEZA 2FZ1A 3MF6A 2PUFA 3CF6E 2D98A 5SV5A 5BNOC 1CN1A 2WNVC 3WP5A 1H2MA 5GZFA 3WDYA 2GALA 4F8DA 4QM9A 1MS8A 5FPXA 4R52A 5J3UA 3QLQA 3ZMOA 5EZWA 3ZSKA 1V6OA 1TME3 2VQAA 4NHLA 3VBUC 3VDDA 1CVNA 4X6RB 2BVVA 5K9YA 1YI7A 3RNSA 1FNZA 4AFBA 1M06G 2DVDA 4XIKA 5CFCC 3GZUC 1LGCA 4FT8A 5KXCA 4L99A 1Q8OA 1DWKA 2LYRA 2CGOA 4YNIA 4O9EA 4PIYA 2BTVC 1UAIA 3TWIA 3MGUA 5F1RA 2WZPP 2Q5TA 1CAWB 4OI0A 4EROA 2ZX2A 4AHXA 4Z82A 1D0GA 3B9CA 4YG0A 3WW4A 3H1WA 1F5FA 1MEC2 1BJQA 1NXD1 1AUYA 1S0FA 4U36A 4AWDA 1OI6A 3OBRA 4D7TA 1PMIA 4HKOA 1DQ6A 1WLTA 2XJTA 3AZYA 3VKLA 4Z8BA 4AYUA 4GIQA 5JR7B 2Q4SA 2KEJA 2JG9B 1ENSA 3D82A 4Y1XA 3ZXLA 4AI3A 4AVTA 4LULA 3ZN4A 2HWE1 4QM8A 2AXVA 4ATEA 4QGLA 2WA4A 5DZGA 1B0NA 4YM3A 4YYOA 4A3XA 2N7GA 1Q8QA 1ZBE3 1ALYA 4L97A 5TSWA 2FBEA 4LBQD 4DNYA 5AVAA 2XJVA 1W0PA 4M3CF 2PUBA 3J8F3 5CADA 4ISQA 3SCFA 2AUYA 3FX3A 2ZGRA 1IHMA 2XJ3A 4CDXB 3WP3A 1FX5A 4RL7A 3ENRA 4R9CA 1EFAA 1BYHA 4GA9A 3GZAA 3UV9A 2IXIA 1QQP1 2QE3A 3V64A 1ZS4A 3OMTA 2LYQA 1QGLA 1WCDJ 2XB6C 4D7YA 2GN7A 2GNMA 1RUNA 4RS5C 3SHRA 1SBEA 1KD7A 1WUVA 1C8NA 5FMOL 1V9U2 5SV8A 2G9FA 2Z69A 5D8AC 4S2FA 1POV3 1PO11 1QXRA 4XBNA 3CJIC 4Q29A 2V5YA 3R05A 4DY5A 1TQ5A 1RTVA 2H6CA 4LBLA 2YC0A 4Y24A 3ZDSA 2I2SA 3EJKA 1DU3D 2OW4A 3VZNA 1YNAA 1GQHA 1Q43A 1V6NA 2ERFA 3DNVB 2ZZJA 3O0VA 4GB31 1U12A 2CNAA 2RMU2 3VL9A 1BDHA 2D40A 3WW1A 4CDQC 3BCWA 4R9DA 1OLRA 1V70A 3DPRC 1ZX5A 2UY9A 1LECA 2HEVF 2WT2A 1D2SA 5GLTA 5JOZA 1QDCA 1HRI1 3OGGA 1NQJA 4LLOA 1ND3B 3KCCA 3R4DB 5H9PA 2D3SA 5FLIA 4BQ1A 4UXAA 1ZBA2 4HVRA 4YM2A 1H2LA 1RGSA 3ZFFA 4KL1A 3U07A 1UL9A 2RS53 3SXWA 3N4MA 5J48A 1GFF2 2W0XA 4IWRA 4IETA 1MACA 3UKNA 4HK9A 3RG0A 1R69A 5I0SA 5BNNA 3NV2A 4DXZA 4Z59A 1ZZ6A 4MGZE 1Z7S1 2PHUA 1MEC3 5KBFA 4IQPA 1LENA 4CP1A 1MQTB 4WZFA 4Q1RA 1RB8G 4L9BA 1IKQA 3POWA 4HSJA 3V0BA 1REDA 3PLQA 3WD5A 1LESA 4I02A 1H8TA 4XYXA 4AGRA 4GH4B 1BQPA 3E6DA 2DV9A 3MPPG 2RJLA 4CDUB 3LOBA 5GZCA 4H7MA 2ZX4A 2AGSA 3ZKCA 2C5DA 2IFWA 2IXCA 2QZ2A 3AZWA 1UKRA 5T50A 3ALQA 4X4HA 1V6LA 2H8RA 1AZDA 4YG6A 4BLJA 5BNPA 2JG8C 3F52A 2K0GA 2Y0IA 4OHWA 5I91A 3E6CC 4FTBA 3ES4A 2E7AA 4IV3C 4AI2A 1N3PA 2RS33 2QDRA 1V6JA 3LGRA 4IV1C 1ULCA 2H0VA 4BHPA 1K5MA 1RUH3 4HETA 3TN93 1KDKA 2G4IA 2D43A 1AYN1 2D5VA 4MGIE 5J09A 1Z7S3 4D7SA 1UD1A 1UTXA 1PNFA 1D4VB 4Z1VA 2VNOA 5A33A 1QDOA 1AR91 3FE5A 3NO8A 4OI4A 4P9IA 5JSRA 1VBA2 3HT2A 4MYEA 5KC6A 3WW2A 3ZX7A 1R1A2 2ZBJA 4F3JA 2ZTNA 3LA3A 2RR13 2A70A 5I8SA 3VBRB 5JAXA 3M7AA 4I3PA 3R4UA 1G9BA 4QPGA 1ENRA 4CP2A 1HW5A 4OFGA 2FHRA 2R1BA 1S0CA 2DU1A 4QMAA 3BDNA 2FMDA 5LRSA 1RZSA 4K1ZA 2D5FA 5JCTA 1NG0A 3HBZA 4AVVA 3U3WA 3W9AA 3OBTA 1ZBA3 2O8QA 3AZVA 4XJUA 5GLWA 1ZYBA 2D93A 4H14A 1GSLA 1LOCA 3LCPA 4JGYC 2VW0A 3ZYRA 1R082 1QXPA 3JD72 4E27A 3ASIA 3DPRB 2A6WA 4UW5A 3KGZA 4HFSA 1DZTA 3RYPA 3WG3A 1LQCA 2G9GA 3IBMA 2KEKA 1OFSA 1R092 1DF0A 1BEV1 2GMMA 4YZ1A 2XJQA 1HXS2