1ZZ8A

Crystal structure of feii hppe in complex with substrate form 2
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
192
structure length
192
Chain Sequence
ASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 47
structure length 192
sequence length 192
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz8A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz8A02
2XGXA 1ZVFA 3FE5A 1S7EA 2GRLA 3QF3A 1WH6A 2A6CA 1YHFA 4MUVA 4KU8A 3ES1A 4I0AA 3U3WA 4JCXA 5J3UA 3OGJA 2B8MA 1EFAA 3ETQA 5LRRA 1J3QA 3IDCB 3TNPB 3H9AA 5JSPA 3QYXA 3GN5B 4WVZA 3F51A 1JFTA 1GQHA 1ZPQA 2O38A 1HF0A 3H1YA 1CJGA 3DL3A 2XLGA 1QQAA 1VJ2A 4XF3A 1Q5OA 2GRMA 1YUDA 3D0JA 3F6WA 3S7EA 1ZS4A 5FLHA 3QQ6A 4OB4A 3U0ZA 1RZRD 4AQ2A 2HJIA 4FBFA 2XL7A 3H7YA 4XFFA 1E3OC 1UCXA 3ES4A 3EJKA 3ZDSA 4X4HA 2XLFA 1X7NA 3FYMA 3QWGA 1CAUB 1OFNA 2B9UA 3CO2A 5CU1A 5I0UA 4Y42A 2Q1ZB 1G6NA 4LUMA 2Q30A 4Q0SA 4LTAA 5BXXA 4IEYA 1J58A 4QX5A 2PIJA 4PU4C 4E2GA 1J3RA 4JVAA 1JUHA 4AVAA 2FQPA 5E1RA 5FPZA 4XETA 3IBMA 2O8QA 4QM8A 3SXWA 5AVPA 2L49A 5BPXA 3LISA 2PUAA 4YSFA 5FPXA 4L11A 5T3NA 5JCTA 1IPKA 3D0SA 4YG7B 2XKOA 1UTXA 4E2QA 3R6SA 1R63A 3LAGA 2CAUA 4KL1A 1RL3A 3E6CC 3FZ3A 3GBFA 4JCYA 4ZU7A 2KZ8A 2KEJA 2H6BA 2OPKA 4AVCA 2XJ3A 4FT8A 1R69A 4IEQA 4XF0A 1DZRA 2GU9A 3OF1A 3LA2A 1ZZ8A 3IVPA 1NXMA 1LCCA 2D5FA 2GZUA 2GC1A 4I6TA 3BD1A 4MGYE 4X6RB 2WFPA 1SEFA 3SMHA 1DGWA 1NEQA 1XWRA 3TRBA 4AQ6A 4QMAA 2MQKA 2R1JL 4PU3C 1QP0A 1CAVA 4YNIA 5FLIA 5HI0A 4LUKA 3JXCL 3KMHA 1UIJA 2OZJA 4HSLA 4X4GA 4IEPA 1VPWA 4ZU4A 1CAXA 1ZRDA 4I2OA 3M3IA 1WETA 1YFYA 2GC0A 2UYAA 1L1MA 1ZZ9A 1PERL 1AU7A 2OZ6A 1CAWA 4HVQA 5I8YA 3RNSA 1LB2A 2LYSA 4XF4A 2ZCWA 3WW4A 4WZCA 1OMIA 1SQ8A 2O49A 3OD0A 4EWDA 1ZAYA 3SCFA 4UBGA 3KZ3A 2XCJA 2XHKA 1JFSA 3H7JA 4N9IA 4EROA 2ET1A 3FYAA 3C3VA 4BH9A 4IEWA 4FAHA 1ZVVA 2AWIA 4IEXA 3OMTA 1DGRA 2BYVE 4YYOA 3H3UA 4LA3A 4IETA 4B29A 3G5GA 3KSCA 4QGNA 5I93A 2LYQA 4KWKA 2PAKA 5D1IA 4QGLA 5I0SA 3ZHMA 4PU8A 1O4TA 4PIZA 2GZWA 5BUVA 4PIXA 2FJRA 2D40A 5FQ0B 4F7ZA 1V70A 3O9XA 2PUFA 1ZZ6A 3OCPA 2OA2A 4D7SA 1ZZ7A 1QWRA 3FFQA 2CSFA 4KWJA 2JVLA 4OFGA 5LEKA 1NZCA 4HN0A 1GT0C 1IC8A 3D82A 1ZZCA 1XE8A 5I0RA 3FX3A 3MPBA 2PQQA 4LULA 4XFIA 3H1MA 5LEJA 2AUWA 3H1WA 3RDIA 2OFYA 3RPQA 1O3SA 2BNMA 1XRUA 4Q0VA 2PYTA 4X6QB 3CLPA 4HVOA 2PUCA 1EYBA 4LA2A 4IEUA 2KEKA 1LLIA 1ZUGA 1FXZA 1CAVB 3KCCA 4HBNA 4HZFA 1OSLA 3PLQA 4XFGA 1O5UA 3S7IA 2PUDA 1Y3TA 1H1IA 4I0BA 4E2SA 1NE6A 2IVQA 5I8SA 2KXLA 4FAGA 3UFDA 2PPXA 4Q0PA 1VR3A 3I59A 4HMZA 2MHFA 1CAWB 3SHRA 2HINA 2OYZA 4HVRA 1LMB3 1O3QA 5C6CA 3H8UA 4N9HA 4BIFA 2IV1A 4ORFA 1ZREA 1SFNA 1RGSA 2FMYA 4MGZE 2KPJA 4IEVA 2H0VA 1HW5A 3KJXA 4Z07A 4F8DA 2QDRA 1RC6A 4XFHA 2IXJA 1YLLA 2LYKA 3OTFA 5BY5A 3FWEA 1UXDA 4MCTA 5K8SA 3O14A 4BHPA 1RIOA 4Q0UA 2MPFA 4EV0A 4UBHA 2F4PA 2Q0AA 4XFAA 5FCCA 1BDHA 1ZX5A 2VQAA 4MGKE 2XKPA 3PXPA 3OQOA 1X8EA 3CF6E 2PHLA 3RZZA 3BB6A 3MYXA 3LZZA 5KHHA 5K98B 3FJSA 3U10A 3CLCA 2ETEA 3I7DA 2EA7A 3EO6A 3N4MA 1YWKA 1RZRA 3NW4A 4WBBA 3WW1A 1OCTC 3VHRA 2CV6A 1RPEL 2EF8A 5FDBA 4X4FA 4X4DA 1O5LA 3EUSA 4YRDA 1PRVA 4YG4A 1Q43A 2K9ZA 1OI6A 2QCSB 5FQ0A 3CJXA 1QP4A 1LRHA 1ZRRA 3TNQA 1CGPA 2P17A 5JSRA 4HN1A 1X82A 4NDWA 3CECA 4X4IA 4MGIE 3PVBB 1CX4A 2H8RA 2VPVA 3DV8A 4KWLA 2R63A 1X2LA 4O9GA 4ONUA 1CQTA 2LCVA 3HQXA 1ZRCA 1O3RA 1LKNA 4Z58A 4IVZA 2IC1A 2WC2A 2D5HA 2IXLA 3IWZA 3E5XA 3MZHA 3NVCA 2PUGA 4EWAA 4R8HA 4UXAA 2AXZA 2ICTA 3ZHIA 2Z2SB 2IXKA 2UYBA 2GH2A 4XFBA 4IWRA 1X57A 4X4CA 2QNKA 3H5TA 1EPZA 1NYWA 3CL1A 1NE4A 1H1MA 5JSOA 4KU7A 3JXBC 1ZRFA 4A2UA 4RD7A 1LQCA 2MNGA 2LYJA 3WW2A 3UKVA 1U12A 2PHDA 2LYPA 3DKWA 3KGZA 1UPIA 4O9EA 1YFXA 1PNRA 4JQDA 2B5AA 1ADRA 1RTVA 3ST7A 4IERA 3QACA 1JH9A 2IXHA 2GC2A 3R1FA 3MLFA 3L1PA 3RYKA 2IXIA 4CYDA 2PUBA 4Z5DA 2I45A 3EHKA 2AXVA 1B0NA 1BDIA 1L3JA 4FBIA 1QXRA 2HKXA 4X4EA 5J7MA 1O7FA 2EWTA 3E6BA 5JAXA 2K0GA 1I5ZA 3G7DA 3E6DA 4PIYA 1J3PA 3ROUA 2VECA 4JTNA 3SCGA 1PMIA 1DWKA 3IDBB 1WGPA 3LOIA 4P9GA 3FMYA 4Q29A 2BNOA 4ZU5A 1TQ5A 2EBYA 4XEZA 3S0MA 1OD5A 2B5HA 2GAUA 1DW9A 5A7LA 3CROL 3DN7A 2EAAA 3EQEA 3I59B 5E16A 3E5QA 2PE5A 4F8AA 4LLOA 3SCHA 4I8TA 4J1XA 4MCXA 3EBRA 2BEOA 2AW6A 3OQNA 1JWLA 1SQ4A 4JTOA 5C8WA 1POUA 2CROA 3BDNA 3MDPA 2XIUA 1Y7YA 4TLFA 4GQMA 2LYRA 2AXUA 5J48A 2C0ZA 3BS3A 2PUEA 4AVBA 3USSA 4MZUA 5LRSA 2WUSR 1J1LA 3OQMA 3L2HA 2IVGA 2PA7A 3NKTA 1RZSA 4X4BA 3B7HA 2XSDC 3GN5A 2UY9A 3PNAA 1WLTA 5KBFA 1UW8A 3WW3A 2ICPA 3LFPA 3F52A 4Z59A 3S8QA 3OP9A 2Y0OA 3RYRA 4FN3A 1UD1A 2PFWA 2QVSB 1VP6A 2UY8A 2E9QA 1RUOA 4I3PA 2PTMA 4IA8A 2KEIA 2DCTA 4MH0E 3U11A 4JV4A 1UIKA 1XE7A 3JZVA 4MV2A 2JCGA 1CAUA 2BJCA 3HIFA 4I09A 4I6UA 2BNNA 4XF1A 3HT1A 2O1QA 2GC3A 5I0TA 1LR5A 1I6XA 4MX3A 4DINB 1LCDA 5KHKA 2Q4SA 3NSTA 4QXKA 4XFCA 2CGPA 1WA4A 2N7GA 4J1WA 2H6CA 2Z69A 3LA3A 3IIAA 2ZKLA 4BYYA 1YSEA 3HT2A 1X8MA 2HSGA 3ZKCA 1QP7A 1J59A 3UKNA 5KHIA 2LYLA 3JXDL 3BPZA 4H7LA 5I8TA 2V09A 1O4XA 1ZZBA 4Z5CA 4PJYA 4YARA 2IUOA 2BGCA 3ACLA 2WIUB 5KHJA 2D93A 1EP0A 1PRUA 2PAMA 2EVXA 4PU7A 2QJVA 4OLLA 1RUNA 3VK0A 3BALA 4IEOA 4LEJA 3RYPA 4R52A 2O4AA 4Q0QA 5CVRA 4META 1QXJA 1WIZA 3ELNA 2IU7A 1EY2A 2IVBA 2XI8A 3GYDA 5BV6A 3QOPA 5FLJA 1FT9A 3BCWA 1UXCA 1PRAA 4YG1A 3M70A 4IESA 3H50A 3HZIB 4XF9A 3I54A 1YFUA 4YBAA 2D5VA 3E5UA 4D7TA 1PM7A 1O3TA 5EFUA 4GHJA 2CAVA 2OR1L 1CAXB 1QQBA 2IXCA 1NERA 4Z5HA 1DZTA 2XL9A 4I01A 3D1NI 4I6RA 3KGLA 4O8BA 4QM9A 5KHGA 1FI2A 1Y9QA 5CADA 2ET7A 2PAEA 3BU7A 5EZWA 5I91A 1ZNPA 2ATFA 3E97A 3LWCA 4I02A 3LA7A 5JR7B 1Q3EA 4HSJA 3UKTA 4EWEA 3CEWA 2MEZA 1QPZA 3KXAA 4AXOA 3B02A 3NJZA 4HLTA 4GULA 3DNVB 4QGMA 1YFWA 1WH8A 2XLAA 2L8NA 3NL1A 3FHIB 5F1RA 1GQGA 4Z82A 4NVPA 4IEZA 1QY4A 4K8FA 4L2NA 3H3ZA 1IPJA
chains in the Genus database with same CATH superfamily
1ZVFA 4ARYA 3FE5A 5FY4A 3QF3A 5GAHi 2WN2A 1GUIA 4KU8A 4LBKA 4ATEA 4MG2A 2WYSA 2W0XA 2RDNA 5A6YA 1IS5A 1NCQA 3S30A 3TWIA 5LRRA 2ZMNA 4CP1A 2XJTA 3FC0A 3W58A 1TVGA 4DQAA 5CISA 1ENRA 2HCNA 3ZIWA 2QQWA 2W5FA 3Q8CA 3J9SA 1VRH1 4N53A 2VU9A 2DV9A 1LGBA 2R041 3IIIA 5FZOA 1LHNA 1HF0A 5FZ9A 1CJGA 4AFAA 4XF3A 2GRMA 3AL5A 3ILNA 1RVF2 4XJAA 1LEMA 4NO4A 4OB4A 1PO21 1HB4A 4AQ2A 2HJIA 3A22A 2DU0A 1VBC1 5A32A 3SH3A 2JG8C 2VCCA 2J7WA 3MF9A 3GHNA 3ZDSA 3R09A 4X4HA 1CR7A 4AHXA 1APNA 1BHGA 2LW8A 4KBBA 1WW7A 1DLCA 1OFNA 4YVWC 1VRH2 1RUI2 3ZXAC 4CDUA 5FUNA 5L36A 4Y42A 1S2KA 2ZHNA 3ZLIA 1ZBE2 3RRDA 1WBFA 3HNBM 1RXGA 4DXZA 4LUMA 1XNBA 4Q0SA 2RHPA 3NNFA 5BXXA 1J58A 4QX5A 4CUGA 1S1AA 1PVC1 2PXKA 4PU4C 3W5MA 2WABA 1W8NA 4NRPA 1KITA 1OOPC 4GALA 5LBBA 3OKZA 2O8QA 2ZGOA 2ZGMA 4UW6A 4R9CA 3QOWA 1SLIA 5FYUA 4NHKA 2VXJA 3SNMA 1PMJX 1V9U1 2PUAA 4QB6A 1W6OB 4DRVA 4DRRA 4UFMA 5GLZA 3LF7A 5JCTA 4DXTA 1PVXA 2HWE2 2WO2A 3N9LA 1W8WA 4GKXA 4Z1VA 1NA1A 3ETPA 1EAH1 1QJY2 3GZDA 1U5ZA 1YQ5A 4RFT0 1LAJA 5I0DA 3WG4A 2JQEA 3FZ3A 3GBFA 1DP0A 4P9XA 2H6BA 3T2PA 1HLCA 1QJU3 1DZRA 3PE5A 1JOPA 4OZOA 2IVJA 4GWJA 2VO5A 4A4AA 1W0PA 4CXWA 2V5YA 2WZR3 4WM8B 5C9AA 1R1ZA 4ITCA 2YROA 1LODA 1GR3A 4RN5A 2WFPA 3IM0A 3LQXA 1SLCA 2OUHA 5JR2A 3W59A 2VNVA 5A3WA 1HB2A 1W9TA 2RJLA 2EAKA 3N7MA 1KFUL 3B7MA 3GDBA 1PGL1 1I5PA 1QEXA 5HCBA 2MQKA 1D4M3 2DTYA 2YY1A 5JOXA 4UW3A 1FOD2 2AR6A 4IL7A 4O61A 4N43A 4PLMA 4E4HA 5AFEA 5CIRA 4F3JA 1PZ7A 2FDJA 1C1FA 4IEPA 1VPWA 4ZU4A 5JDBA 3WX5A 2DCYA 4L92A 3VV1A 1CD3G 3W20A 4KNCA 1NUKA 1ZZ9A 5IATA 1AU7A 2RS12 2C9KA 3WDXA 1G9BA 3RNSA 1DLLA 4QQPA 4EN6B 4QDRA 2VCMA 2ZCWA 3GJBA 2DVBA 4GWNA 4Y22A 3WW4A 1OD3A 4XDPA 4LKSA 5A80A 3V0AB 1SQ8A 2WNEA 5A3TA 2P3JA 1RUE1 1KRIA 4BWOA 2WNUC 2RS53 1QJEA 2EIDA 2HWB3 3H7JA 2ET1A 3H8RA 1MS5A 1N1TA 4GWMA 4EZHA 2QUOA 5BNQA 5T5JA 1OLRA 1Q56A 2VOVA 1CZTA 1O91A 4H7MA 1C3HA 2A73B 4BQWA 1YIPA 2RDQA 2RV9A 4DY5A 2RS32 3IN9A 3LEKA 4IETA 4YWAA 5EQUA 1RHI1 2GDFA 4EQZA 4IE0A 4AEDB 1CIWA 2JDKA 1V6OA 4D3WA 1MZ5A 4G3YC 2VXRA 3VBUC 4XPVA 3HPNA 3B93A 2BOJA 3MPPG 1W6NA 3OGRA 4PIXA 2ZJCA 5EIYB 4W50A 4F7ZA 5FR3A 4A44A 3O9XA 1ASJ2 1COV2 1H2KA 1N1SA 1UZZA 1IGOA 3OCPA 1YI7A 1FX5A 4FTSA 4W6YA 1FMD2 1XNDA 3VLBB 3ZM8A 1VBD3 4QWNA 1JZ7A 4D7SA 1WW4A 3BU0A 4B1LA 5BNNB 1SFPA 2F17A 2WZ8A 4LKFA 5LEKA 4EYUA 5HXMA 2ZPXA 3KF5A 4LO4B 1PIV1 2R042 1CZVA 3FX3A 1SFYA 2PQQA 2VW2A 4LMFA 4XFIA 4CCEA 3ZFEB 1O3SA 1W2OA 1PK6C 1XRUA 3OG2A 5DG1A 4Q0VA 3CLPA 3RI9A 1A78A 2WS93 1HKDA 2VZOA 2J1TA 2JE7A 2ZGKA 2KEKA 1LLIA 1AR72 2ZA9A 4N53B 4QX7A 4HZFA 5FMOL 4BQYA 5LB6A 3PLQA 4E8DA 3WHUA 1Y3TA 4I0BA 2QQNA 1LENA 5I8SA 1HXS3 1OVSA 2KXLA 1RUI1 4WM7A 5HBAA 3KV5A 1MQTA 3PJQA 5A3PA 4JHTA 2VQ0A 3FLTA 1HRI2 4CP9B 4XTPA 4DUVA 2FDGA 1LCLA 1R1A2 4HMZA 2UWBA 1PVC2 4CDXB 3WP6A 1VBA2 3SHRA 1W0NA 4E8CA 4DUXA 4HVRA 2VMFA 1Z7S2 4GA9A 3WZ1A 3HWJA 5FJKA 1PHMA 4QPGA 4NIGA 3HD8B 4O7XA 5IFPA 5FPLA 3T08A 4Y26A 1RGSA 5IVBA 4NWVA 4MGZE 4FPHA 1ND2A 4QB2A 3N7JA 3RJRA 2HWE1 3ZSLA 3BTYA 4Z92B 3MW2A 3ZMOA 1AYN2 3O5SA 4MSVA 1N1VA 1RC6A 4AF9A 4ZONA 1R64A 2IXJA 4P9WA 3WV6A 1I9RA 4OUSA 1ULGA 1ZRIA 2DUOA 2HWD2 4TN7A 4WM8A 1JZ2A 1AR61 5FYYA 4BMBA 2PN5A 2VD7A 3ACIA 4QHZA 4BHPA 3G0TA 4Q0UA 1IQAA 4ZZ8A 4UBHA 1BDHA 1QNYA 1G9DA 1JYTA 4MGKE 2CTVA 2C26A 2BDRA 1H8TC 2HYKA 3SLIA 3BGAA 4A6SA 4ASLA 3BB6A 5FWEA 4CU8A 2V5DA 5ACA3 5FTTC 2ETEA 4IE6A 3I7DA 2EA7A 2CSGA 1RZRA 1TME3 5DDJ3 5LK5A 1RUC2 1BKZA 3OGGA 4Q4X3 5CFDC 1AR63 2LRPA 1RPEL 3TB0A 2XBO2 5FDBA 5GZDA 1WLCA 1W06A 2HWF1 4NMIA 5ABJB 1MVEA 3CU7A 1GOGA 4XBNA 1GWMA 2JDAA 2QCSB 4PQQA 4DFSA 4LO8A 3V64A 1K3IA 1X82A 4NDWA 3CECA 5GALA 2TEPA 1QMJA 3KV4A 2IFWA 1W8TA 3GBWA 4LBQD 2HH9A 1HN1A 3MF6A 4BXFA 1PIV2 4KWLA 3DUIA 4O9GA 2VZVA 2WT2A 3JD73 4LK7A 3ZKYA 2LCVA 4NE9A 4L9BA 4AQTA 1ZRCA 4BZ4A 2XJQA 2ARXA 1LECA 4KGGA 3KWVA 5GZFA 1O3RA 3C8XA 2IC1A 4ATFA 4CDWB 2IXLA 4PDWB 3VWSA 3FBYA 3NVCA 4EWAA 5F5AA 5KXBA 3JD72 2VE1A 3VUOA 2AXZA 2R0HA 4LHNA 1V0AA 1ULFA 2UYBA 2ZX3A 2OVUA 5L9RA 4AI8A 2BZDA 1RMU2 3R4UA 1GYKA 5EYYA 3V0AA 5JZGB 1RUF1 3HEIA 5FBJA 3H5TA 4LHSA 3CL1A 1HQ1A 1NE4A 5FO7B 1GNYA 1WLWA 3JXBC 1KDKA 1H30A 2HFZA 1QJY1 3I2GA 3J8F2 2MNGA 3AZXA 2LYJA 3MW4A 3POIA 4Q4V2 2PHDA 1SCRA 5GLVA 5EP9A 2Q5TA 3DKWA 1JN2P 1AUYA 2E7QA 2G9GA 4FQZA 4N43C 5HXVA 5BNNA 2UU8A 4JQDA 4O65A 5IWFA 2W9XA 1BZWA 4IERA 4TXWA 3QACA 5F5CA 5F6KA 5IJRA 4NRQA 3K2OA 4QPGC 2WO1A 3N9NA 2IXHA 3CMGA 2ERFA 3GCXA 1RUG1 4Q2FA 3L1PA 1DGLA 2IXIA 4Q1PA 1ST8A 2UWAA 4RQPB 2QKDA 2W94A 3P1IA 4PLOA 3HJRA 4CCDA 1H4HA 5J7MA 1W28A 4AFDA 1B35A 2K2SA 3F95A 5JXHA 1GU3A 1LTEA 1W2AX 1I5ZA 3AYCA 4HRAA 4P5HA 3CZJA 4X8PA 3USUB 1O8PA 3NRUA 4CU9A 1J3PA 1HRV3 1S55A 2VECA 2YPJA 3SCGA 3JB4C 3PHMA 3VBRA 5DZFA 3ZPOA 4F83A 1VB4A 3DYOA 4WM8C 1H1AA 4ZU5A 1RUH3 4XEZA 3GALA 1MQTB 1STMA 3OPZA 4MGQA 2XOMA 3VZMA 2ZEZA 1UNBA 2R062 1LESA 4PLNA 2D97A 5E16A 3ZPYA 1QOOA 2CGOA 2L1PA 3O1SA 4IE5A 1OA3A 1BVVA 1PGSA 4FOYA 5FZDA 2BGOA 4J1XA 4MCXA 1ZBA2 2BEOA 2LS6A 2VBPA 3NKGA 5IVJA 4Q4W2 4IV3B 4Y4RA 5FZGA 2AACA 1JWLA 4FOQA 4CDQB 1NOVA 2ZGRA 1MEC3 2WQ4A 1NT0A 4I3GA 3S5QA 2XHNA 5FZ6A 2JDZA 1HRV1 4GQMA 2LYRA 3HVDA 5BNOC 2O0OA 4LLFA 2WJSA 2QQKA 2C0ZA 2XVLA 2FCUA 1H2MA 4P9LA 4XVHA 5ANQA 1ZBA3 2QQUA 5T52A 5BNPA 4FFIA 4AVBA 1PO23 4FPLA 2DUPA 3KCXA 4EJRA 3VDDB 5CBLA 4B4RA 1W6MB 3U4XA 5K4LA 5LRSA 1JXNA 1J1LA 2GP3A 3OPTA 4UFHA 4P14A 4COUA 5F3CA 1AL23 3THCA 4YW3A 4RS5A 3NKTA 5EHDA 1RZSA 3H8XA 2A3YA 5GAGi 4AVSA 1DQ4A 3OB8A 1OBNA 3GN5A 2UY9A 1PK6A 3PNAA 1HRV2 4ER5A 1RVF1 3C7EA 5DQ0A 4HKOA 1W04A 3POYA 1LGCA 1OKQA 3WW3A 2R043 3LFPA 2X05A 3S8QA 3OP9A 5DAXA 3RYRA 4FN3A 2P3KA 2PFWA 2QVSB 4QD2A 4K1ZA 2XVKA 3AFKA 4UF0B 3DXTA 2JWPA 2UY8A 3NV4A 2E9QA 4R9AA 4KG8A 2DCTA 3HBKA 1NCRC 2Q8EA 4AI1A 2JCGA 2ZX0A 1CAUA 1AR82 2EF6A 3WP5A 4A45A 3SR4A 1UU4A 3WG2A 3HIFA 3MUY1 4GKYA 1GSLA 5T50A 4XIKA 5IVVA 3ZYIB 5IK5A 1SLAA 1AVBA 4K20A 1LR5A 2VQTA 4COYA 4IGOA 1X50A 2W92A 3TAYA 2XXPA 3W9AA 5KHKA 2A6YA 3RJ2X 1ONAA 2YBDA 2KR2A 5LA0A 1T6GC 2PXTA 2WA4A 1QQP2 2RR12 2WUHA 3IDAA 3OOXA 3U07A 1DYOA 3LA3A 1RJ7A 3IIAA 3UK9A 4BYYA 1BBT2 1WWYA 2JEMA 1ENSA 3HT2A 2G4IA 4XOGA 3ZKCA 4URAA 2BUKA 3JBG1 3H3LA 4Q4W3 3MI8A 3O0XA 5JPNB 2ZABA 1LOGA 3HAGA 4JZRA 1PIV3 4RFRB 1ZZBA 5T5PA 3WNNA 2JDPA 4C90A 2BGCA 1PO13 5FZHA 1HX6A 3AMMA 3T1LA 3W21A 1EP0A 1PRUA 5F2SA 1W6PA 4Q4V3 5F8PA 4PU7A 5J37A 3VZNA 5LA1A 1YNAA 4QPWA 3VK0A 5FZCA 3ZYPA 4B4QA 4BM8A 1DFQA 3GBGA 3OUHA 3BKZA 1YEWA 1QXJA 1WIZA 2CNAA 1C8M3 1FOD3 4JC1A 5FY8A 2IVBA 1VBB1 2ZGTA 3WSOA 2PXFA 4Q4X2 4R9DA 3RQ0A 4Y1VA 1TMF2 3QOPA 4LE3A 3VZLA 4XDOA 1RUE3 1D0GA 4LBOA 3BCWA 3M70A 1PRAA 5DRTA 2BJSA 4COVA 3HZIB 3RI8A 1NLQA 5DT2A 3PVEA 3UGGA 2HWB1 3ZDVA 3E5UA 4AYUA 5EFUA 2IXCA 2D6LX 1F35A 2JIJA 1YQ2A 2ZEWA 2NPIA 2PXUA 1DQ1A 1R081 1OKOA 3BPSA 4YM0A 3KGLA 2RM22 1RUE2 4PHZA 4NIHA 5A6XA 2GP5A 3DPRB 4HK8A 1QOTA 4W6XA 5DUWA 3RGBA 5CADA 5J36A 1GNHA 1ZNPA 2LALA 5JR7B 1CX1A 2DUQA 3ZFFA 1QJY3 3CEWA 3VDCA 4CUAA 2MEZA 4SBVA 1QPZA 3ZSMA 4C1XA 3ATGA 1LEDA 5DAPA 5FXVA 4D0QA 4FP3A 4BQ3A 4QGMA 2A3WA 1Z78A 1WMEA 1GP5A 4D6SA 2VY0A 2W39A 1VAVA 5GLUA 3PUIA 4NVPA 2ZMLA 4XIOA 1SG3A 1UY4A 4CCLA 4MYEA 2XGXA 4I30A 4V2VA 3PTRB 3POWA 2GRLA 3WD5A 1FV3A 1WH6A 4AEMA 4WVVA 1YHFA 2G19A 3U3WA 1FNZA 4YM3A 1EFAA 3ETQA 1QHDA 1DDLA 3TNPB 3AYEA 2EXIA 5JSPA 3VKFC 5JXIA 1HN0A 3GN5B 1VMJA 1MS0A 2AGSA 2W47A 4AOCA 1JFTA 5JUVA 1GWLA 3DEMA 1AR73 5LBCA 4K6BA 1B35C 4HPKB 4N53C 1LGNA 1VJ2A 1TNFA 1XYOA 3OYWB 4BLIA 1Q5OA 3D0JA 3R4SA 2QQVA 1VAMA 1ZS4A 2Y60A 3TN93 4DPNA 2QQLA 5J98B 3LPFA 2VBBA 3WNXA 3THTA 1AR83 4AHWA 3POGA 4B8EA 3H7YA 4JDNA 5JOZA 1UCXA 1Z7S3 1GBGA 2XLFA 3EMRA 4AEKA 2PXLA 3QWGA 2WNUA 5JMOA 1EV12 4URTA 5CU1A 1G6NA 3PIGA 1ULCA 2VTXJ 4FFFA 4IEYA 2AC1A 4CDUC 1DQ6A 1WMDA 4Y24A 1HXS1 2VZRA 1J3RA 2ZKNA 4HKWA 2P2KA 3J7LA 4BXSV 4DE9A 5E1RA 5FPZA 1RUF3 1IG0A 4S2GA 5G04L 3SXWA 5AVPA 3Q8EA 2XUMA 3A4UA 3A9XA 1PGW2 5L9BA 3LISA 2DFCA 4YVWB 3SC7X 1AYN3 1YO8A 5BYNA 1CN1A 1UKRA 1UTXA 1QJFA 1GP6A 3GGLA 3VBFC 1D2QA 3NXHA 3WLUA 1RL3A 3IPVB 1GFF2 5L9VA 1UN1A 3E6CC 2KZ8A 1QB2A 2OPKA 4AVCA 1W9WA 2RS52 2XJRA 3MLKA 4QX3A 1R69A 4IEQA 4XF0A 4QX1A 1E5RA 2ADEA 1JHNA 2R32A 2ZMKA 3LA2A 1ZZ8A 1NXMA 1Q8OA 3VL9A 1G9CA 3C7GA 3AB0A 1T6BX 4QXCA 3ZYFA 5IAVA 3CJIB 1FPN1 4N7UA 4I6TA 3BD1A 3TN92 4X6RB 2R071 4FXGB 2J1SA 1NEQA 2SLIA 1XWRA 2ZTNA 1PNGA 1ULDA 2A7AA 3ACHA 3JQWA 3TRBA 4XAEA 3OUJA 1GZTA 2R1JL 1JUIA 1A3KA 5EWSA 1CAVA 1BCXA 5FKBA 3O1VA 3WDTA 2MXDA 2OZJA 2VMIA 2A75A 3FUQA 3A9YA 1F5JA 3I2IA 3T2OA 3I2JA 4B3NA 1CZSA 1O8SA 3PVOA 1WETA 1FPN2 1RUNA 2UYAA 4CDWA 3IB3A 1HV0A 4COZA 5I8YA 1CAWA 1LOBA 2IZWA 5A7OA 3V65A 2D6OX 2E32A 1NCQB 1VPHA 4XUOA 3WOGA 4BIOA 1LB2A 3IAQA 1HQWA 1OQEA 4U36A 4NHXA 1K5MC 3AZYA 4BISA 1O59A 4Y5TA 5LBEA 4ZHNA 3TEPA 3K46A 1ZAYA 5GM0A 3ME5A 3MIBA 5A7NA 2OW4A 2CDPA 2E26A 2XCJA 2XHKA 2VBDA 1FV2A 2ORXA 4EROA 5CA6A 5C7GA 2ZGNA 1MEC1 3FHAA 1XC6A 2BBVA 1NY71 4RGGA 4M3CB 5JPMB 4JX0A 3RS6A 2AWIA 3JU9A 3POSA 4A6OA 1H6XA 4AK3A 5LK7B 5DAQA 3H3UA 3K4ZA 3VBUA 1SLLA 2XBO3 4LA3A 2D43A 4QX2A 4B29A 1FATA 4NIAA 2HWE3 2Q8CA 3AYAA 3WDWA 4QAWA 1I3HA 2VGDA 1TME2 1MVQA 3LDBA 3AKTA 4DUWA 2PXQA 1YCIA 3FHQA 2TNFA 3H42B 3ZHMA 4PU8A 5GKAC 1XB9A 1PX3A 2GZWA 2HLEA 2D40A 5FQ0B 4BQ4A 4ZPIA 3I97A 2I2SA 1LU1A 1UU5A 2Y6JA 3GZAA 5FPVA 1TG7A 2WZR1 1XNTA 1B35B 1R083 2OA2A 4NAMA 5CYYA 3C2UA 1WW6A 4W8JA 4BQ2A 2BPA2 1ZZ7A 1QWRA 5IK7A 4R4ZA 2XJPA 3OUIA 1QF3A 3I3EA 2DCKA 1W6QB 3D82A 1IC8A 1AR93 1ZZCA 2KA3A 3LDKA 4HN0A 4HONA 5C9AC 3ZXGA 3H1MA 3WG1A 3MHZA 3RDIA 3DYMA 3H1WA 5LEJA 1T2XA 2OFYA 3RPQA 3QH6A 5FK7A 1Q8SA 5GZGA 1NG0A 3PTYA 4ZZ5A 2J42A 2WBKA 5KXDA 1COV1 1RINA 4AFMA 1RMU3 1SDDB 4ASKA 1DIWA 2PUCA 1EYBA 2P5BA 3ALQA 4IEUA 1QXPA 2Z42A 5DDJ2 3D5OA 5FY7A 1ZUGA 4E2SA 4NIDA 1O5UA 2D6NA 1OPOA 1MS8A 4HKLA 5A7WB 1NE6A 4N43B 2YBPA 5F3GA 2VC9A 4FAGA 3UFDA 1XQNA 2VZPA 2JG8B 3IMNA 2R072 1VBA3 2YC2A 3BVCA 3JQXA 1BBT3 1ZBA1 4Q0PA 3ZKUA 4LO6B 4AW7A 5A3LA 5A3NA 1YJKA 3M1HA 1MQTC 3B94A 1W03A 5D8AB 5EJ3A 4NHLA 2C6SA 2QQMA 3RVHA 4EZ4A 1LMB3 5C6CA 3ZXKA 3LFIA 1HQLA 5FP9A 1GQPA 1H8VA 2HWD3 2NYYA 4Y1UA 4N9HA 4K40A 5LA2A 3WF2A 1AR71 1YJLA 5DXDA 1ZREA 1SFNA 2FMYA 4JQTA 4QPIA 4IEVA 2H0VA 3JBG3 3I49A 3ZX7A 5JWPA 3KJXA 1MS1A 4Z07A 1C5IA 2VNRA 2X10A 1UOBA 3MFCA 2PHFA 2QDRA 1S0IA 3JCIA 3KT1A 1W9SA 3I3BA 3SKJE 4DMIA 5KC5A 1ODNA 3MEJA 3DECA 3GJAA 4UYBA 1BXHA 1NLRA 4MCTA 3AYDA 4CUBA 1GMMA 4FXKB 5L73A 4DXRA 5K8SA 4L8QA 5AVAA 4IDZA 1ND3A 3WP3A 1RIOA 1EUTA 2ENRA 3HR9A 3IAPA 4GMP0 4YW5A 1W6NB 1VRH3 2E63A 2VUJA 3CNAA 3S57A 1ASJ3 2DVDA 1GNZA 4HETA 2XONA 3CF6E 4A3ZA 4KWUA 5KHHA 5K98B 4QXHA 3FJSA 2WNOA 5F6LB 3CLCA 3FLRA 4YG3A 3N4MA 3ABZA 5HCAA 2ZX1A 4FPJA 2QTWB 3VGIA 1A8DA 5GJ6A 1I1EA 3OBTA 3T2QA 2WRAA 5F9TA 3EUSA 1PO22 3WY6A 2K9ZA 2EICA 5LCWL 3CJXA 1QP4A 1LRHA 2W08A 3N9MA 2VW1A 3TNQA 2ARAA 1S0FA 2P17A 3U37A 2P4EA 1MR5A 4LIVA 2XVGA 3LB9A 1UY1A 5KC6A 4ES9A 2YPDA 3B00A 3PVBB 3AK0A 1NQJA 2VPVA 2R63A 4BQ1A 4YW4A 4ER3A 5T5LA 1ZA7A 1JOJA 3ENRA 1AXKA 3NNGA 4JGZA 1S2BA 2HYXA 4IVZA 1HXS2 4EN0A 1HDKA 5FZKA 4QPYA 2RS13 2D5HA 2VTXA 3VBOB 3E5XA 5D2AA 1KJLA 2PUGA 1V9U3 1SBEA 1H9WA 2VTFA 4DIQA 4Q4Y1 2VZ3A 4P9YA 3PMSA 3NJVA 3ZPXA 4R9BA 3GNEA 4LIUA 3WNLA 4IWRA 3OPWA 3BTAA 3UL2A 3IMMA 2QNKA 4QHOA 4QPGB 2GH8A 2CYFA 4XHXA 2RS33 5A3UA 1BQPA 1H1MA 5A3OA 2WYFA 5JSOA 1UXXX 1IHMA 1ZRFA 4A2UA 4RD7A 5EV7A 1AR81 4KG0A 3WW2A 3WNPA 1UWWA 1UY0A 4LO7A 4QKDA 4XUQA 1VBB2 3WNOA 3KS7A 2QQOA 1DGWX 1Z7S1 1YFXA 2RMU2 3RZMA 3OBRA 2G1MA 1X9PA 5DUUA 4Y33A 3RMXA 2KM2A 5IT6A 4BB3A 2FMDA 4AG4A 1RHI3 1OHFA 3G6JB 2NZ9A 2GC2A 2Z5WA 3MLFA 3RYKA 4CYDA 2PUBA 3MFAA 5LY1A 4AHYA 1W05A 5JUWA 1V6NA 1UXZA 1VAKA 1BDIA 5E6HA 2RVAA 2YV8A 1UYYA 3GZTB 4IQPA 1K5MA 4G9SB 4X4EA 4P00B 1O7FA 2EWTA 3E6BA 4DEVA 5HV0A 1MPXA 4E4SA 2E7AA 3G7DA 4K3UA 4EKGA 2HWD1 2W2IA 3K3NA 3IDBB 2BGPA 3LOIA 4NHYA 4P9GA 5ERLA 2BNOA 4UW4A 3NV1A 5FYIA 3UT0A 2TUNA 1OD5A 2JG8A 2XJSA 4FFGA 4YFWA 1B09A 3P3NA 2G9FA 3HQRA 4CP9A 4LBNA 3VBSA 1RUG2 3E5QA 2PXEA 2VMHA 4QU1A 3SCHA 4I8TA 1M4WA 3INAA 2DVFA 2XJUA 1CVNA 3O1TA 3AMHA 4CU7A 4C0BA 3K3OA 1US2A 1YRZA 4GH4A 3BDNA 4QPIB 2ZZJA 3J7MA 4B7EA 2XIUA 1V6KA 1Y7YA 5FY5A 3RZLA 2AXUA 1NLSA 1Y43B 2Q1MA 4JHZA 1HJFA 1H8TB 3M9LA 2C4XA 5FXXA 5J48A 3JXSA 5FKCA 4AWDA 2R073 1SBFA 2NMOA 3AKPA 2WN3A 3HQUA 3QLQA 4P9IA 4AFCA 3BS3A 4AI0A 2PUEA 5BNOA 2JKXA 2JG9B 3TEYA 4QQ2A 5D8AA 1PO11 4MZUA 4CCKA 5DMYA 1A6CA 1D4M2 5BNPC 5FYSA 1RUC3 1PGL2 3L2HA 3ZXDA 5EPAA 1L7QA 2VMGA 4FTBA 3DF0A 5LY2A 4X4BA 4XZUG 3B7HA 3C7OA 1RB8G 1VB2A 1FOD1 5C4WC 4RR3B 4Q26A 2Y6FA 4QQOA 1N47A 4H55A 1UW8A 4MXWA 1VBD1 1Q8PA 4Q1RA 2PXJA 4A3XA 1K5JA 4Z59A 4Q4Y2 2DWRA 2Y0OA 4GXLA 2W95A 1UD1A 2YMZA 3MUZ1 3WT3A 4XYXA 1GZWB 1S0CA 1RUOA 5FP7A 2AREA 4I3PA 2PTMA 3WCRA 1QQP1 1UYPA 2RR11 1RUJ1 3MO4A 4GMP1 5CKNA 2CDOA 4UI9L 4C1WA 2Y6GA 5C70A 2BJCA 3WUCA 2V72A 1VALA 4K9SA 5F39A 4M4PA 1NXD1 4I09A 4I6UA 2BNNA 3GM8A 4ZY9A 2GC3A 2A6WA 3V0BA 3BN6A 1I6XA 5FZMA 3ILRA 1UL9A 5ACA1 2DURA 5FXZA 2RS31 3POEA 4JKMA 4UT5A 4E4DX 3M2MA 1D0HA 4IXLA 1K42A 2P1BA 5C3SA 1QH6A 2H6CA 4E9KA 2E31A 3AX4A 4CTEA 1EUUA 1QDOA 2ZKLA 1RUI3 5DRYA 4FPGA 4X8NA 1ULEA 1K12A 5D21A 4NRMA 1YQCA 2J1VA 3UKNA 1J59A 5KHIA 3BODA 3JXDL 4H7LA 1IKQA 4FPFA 4AR2A 1OPMA 4Z5CA 1QJX1 2WLPA 4PJYA 5A7QA 4LO5B 5LATA 4IV3C 4CZSA 5KHJA 5HV4A 2D93A 2VOWA 1NW3A 4DEQA 4K7JA 1LOCA 4MLOA 5FXWA 3CHXA 3VBOA 2BV4A 4LBMA 4MOAA 1IQDC 4IEOA 3RYPA 2YFZA 3VZOA 3ELNA 4BDVB 1EY2A 1GOHA 2PXBA 4YGDA 1JTZX 5FPUA 2XI8A 4M00A 5T55A 1OA4A 4OI4A 3J26N 5FLJA 4J25A 3IDEA 4D6QA 1PGW1 4RS5C 1V9U2 3AMPA 1S4CA 3H50A 1QZXA 2D5VA 2GNMA 2NLRA 2W1SA 3T3YA 4FOVA 1O3TA 4GHJA 2CAVA 2L9LA 4YGBA 1G7YA 1NERA 1U2ZA 4RSUA 1DZTA 1EAH2 2MEV3 2WNVB 5SV8A 5JOYA 3LSDA 4OQ8A 5A33B 1E5SA 3I2HA 3APBA 2YHJA 4J6GA 5FMCA 2G9ZA 2EXHA 2Z4FA 3AZZA 2YYOA 1C28A 1Y9QA 2ADDA 2BFUL 2ET7A 3BU7A 5FYTA 1QIQA 1LHVA 2AEYA 3N9QA 3LWCA 2RG4A 3AP5A 5FY0A 1Q3EA 3UKTA 4D8MA 4BU2A 2VUCA 4XCBA 4DNYA 1LU2A 3O1MA 3VKNA 4AXOA 1YYNA 4Q2JA 2JE9A 4IW3A 4C91A 4WM7C 4U2AA 3I3DA 2JB4A 1IG3A 3NL1A 3O7OA 5F1RA 3AKQA 1C57A 3N7LA 1DULA 3QCWA 1AYM1 3RWNA 1W8HA 2YZ4A 3WQ7A 2JG9C 1QY4A 2RM21 4K8FA 5C33A 4L2NA 3H3ZA 1IPJA 3SX0A 4Y1XA 1S7EA 2JKBA 3VHPA 2O14A 2VULA 4MUVA 5CNAA 5FYCA 1BJQA 4JCXA 3ASIA 1UQXA 1JYIA 2B8MA 5FZ0A 2Y38A 3AC0A 5B4XA 1RMU1 1CESA 3LE0A 4PQ9A 4A42A 3H9AA 3WP4A 1K45A 1SMVA 4XABA 4ZKTB 4QT6A 5C5UA 4BA6A 1UOJA 3S5AA 3AZWA 3SEPA 1D7PM 3F51A 1GQHA 2OQ6A 4V2WA 4FFHA 5F7UA 4AE2A 2O38A 4GB31 3VDBA 1LOFC 3DL3A 2XLGA 4L99A 1UMHA 2I74A 4OHZA 4CDWC 3B9CA 4OHWA 3S7EA 3ZFGA 5FLHA 5ABJC 3QQ6A 5JMCA 2DVAA 5FP3A 4LR4A 3PVNA 3OSDA 4OHYA 3P5BA 1Y7BA 1V6JA 4UF0A 2XL7A 4FBFA 3GXUA 1C5HA 3X29B 2ZS6B 3I2KA 2BBAA 1G9AA 3MIEA 3KQ4B 4DOUA 1QJU2 3FYMA 1CAUB 1WCDJ 1YXWA 1S0GA 2I07B 2WQ8A 3B3QE 3VD4A 1DF0A 2Q1ZB 4XUTA 4M01A 2YBKA 2Q30A 4LTAA 1KD7A 1CPNA 4Q4Y3 4PF1A 2FDHA 2YDEA 4E2GA 1W39A 4JVAA 1JUHA 4AVAA 4ARXA 4XC9A 4C0HA 4YG6A 4XETA 2GSYA 3IBMA 4INDA 4YZ4A 1QJX3 4JAAA 5CEHA 2W1UA 1MFQC 1DQ5A 3H0OA 5BPXA 2L49A 1JZ4A 3AJZA 3IKWA 4H3WA 4UFKA 2J22A 3VBFA 5FPXA 3ACGA 4XJ8A 2VW0A 5T3NA 3D0SA 4MHRA 3THDA 3QOXA 3O12A 5DPNA 1ND3B 4M3CF 4E2QA 2R30A 1R63A 2ZX2A 3ITQA 3A9ZA 2HWF3 2CAUA 4CPBD 3KHCA 1OLQA 1J84A 4Q4W1 1JH5A 4AGGA 1BLZA 5DABA 3HN3A 1TE1B 2GN7A 5A33A 3TYJA 4BCUA 4CEYC 4ZU7A 5C71A 5GLWA 4CSWA 5AFBA 2VR4A 1TZOA 5F32A 2GU9A 3OF1A 5F37A 3THPA 1IS3A 1OC1A 1LCCA 3EB7A 2D5FA 1UYZA 2JDNA 2GC1A 4NOTA 2OUJA 3AM2A 3TFLA 1VBB3 1W8FA 2DBNA 2E33A 4Y4YA 4Z2AA 1YIFA 1V6LA 1POV1 1JZ6A 2LROA 2ZBJA 3KV9A 4JCKA 4QMAA 4AQ6A 4PU3C 4CCMA 5H9SA 1WCKA 2RS51 2DF7A 3OWQA 5FLIA 5FP8A 4K8RB 4LUKA 3ZVXA 1TNRA 4UFLA 3O1RA 4CDXC 4HSLA 1IS4A 5DTQA 1N3QA 4NWWA 5H9PA 4EKIA 1GWKA 4I2OA 1QH7A 1UKGA 1YFYA 2GC0A 2PLV3 3ZSJA 1L1MA 1PERL 2OZ6A 4HVQA 5DTRA 1BYHA 1DYKA 1XYPA 4XILA 4IGPA 3ZN6B 4COWA 2LYSA 4XF4A 5A7PA 3T0BA 2Y8KA 1R082 4WZCA 2WT1A 4AEDC 1OMIA 3OD0A 4EWDA 2W3JA 2B7YA 4XXAA 5FRAA 1OLMA 1OA2A 2BU9A 1ND2B 3NO8A 1RUG3 2PHTA 2RMU3 4QQHA 4Y20B 3QFIA 1E57A 5FZ3A 3T4VA 3C3VA 1EPWA 3UGHA 3M8LA 3LIGA 4HPKA 2LNMA 5FZ7A 3VZKA 5A1LA 1ZVVA 2OX0A 1VBC2 4NUBA 3GZEA 2FHRA 1DGRA 1OQ1A 3HN1A 4YYOA 2RS11 4TLGA 4XJ9A 1SZBA 5FZEA 3G5GA 1IKPA 5A32B 5I93A 4Z8BA 3RZJA 4IE7A 2LUWA 3IZOA 5FV3A 3ZYJB 2PAKA 1REDA 2ILMA 1Q8QA 2V4AA 5D1IA 2WWSA 5I0SA 3M4FA 4PIZA 3OGSA 1RUC1 2J7MA 2YG0A 2WZEA 1F9KA 3U75A 1GICA 1V70A 4AL9A 1ZZ6A 1F4AA 1H2NA 1NA1B 2RMU1 4TYSA 4YM2A 3U14A 3ZN4A 5IK4A 1OSGA 4OMDA 1SACA 1Y4WA 2PHXA 2EIEA 4FI9A 4RGAA 4Y1YA 3RZKA 5FO9B 1XYNA 4AI2A 2XQRA 4ISRA 4PI2A 3FFQA 2CSFA 3LEIA 4KWJA 5K9YA 1VLNA 4OFGA 2JDUA 3ECQA 1YQ6A 2VVFA 2YGMA 1GZCA 1NZCA 2YUEA 1C8M1 4JQRA 2Z79A 3WF0A 4PDWA 5C9AB 5I0RA 2D6PA 2C24A 3MPBA 4GZ9A 2WT0A 2BQPA 4CCOA 1OXCA 2AUWA 2XUEA 2JXAA 4LBQA 1ULPA 2FD8A 1S0BA 4QX0A 3NAPA 5J96B 4BJ0A 3LIHA 2PXPA 2PYTA 3O0WA 1H6YA 4HVOA 5HCHA 5CKMA 4LA2A 4RHV3 3OD4A 4AFBA 1CAVB 4E4ZA 4XFGA 1H0BA 1JOBA 1W2TA 1W8ZA 1H1IA 2ODRD 1PZ9A 4OHVA 4PCRA 2IVQA 1V00A 4RYDA 3WG3A 5IYYA 2B42B 2VZQA 3QBQA 2PXVA 1VR3A 1JYWA 4AGVA 2RE9A 3F2ZA 4IUGA 5DZEA 3BOPA 1ALYA 1WMFA 2JG9A 3RSJA 2W1WA 3VB9A 1CAWB 1XNCA 3NMBA 3NDBB 2ORZA 2OYZA 1CQ9A 2WA3A 2WKKA 3KVBA 1O6UA 1Q8VA 1DQ2A 5K0UB 4OMCA 1BEV2 3KV6A 2JIGA 2IV1A 2VZSA 1NCQC 2ZAAA 3IT8A 4LKDA 3AXEA 2D3PA 2KPJA 2VZUA 5DN2A 2R16A 5FMDA 1HW5A 1LHUA 1YQ8A 1SCSA 2J1AA 4HFSA 4XUNA 5FY9A 2X5IA 4QPIC 5AC92 5FUPA 1D4M1 4LHKA 1QU0A 4KI5M 3NNJA 2FZ2A 2LYKA 3U4SA 4LQRA 3FN9A 5BY5A 3AJYA 1JZ5A 1UXDA 1W0OA 3MIGA 3DXUA 3Q8BA 3AVRA 3O14A 5FZ1A 3T1MA 4NN0A 4IV1C 1N1YA 2MPFA 4WVMB 3N7KA 5FCCA 4AQSA 4XMIA 4XZPA 2XMLA 3VHOA 2R6QA 3LDRA 5JLVA 3AVSA 4M3CA 3WF1A 3OQOA 5L7OC 1X8EA 3RZZA 3MYXA 2YGLA 3LZZA 4FPCA 2OXBA 1US3A 4MHUA 4JKLA 2PHRA 5FBZA 3ZR5A 1C8NA 5JI9A 3KL4A 1DBNA 3NW4A 4WBBA 3M3QA 3WW1A 4CEWB 1OCTC 4MO3M 1F2NA 4Y5Z0 1W6QA 2EF8A 4X4DA 4YRDA 2LM3A 4A7ZA 1PRVA 3WNKA 2B39A 1W6MA 2W68A 1POV0 2JE8A 2ZACA 3ZN6A 1KXGA 2WAOA 1CGPA 1BK1A 2HWC3 2JD4A 1FYUA 1LHOA 5APAA 5JSRA 4HN1A 2EXJA 4AVVA 2RM23 4X4IA 4FPEA 1JMUB 5JZGC 1CX4A 3N9OA 5CKQA 3MIFA 2X8KA 3N36A 3GZDC 1CQTA 1S0EA 1G86A 5JIUA 1OQDA 4OI0A 2QDNA 3VDDC 5LWBA 1QNWA 2ZHLA 3FBMA 4Z58A 4PDWC 5A1AA 3MLLA 2WC2A 2XBO1 3AP4A 3IWZA 3MZHA 4TTGA 2WL1A 1TEIA 4R8HA 1HB1A 1NCRB 1SDWA 2R7EB 3TBDA 2ICTA 4LORA 2Z2SB 3WCSA 2WAAA 2QBXA 4PI0A 4YW1A 5DAWA 5FIXA 5CZKA 2GH2A 4XFBA 3EYPA 1D2SA 4QKBA 3ME2A 3WDVA 4X4CA 3VKMA 1ULOA 2ID4A 3UGFA 2A6VA 4H2AA 2IWGB 3KZ4C 4D94A 5L19A 1NYWA 4XCAA 1C1LA 2DDUA 4IE4A 5ANNA 1YI9A 5C8CB 4KU7A 4CE8A 1HIXA 1AR92 1DZQA 2GMPA 1LQCA 2HEWF 5A7SA 4BOWA 4BQXA 1U5IA 2BOIA 2LYPA 3WNMA 3KGZA 3BUCA 4V1PA 4LHLA 3SKVA 1PNRA 1W3VA 4CDXA 1LJ7A 1RXFA 2BWAA 2B5AA 2XDVA 1RTVA 1MACA 1RITA 1WUVA 2VOTA 3HOBA 4QDQA 2FFHA 3ON7A 4W4ZA 3RFRA 3ZSEA 3VN4A 3UJOA 4ER0A 1JH9A 1ZA4A 1XU2A 2P3IA 2YXSA 3KLSA 4GAZA 3J4UH 4JDMA 3A0KA 2HEYF 4ISQA 2DFBA 2HBTA 2FCVA 4Z5DA 2I45A 2WR9A 3DGTA 2AXVA 4LBLA 3CKHA 1L3JA 4WVLA 2XWJB 5FZ4A 3HNMA 4FBIA 4KMQA 3VKLA 2HKXA 1FPN3 2ZXQA 1QQP3 2RR13 2VZTA 3C7FA 5F3IA 1TMF3 5FMBA 1ENXA 3E6DA 4CDQC 4CEYB 3VBHA 4EZIA 3GZCA 3P3PA 4JTNA 2R0FA 1DWKA 1CPMA 4CXXA 1CONA 4XQDA 4OQ9A 2VOXA 1TQ5A 2EBYA 3E1F1 3VL8A 3S0MA 1KGYA 1UAIA 2GAUA 1DW9A 3CROL 2XQXA 3FMGA 4BLJA 5AC93 3DN7A 4UAPA 1FNYA 2EAAA 3EQEA 1F15A 4N90A 4F8AA 1OF3A 1PO12 2Y6LA 4LLOA 1MZFA 3K75B 2VEOA 4YW7A 4YVSB 1NAEA 1AL21 5A6ZA 2AW6A 4D6RA 3D4KA 3OBAA 3UJQA 2GALA 3OQNA 1CIYA 1SQ4A 4JTOA 5C8WA 1POUA 2CROA 2BVVA 5H9RA 2WDBA 5CG8A 4TLFA 4ASMB 2DCZA 4FPOB 5FAXA 3ZXLA 1MEC2 1W6PB 2VJXA 3J7HA 4JRAA 3NNMA 4K1YA 3CJIC 4CCCA 4S2FA 4NPMA 2K46A 2H0BA 1KS4A 3AL6A 3ZFGB 1ACCA 4UOJA 4YLZA 1WMXA 1AZDA 3RMYA 2VG9A 1XNKA 2YB7A 3DPRA 1AL22 2D44A 5LA9A 1TME1 4RHV1 4LT5A 3LEGA 1RUH2 2XWBB 2JX9A 3BI3A 2XSDC 3MGUA 2ARBA 2Y64A 2V4VA 1N3OA 5A1FA 1WLTA 1Y9MA 1WCUA 3TRSB 1JW6A 2X29A 4C8DA 4FPKA 1H4GA 4N7IA 2HWC1 3ORJA 4JGZB 2QZ2A 1AF9A 2VVDA 5FWJA 1VBE1 1OURA 1LOEA 4GQ7A 3B5LB 2AH2A 3PMEA 5EYXA 3QH7A 5DSXA 3I3QA 3VD5A 3ST7A 2J1EA 4GD4A 4CP2A 2XXAA 4IA8A 2FDIA 2DCJA 3U11A 1AYM2 2J7UA 1OOPB 1UIKA 4JV4A 2GMMA 3BOWA 1COV3 4MV2A 2HEVF 4UWDA 5JVVA 3AKSA 4RQPA 1AXZA 4KBZA 2R063 2JD9A 1H2LA 1RUD2 4XF1A 3OGVA 5KR7A 3JBG2 5FJHA 4GJYA 1JS9A 2WSVA 4MGSA 2ZGUA 1D4VB 4MX3A 2VMCA 3AP6A 2NP0A 5F5QA 2FDKA 1LCDA 1O4ZA 2NQYA 2Q4SA 3LPGA 3C7HA 3NSTA 3K4AA 3BYWA 1L7RA 1PNFA 1CWPA 2CGPA 1Z0HA 4AI9A 5SV5A 1U5YA 3M7AA 4YGEA 1R1A1 3A23A 4LNVA 1DQ0A 1ENQA 2XB6C 3I4IA 1YSEA 1EV13 3VBSB 1F31A 5C3OA 3KT4A 1A8MA 5C8CC 1ODMA 3DCQA 3PU3A 1QP7A 4AI3A 5JOWA 4IV3A 1LULA 4CDQA 3BPZA 3O1PA 3B69A 1O4XA 2VMDA 5DUVA 3VBOC 4GH4C 2W52A 4YARA 3N3HA 1QJU1 3AKRA 2FZ1A 2B46X 2PAMA 1H8TA 2EVXA 1DU3D 3B9IA 3I8TA 3LSEA 3PU8A 3WF4A 1C8M2 4P5YA 4ET7A 4OLLA 1IOAA 4B4PA 2AENA 4W6WA 2WNVC 4Q0QA 2P37A 2IU7A 3AMNA 4RGKA 3ZXEA 4CCNA 5D8AC 1OT5A 4YW2A 5FPAA 5M0TA 1QDCA 1AR62 1MS9A 3L2YA 4YVWA 4YPJA 5EJ1B 3WF3A 4EQVA 4CA9A 5G05L 1JYCA 4RS5B 1FT9A 4YG1A 5HCFA 4YM1A 4W65A 2GNBA 4YBAA 4RR3A 2FDFA 2JECA 1G8WA 1X9TA 4E27A 2NN8A 4NAOA 3KB5A 2OR1L 3DKQA 1CAXB 1QQBA 3R4DB 5FP4A 1UPSA 5LASA 2Q8OA 3VBHB 3BTZA 4I6RA 5BNOB 3SH5A 3WQBA 1REFA 2WFF1 3O0VA 3EXUA 1W3XA 1KDMA 2JJ6A 3TEXA 3LCPA 1UF2C 4O8BA 3VD9A 4JKKA 4QM9A 3SQOA 1W2NA 2VVEA 5E89A 5EZWA 1BEV1 1MS3A 3NZLA 2BP6A 3E97A 3LA7A 3MICA 4I02A 2HWF2 4HSJA 1S0JA 5JIAA 3SEEA 2A6XA 3KXAA 1CJPA 4XQWA 5EJZB 2JB8A 1UY2A 4AGRA 5L7OB 2Y34A 1BMV2 3DNVB 2WZPP 1YFWA 4Y3OA 2ZGPA 1WH8A 2KD7A 4M0HA 5FZAA 2D3RA 2XLAA 2L8NA 3PIJA 3FHIB 3OEBA 1W2UA 4HL0A 1GQGA 2BTVC 3V0BB 2VNOA 4OVEA 2OQ7A 5DTMA 2WFF3 1HJGA 1O4YA 1QP0A 2RDRA 2A6ZA 2CGNA 2ZX4A 5F5IA 3ZXJA 2A6CA 1OH4A 4AAPA 5CFDB 2QZ3A 2ZZQA 3D8CA 3ES1A 4I0AA 3T30A 3GHMA 3LKJA 4I0WB 3OGJA 2C1FA 5FREA 4WV8A 3UYJA 1HV1A 5J3UA 3J7NA 5A70A 2WWUA 1J3QA 1FAYA 2ZGLA 3IDCB 3PDQA 3K77A 5JI7A 3SITA 3WVJA 1JU3A 3ZN5A 1H9PA 4DXSA 3TEWA 2VH9A 3QYXA 3T4HB 4QU2A 2A71A 2O8OA 1UZVA 4WVZA 4MXVA 3BTXA 3CBNA 2BERA 1ZPQA 3KF3A 4Y1ZA 3I2DA 4CUCA 3H1YA 5KWRA 3I2FA 1REEA 5FFOC 1CJDA 1QQAA 1RUD3 4NHMA 5CB7A 4UFJA 1YUDA 4KH9A 3F6WA 3U0ZA 2CY6A 3VBUB 1RZRD 2QQJA 4XTMA 3GCWA 1NZIA 3KT7A 5FZIA 4AEDA 2C5DA 1SPPA 2NMNA 4XFFA 3UNPA 1E3OC 3ES4A 4TWTA 1J83A 3EJKA 4QKFA 4CRQA 1VRBA 4N8MA 4TSVA 3U1XA 1X7NA 1JZ3A 1X33A 1WKYA 4ER7A 1UMIA 2B9UA 3AP7A 3CO2A 5E88A 5I0UA 1R1A3 5C4WB 5JXJA 1OVPA 5DZGA 1WBLA 2VNGA 4ES8A 4EN7B 2BW8A 1W90A 5K7PA 2PIJA 1UZWA 4AAXA 1WZXA 4EN9B 4LPLA 1ASJ1 2FQPA 4BK5A 3T09A 4QM8A 4XE9A 3OJBA 1F8VA 5JXGA 2R1DA 3GF6A 4YSFA 1OOPA 1VE0A 4L11A 1RUF2 3WQ0A 1IPKA 5F2WA 4YG7B 2XKOA 5B4NA 5C3QA 2Q1FA 1PZ8A 3JB8A 3R6SA 3LAGA 3P6BA 2X53S 1AYM3 3J8F1 3KCYA 4KL1A 4YVSC 1XU1A 2ZAHA 4BMEA 5DG2A 1AL0G 1BBT1 3MIHA 4JCYA 4SLIA 2KEJA 4ZS2A 3FFZA 4XXPA 2XJ3A 3A21A 1XPWA 4FT8A 3CIHA 2QQPA 2ZEYA 1XJAA 1BK0A 3IVPA 5DDJ1 4UFIA 4LJHA 1UY3A 3WDUA 2B45X 2GZUA 2LLWA 2ARCA 4LBJA 3LEMA 4LOTA 4MGYE 3ZFEA 3NAPC 1SEFA 5FYHA 3SMHA 3V56A 3H8OA 2VOKA 5LW9A 4LE4A 1DGWA 5CG9A 1V6MA 4RHV2 1JZ8A 2VAUA 4XW3A 3J8F3 3ZYBA 1UO9A 2XXZA 5IUQA 5IFTA 3L9JT 1E5HA 4YNIA 1HQNA 1SBDA 4RL7A 4XACA 5HI0A 2VUDA 3DYPA 3JXCL 1TMF1 3A7QA 3KMHA 2E53A 1UIJA 4FVVA 3WHTA 1VBC3 3FLPA 3ZOIA 4X4GA 3ZYRA 4DY3A 1ZRDA 1CAXA 4KGQA 4Q8LA 1J1TA 3M3IA 2HWB2 4OYUA 3OYWA 2F6BA 3ZYGA 3SH4A 3ZFGC 5ABJA 5AC91 2CWSA 5KXEA 1DHKB 4Q8KA 1FMD3 4XUPA 2WFF2 4OUMA 1KJRA 2VQUA 3OY8A 2O49A 1WLDA 1GP4A 3K51A 4OZXA 3SCFA 3Q8AA 4UBGA 2GNDA 3KZ3A 5DAVA 2E51A 4AEJA 2P6CA 1JFSA 4N9IA 4ZXKA 2X5IC 4JGYB 5C8CA 3FYAA 1POQA 5C3PA 4BH9A 3JD71 3PJYA 2RJ2A 4IEWA 4FAHA 2Y6HA 2DYCA 4RA0A 4IEXA 5F3EA 3OMTA 2EALA 2MEV1 4NPRA 2BYVE 2Y33A 3T0AA 3WEZA 4DZGA 2VUAA 2B4KA 2D7FA 5A3MA 3U78A 3FUOA 1UOFA 2IFRA 3CQOA 3KSCA 1PM4A 1F5FA 4QGNA 2LYQA 4A7YA 5ISLA 4KWKA 5FOJB 4QGLA 1O4TA 3KHBA 3N9PA 3NV2A 4OCTA 1W8UA 2OKXA 2Q8DA 5BUVA 2FJRA 4Q5OA 5L7OA 2ES3A 3M3EA 2PUFA 5FZFA 1JYXA 1NA1C 2D6KA 2VCBA 1XSRA 2YU2A 4GWIA 4CEWC 3FL7A 1QJZA 4QHBA 4WZFA 3VD7A 4CXYA 5T5OA 5LBFA 2JVLA 1GV9A 2OS2A 1QGLA 2HCSA 1XNAA 2PMWB 2QFEA 4G4FA 1OF4A 2VL4A 1GT0C 1XE8A 4FCAA 1HRI1 1UZ0A 2HBUA 3CZUA 4LULA 4QXBA 3RWKX 2BWCA 2RJKA 3D6EA 4YG0A 2Y6KA 2BNMA 2WO3A 4OBMA 4LITA 1JYVA 4DB5A 4QB1A 4FTEA 2WWJA 4ER6A 1JU4A 2W87A 3KQRA 4K21A 1ZM1A 4NROA 4Q4X1 4X6QB 5GLTA 4NIIA 5JZGA 3UV9A 1KFXL 3JUUA 2YU1A 1FXZA 1UX7A 4HK9A 3S7IA 3KCCA 4HBNA 1OSLA 3ZSKA 5ACA2 2PUDA 4CCJA 3KVAA 4LK6A 3A0NA 4EE2A 5J1XA 1EV11 2PPXA 1DG6A 3ZXFA 1IZ3A 1AR91 3I59A 4Q27A 3MV11 1GANA 1HRI3 1MZ6A 4XJUA 2ZHKA 2MHFA 3HBZA 2HINA 3WQ1A 1XBFA 1SLBA 3M3OA 1AJOA 2UWCA 3WR0A 1O3QA 1GLHA 4IGQA 2PHUA 3NJXA 5K0UC 1VMHA 1U5XA 2FCTA 3H8UA 2PHWA 3VDAA 5DUXA 4BIFA 4CDUB 4ORFA 1RUJ3 4GMP3 4ZS3A 2SBAA 1RVF3 2R1BA 3AXDA 1K5MB 4BQ5A 1NX9A 4B1MA 2D98A 1SHWB 1XXNA 2AEZA 1JBCA 1N3PA 2UURA 5CFCC 4F8DA 4MADA 3UESA 4EN8B 2VMEA 5FPBA 4YGCA 1ND2C 4XFHA 1GKBA 1YLLA 2BVBA 4HT1T 1U0AA 3OTFA 5FY1A 1IPSA 3FWEA 1AX0A 1C4RA 4IV1A 2D3SA 1RIRA 4YZ3A 2EXKA 2M4HA 5EXOA 3M3CA 1P8JA 3RG0A 4B7KA 1XE0A 2XH6A 1VBD2 4H14A 4EV0A 4XFAA 2F4PA 3DM5A 2IVIB 2Q0AA 2R49A 3T0DA 1ZX5A 4DE8A 2R061 4Y20A 1EAH3 2MEV2 2VQAA 1NKGA 1UX6A 1W9FA 2XKPA 5LZ6A 3PXPA 3AMQA 2PHLA 1RHI2 3VBRC 5J09A 1R093 3ZIXA 3VBRB 2X09A 2W91A 3U10A 1DYPA 2YFUA 3EO6A 1YWKA 1PMHX 3TOJA 3VHRA 2PLV1 2CV6A 2YC4A 5H9QA 4XJWA 4X4FA 1O5LA 4GB33 1LHWA 4YG4A 2OPWA 1Q43A 4YFZA 1OI6A 5IVCA 4FOWA 5FQ0A 1ZRRA 1BEV3 4XJZA 5FOBB 1W9YA 1WCSA 3HMYA 4AVTA 3R05A 3N35A 3POFA 4MGIE 2XPJA 1PK6B 1PVC3 1QOSA 2H8RA 3ZMNA 3DV8A 1R091 1X2LA 4ONUA 5C5TA 3PUHA 1DCSA 1PX4A 3HQXA 3AZVA 4Q4V1 5T54A 1LKNA 5IW0A 3O1OA 5FMOS 5BNPB 1WD4A 4OULA 3WXPA 5GZCA 2VM9A 1AX1A 1W8OA 3B01A 3NROA 4EK9A 4NR1A 3VDDA 4UXAA 3MV01 2WQZC 4GIQA 3ZHIA 1VBE2 4LBQB 4Y22B 2AYHA 2IXKA 3KD4A 3RZGA 3CDZB 3ACFA 1X57A 3LFMA 3OY8B 3ZFEC 3MW3A 2XJVA 2CHHA 1EPZA 4BK4A 4GJZA 2A1XA 2DBIA 5CAZA 4MXWB 3TELA 3GZUC 2VCAA 2JDMA 1OFSA 4GB32 4R4XA 5A7WA 2F4LA 3URFA 5FO8B 5BNNC 3UKVA 3MBWA 1U12A 4QX8A 2GMEA 3T2TA 1UPIA 4O9EA 1KEXA 3LOBA 4BPZA 1F4HA 1RUD1 2ZGSA 4JRLA 1ADRA 4LKEA 5FYVA 1IS6A 3W5NA 3OEAA 1X36A 4S2HA 1JI6A 4HOOA 4P02B 5K0UA 4CP0A 3R1FA 1KQRA 4M3CE 1AJKA 1JODA 4RQPC 5IVEA 1M06G 2B9VA 3EHKA 2ZEXA 4WVMA 1UMZA 1B0NA 3NAPB 1JYNA 1UOGA 2Y0IA 1QXRA 1S2EA 4LOSA 1VMFA 2JENA 1RJ8A 4A41A 1LOFA 5CFCA 2K0GA 2CWMA 5JAXA 1W99A 4PIYA 3ROUA 2RDSA 1PMIA 1POV3 1WGPA 4Q29A 3FMYA 3TEZA 4XBLA 1HB3A 3PL0A 4MVTA 1WA6X 2B5HA 3VBHC 1S0DA 2J1RA 5A7LA 3ILFA 1QJX2 2WLQA 4TZDA 3I59B 1BMV1 2PE5A 4WVWA 5CFDA 2LTNA 2P34A 5FYBA 1AX2A 3BIWE 3EBRA 4UW5A 5FYMA 3ZO0B 2AZ5A 1YC61 3OBZA 4FQ4A 5TSWA 1L7LA 1OUXA 2WINB 1SLTA 2DU1A 3MDPA 2VZ1A 4FPYA 3GUUA 2PLV2 4HANA 1KS5A 3ZYHA 4NJ4A 2OT7A 4WM7B 2FBEA 3POJA 4OUEA 5FZOB 3NNLA 2HWC2 2X5IB 4JGYC 3HNYM 4CEWA 3LGRA 2WNVA 3S6PA 2QE3A 3DPRC 4HG6B 4M0NA 2IUWA 3LQCA 3TN91 3USSA 4L0PA 3NWKA 4IV1B 3RZHA 2WUSR 5FK8A 4QDSA 2E6VA 2V73A 3OQMA 1SPPB 3PUAA 3O1UA 2IVGA 2PA7A 1WW5A 2JICA 3ZFFB 3I2OA 5IAXA 5E8AA 5C4WA 3VHNA 5KBFA 3POBA 1BVP1 4JGZC 1XSQA 2ICPA 1URXA 4PBPA 3F52A 2WZR2 3PUQA 4LXLA 3Q8FA 3PUSA 1FMD1 3SISA 3MEPA 4FP2A 1A34A 1OLME 4XDQA 1VP6A 4PF5A 1NCRA 4A7KA 3KM5A 2TBVA 4D7YA 2W46A 5IK8A 2KEIA 1ZBE1 4MH0E 1W6OA 2A70A 1XE7A 3JZVA 4XMAA 3WDYA 1MZEA 2WNUB 2XXQA 2DTWA 4AHZA 1AXYA 3ZR6A 1GOFA 2PXDA 4Y5SA 3MIDA 2W1QA 4P08A 4XHBA 3VD3A 1OH3A 3HT1A 4OI2A 2O1QA 5I0TA 2WO7A 4PBOA 5IVFA 4P9JA 3Q9OA 4DINB 2ZGQA 2JDHA 3NJYA 2WS91 4CVUA 4QXKA 4XFCA 4QQLA 3WUDA 4L97A 4YZ2A 4MGTA 4AZZA 1WA4A 2N7GA 3LD8A 4J1WA 1V6IA 2YC0A 3K48A 2C9AA 2Z69A 4OI1A 4D69A 3UWPA 1ZBE3 1GZ9A 2ZOEB 5C3RA 2P3YA 2Y26A 1ZYBA 2CL2A 2ZHMA 4KQ7A 4PT6A 4XQ4A 4ZXEA 4DS0A 4S2DA 1X8MA 3K4DA 3VZJA 2HSGA 1ND3C 3IPVA 1G9FA 2LYLA 5IVYA 5I8TA 2V09A 4GH4B 2D6MA 1E5IA 2V3CC 2IUOA 3ACLA 2WS92 2WIUB 2J1UA 5GZEA 2WSUA 1AHSA 5FYZA 2QJVA 5B2GB 1Y9GA 3VBSC 3CJIA 1OUSA 1UU6A 2LLVA 3BALA 4JDOA 4LEJA 4M4RA 2O4AA 1RYYA 4R52A 4XBQA 4META 5CVRA 1DGRN 5FZBA 4CU6A 3AFGA 5KXCA 4BE3A 1UYXA 3GYDA 3VBFB 1LOAA 3QD6A 5BV6A 5IHRA 2DVGA 4OHXA 2EIGA 1VBE3 1UXCA 4DO0A 4IESA 3VKOA 2QQIA 4Z2WA 4XF9A 5FUIA 2OIIA 3I54A 1YFUA 2BRTA 4D7TA 2XG3A 2A5ZA 1PM7A 5CFCB 4JGYA 3BIEA 4FSJA 2A3XA 5A6QA 2GNTA 4NPLA 3WINE 4Z5HA 4CEYA 2XL9A 4I01A 3D1NI 4RR3C 5FZ8A 4YZ5A 2JDYA 4FO9A 2PELA 2WIIB 1RUH1 1VBA1 2XR4A 1GZWA 2EIBA 4QKNA 4CPBA 5KHGA 1FI2A 2PAEA 3R0RA 4HXCA 4YZ1A 2ATFA 1JHJA 4EWEA 5I91A 3AP9A 1NY72 1VIWB 2AUYA 2E7TA 1NQDA 4YW6A 3UETA 4YVSA 2NM1A 1LNSA 3MLJA 5HPOA 3B02A 3I3MA 3NJZA 4HLTA 4GULA 3ZFFC 1MS4A 2CU5A 3NQHA 1AYN1 5FZLA 1QKQA 3USUA 1WCQA 1UZYA 3D3AA 2BFUS 4XURA 2YBSA 4Z82A 1R092 1RUJ2 3NV3A 3PURA 4IEZA 2GN3A 1WD3A 4XAAA 2PQSA 1XOYA 2P6HA
chains in the Genus database with same CATH topology
1ZVFA 3FE5A 3QF3A 4LBKA 4KU8A 4ATEA 2W0XA 1IS5A 1NCQA 3S30A 3TWIA 5LRRA 2ZMNA 4CP1A 2XJTA 3FC0A 3W58A 4DQAA 1ENRA 3ZIWA 3J9SA 1VRH1 4N53A 2VU9A 2DV9A 1LGBA 2R041 1LHNA 1HF0A 1CJGA 4XF3A 2GRMA 4XJAA 3ILNA 1RVF2 1LEMA 4NO4A 4OB4A 1PO21 4AQ2A 2HJIA 2DU0A 1VBC1 5A32A 3SH3A 2JG8C 3MF9A 3GHNA 3ZDSA 4X4HA 1CR7A 4AHXA 1APNA 4KBBA 1WW7A 1OFNA 4YVWC 1VRH2 1RUI2 3ZXAC 4CDUA 5L36A 4Y42A 1S2KA 2ZHNA 1ZBE2 3RRDA 1WBFA 4DXZA 4LUMA 1XNBA 4Q0SA 2RHPA 5BXXA 1J58A 4QX5A 1S1AA 1PVC1 4PU4C 1KITA 1OOPC 4GALA 2ZGOA 2O8QA 2ZGMA 4UW6A 1SLIA 4NHKA 3SNMA 1V9U1 2PUAA 4DRVA 1W6OB 4DRRA 5GLZA 5JCTA 1PVXA 2HWE2 4GKXA 4Z1VA 1NA1A 1EAH1 1QJY2 1U5ZA 4RFT0 3WG4A 3FZ3A 3GBFA 4P9XA 2H6BA 1HLCA 1QJU3 1DZRA 1W0PA 2V5YA 2WZR3 4WM8B 5C9AA 1R1ZA 4ITCA 2YROA 1LODA 1GR3A 2WFPA 3IM0A 2OUHA 1SLCA 3W59A 2RJLA 2EAKA 3N7MA 1KFUL 3B7MA 1PGL1 5HCBA 2MQKA 1D4M3 2DTYA 2YY1A 5JOXA 4UW3A 1FOD2 2AR6A 4IL7A 4PLMA 4N43A 5AFEA 5CIRA 4F3JA 1PZ7A 1C1FA 4IEPA 1VPWA 4ZU4A 5JDBA 3WX5A 2DCYA 4L92A 3VV1A 1CD3G 4KNCA 1ZZ9A 1AU7A 2RS12 3WDXA 1G9BA 3RNSA 1DLLA 4QQPA 4EN6B 4Y22A 3WW4A 2ZCWA 2DVBA 4GWNA 3V0AB 1SQ8A 2WNEA 2P3JA 1RUE1 1KRIA 4BWOA 2WNUC 2RS53 3H7JA 2HWB3 2ET1A 1MS5A 1N1TA 4GWMA 5BNQA 2QUOA 5T5JA 1OLRA 1Q56A 2VOVA 1O91A 4H7MA 1C3HA 2A73B 1YIPA 4DY5A 2RS32 3IN9A 4IETA 1RHI1 2GDFA 4AEDB 4D3WA 1CIWA 1V6OA 1MZ5A 4G3YC 2VXRA 3VBUC 4XPVA 3B93A 3MPPG 1W6NA 4PIXA 2ZJCA 4F7ZA 3O9XA 1ASJ2 1COV2 1H2KA 1N1SA 1UZZA 1IGOA 3OCPA 1YI7A 1FX5A 4FTSA 4W6YA 1FMD2 1XNDA 3VLBB 1VBD3 4D7SA 1WW4A 5BNNB 5LEKA 2ZPXA 4LO4B 1PIV1 2R042 3FX3A 1SFYA 2PQQA 2VW2A 4XFIA 3ZFEB 1O3SA 1PK6C 1XRUA 5DG1A 4Q0VA 3CLPA 3RI9A 1A78A 2WS93 1HKDA 2JE7A 2ZGKA 2KEKA 1LLIA 1AR72 2ZA9A 4N53B 4HZFA 5FMOL 3PLQA 3WHUA 1Y3TA 4I0BA 1LENA 5I8SA 1HXS3 5HBAA 2KXLA 1RUI1 4WM7A 1MQTA 3PJQA 2VQ0A 3FLTA 1HRI2 4XTPA 1LCLA 1R1A2 4HMZA 2UWBA 1PVC2 4CDXB 3WP6A 1VBA2 3SHRA 4HVRA 1Z7S2 4GA9A 3WZ1A 3HWJA 1PHMA 4QPGA 3HD8B 4Y26A 1RGSA 4NWVA 4MGZE 4FPHA 1ND2A 3N7JA 3RJRA 2HWE1 3ZSLA 4Z92B 3MW2A 3ZMOA 1AYN2 3O5SA 4MSVA 1N1VA 1RC6A 4AF9A 2IXJA 4P9WA 3WV6A 1I9RA 4OUSA 1ULGA 2DUOA 2HWD2 4WM8A 1AR61 4BMBA 2PN5A 4BHPA 4Q0UA 1IQAA 4UBHA 1BDHA 1QNYA 1G9DA 4MGKE 2CTVA 1H8TC 2HYKA 3SLIA 4ASLA 3BB6A 5ACA3 5FTTC 2ETEA 3I7DA 2EA7A 1RZRA 1TME3 5DDJ3 5LK5A 1RUC2 1BKZA 3OGGA 4Q4X3 5CFDC 1AR63 1RPEL 3TB0A 2XBO2 5FDBA 5GZDA 1WLCA 2HWF1 5ABJB 1MVEA 3CU7A 4XBNA 2QCSB 4DFSA 4LO8A 3V64A 1X82A 4NDWA 3CECA 5GALA 2TEPA 1QMJA 2IFWA 4LBQD 3GBWA 3MF6A 1PIV2 4KWLA 3DUIA 4O9GA 2WT2A 3JD73 2LCVA 4L9BA 4AQTA 1ZRCA 4BZ4A 2XJQA 2ARXA 1LECA 4KGGA 5GZFA 1O3RA 2IC1A 4ATFA 4CDWB 2IXLA 4PDWB 3FBYA 3NVCA 4EWAA 3VUOA 5KXBA 3JD72 2AXZA 2R0HA 4LHNA 1ULFA 2UYBA 2ZX3A 2OVUA 4AI8A 1RMU2 3R4UA 1GYKA 5EYYA 3V0AA 5JZGB 1RUF1 3H5TA 3CL1A 1NE4A 5FO7B 1QJY1 3JXBC 1KDKA 1H30A 1WLWA 3J8F2 2MNGA 3AZXA 2LYJA 3MW4A 4Q4V2 2PHDA 1SCRA 5GLVA 2Q5TA 3DKWA 1JN2P 1AUYA 2E7QA 2G9GA 4FQZA 4N43C 5HXVA 5BNNA 2UU8A 4JQDA 1BZWA 4IERA 5F6KA 3QACA 4QPGC 2IXHA 2ERFA 1RUG1 4Q2FA 3L1PA 1DGLA 2IXIA 4Q1PA 2UWAA 4RQPB 2QKDA 4PLOA 1H4HA 5J7MA 4AFDA 1B35A 2K2SA 1LTEA 3AYCA 4P5HA 1I5ZA 4AEJA 4X8PA 3USUB 1J3PA 1HRV3 1S55A 2VECA 2YPJA 3SCGA 3JB4C 3PHMA 3VBRA 5DZFA 4F83A 1VB4A 4WM8C 4ZU5A 1H1AA 1RUH3 4XEZA 3GALA 1MQTB 3OPZA 3VZMA 2R062 1LESA 4PLNA 2D97A 5E16A 3ZPYA 1QOOA 2CGOA 1OA3A 1BVVA 1PGSA 4FOYA 4J1XA 4MCXA 1ZBA2 2BEOA 3NKGA 4Q4W2 4IV3B 4FOQA 1JWLA 4CDQB 1NOVA 2ZGRA 1MEC3 2WQ4A 4I3GA 2JDZA 1HRV1 4GQMA 2LYRA 5BNOC 2O0OA 4LLFA 2WJSA 2C0ZA 2XVLA 1H2MA 4P9LA 5BNPA 1ZBA3 5T52A 4AVBA 1PO23 4FPLA 2DUPA 3KCXA 4EJRA 3VDDB 5CBLA 4B4RA 1W6MB 3U4XA 5LRSA 1JXNA 1J1LA 4COUA 4P14A 1AL23 4YW3A 4RS5A 3NKTA 1RZSA 2A3YA 4AVSA 1DQ4A 3GN5A 2UY9A 1PK6A 3PNAA 1HRV2 1RVF1 4HKOA 3POYA 1LGCA 1OKQA 3WW3A 2R043 3LFPA 3S8QA 3OP9A 3RYRA 4FN3A 2P3KA 2PFWA 2QVSB 4QD2A 4K1ZA 2XVKA 3AFKA 3NV4A 2UY8A 2E9QA 4R9AA 4KG8A 2DCTA 1NCRC 4AI1A 2JCGA 2ZX0A 1CAUA 1AR82 2EF6A 3WP5A 1UU4A 3WG2A 3HIFA 4GKYA 1GSLA 5T50A 4XIKA 3ZYIB 5IK5A 1SLAA 1AVBA 4K20A 1LR5A 4COYA 1X50A 3TAYA 3W9AA 5KHKA 2A6YA 3RJ2X 1ONAA 1T6GC 2WA4A 1QQP2 2RR12 3U07A 3LA3A 1RJ7A 3IIAA 3UK9A 4BYYA 1BBT2 2JEMA 1ENSA 3HT2A 2G4IA 3ZKCA 2BUKA 3JBG1 4Q4W3 3MI8A 3O0XA 5JPNB 2ZABA 1LOGA 3HAGA 1PIV3 1ZZBA 5T5PA 4C90A 2BGCA 1PO13 1HX6A 3AMMA 3T1LA 1EP0A 1PRUA 5J37A 1W6PA 4Q4V3 4PU7A 3VZNA 1YNAA 1RUNA 3VK0A 3ZYPA 4B4QA 4BM8A 1DFQA 3GBGA 1QXJA 1WIZA 2CNAA 1C8M3 1FOD3 4JC1A 2IVBA 1VBB1 2ZGTA 4Q4X2 4R9DA 3RQ0A 4Y1VA 1TMF2 3QOPA 4LE3A 3VZLA 4COVA 1RUE3 1D0GA 4LBOA 3BCWA 3M70A 1PRAA 3HZIB 3RI8A 3PVEA 2HWB1 3E5UA 4AYUA 5EFUA 2IXCA 2D6LX 2NPIA 1DQ1A 1R081 4YM0A 3KGLA 2RM22 1RUE2 3DPRB 4HK8A 1QOTA 4W6XA 5DUWA 5CADA 5J36A 1GNHA 1ZNPA 2LALA 5JR7B 2DUQA 3ZFFA 1QJY3 3CEWA 2MEZA 4SBVA 1QPZA 3ZSMA 4C1XA 3ATGA 1LEDA 4FP3A 4QGMA 2A3WA 1Z78A 1WMEA 2VY0A 2W39A 1VAVA 5GLUA 4NVPA 4XIOA 2ZMLA 4MYEA 2XGXA 4I30A 3POWA 2GRLA 3WD5A 1FV3A 1WH6A 4AEMA 4WVVA 1YHFA 3U3WA 1FNZA 4YM3A 1EFAA 3ETQA 1QHDA 3TNPB 3AYEA 2EXIA 5JSPA 3VKFC 3GN5B 1MS0A 2AGSA 1JFTA 1AR73 4K6BA 1B35C 4HPKB 4N53C 1LGNA 1VJ2A 1TNFA 1XYOA 3OYWB 4BLIA 1Q5OA 3D0JA 3R4SA 1VAMA 1ZS4A 3TN93 4DPNA 3WNXA 5J98B 4AHWA 4B8EA 3THTA 1AR83 3H7YA 4JDNA 5JOZA 1UCXA 1Z7S3 1GBGA 2XLFA 4AEKA 3QWGA 2WNUA 1EV12 4URTA 5CU1A 1G6NA 1ULCA 4IEYA 4CDUC 1DQ6A 1WMDA 4Y24A 1HXS1 1J3RA 2ZKNA 4HKWA 2P2KA 5E1RA 5FPZA 1RUF3 4S2GA 3SXWA 5AVPA 2XUMA 3A4UA 1PGW2 3LISA 2DFCA 4YVWB 5BYNA 1AYN3 1YO8A 1CN1A 1UKRA 1UTXA 3VBFC 1D2QA 3WLUA 1RL3A 3IPVB 1GFF2 3E6CC 1UN1A 2KZ8A 2OPKA 4AVCA 2RS52 2XJRA 3MLKA 1R69A 4IEQA 4XF0A 2ZMKA 1JHNA 2R32A 3LA2A 1ZZ8A 1NXMA 1Q8OA 3VL9A 1G9CA 3AB0A 3CJIB 1FPN1 4N7UA 4I6TA 3BD1A 3TN92 4X6RB 2R071 4FXGB 1NEQA 2SLIA 1XWRA 2ZTNA 1PNGA 1ULDA 2A7AA 3JQWA 3TRBA 2R1JL 1JUIA 1A3KA 5EWSA 1CAVA 1BCXA 3WDTA 2OZJA 2VMIA 2A75A 3FUQA 1F5JA 4B3NA 3PVOA 1WETA 1FPN2 2UYAA 4CDWA 1HV0A 4COZA 5I8YA 1CAWA 1LOBA 2IZWA 3V65A 2D6OX 3WOGA 1NCQB 4BIOA 1LB2A 1HQWA 1OQEA 4U36A 1K5MC 3AZYA 5GM0A 1ZAYA 3MIBA 2OW4A 2XCJA 2XHKA 1FV2A 5CA6A 4EROA 2ZGNA 1MEC1 2BBVA 1NY71 4RGGA 4M3CB 5JPMB 3RS6A 2AWIA 3JU9A 3POSA 4AK3A 5LK7B 3H3UA 3VBUA 1SLLA 2XBO3 4LA3A 2D43A 4B29A 1FATA 2HWE3 3WDWA 3AYAA 1I3HA 2VGDA 1TME2 1MVQA 3AKTA 1YCIA 2TNFA 3ZHMA 4PU8A 5GKAC 2GZWA 2D40A 5FQ0B 2I2SA 1LU1A 1UU5A 3GZAA 2WZR1 1B35B 1R083 2OA2A 3C2UA 1WW6A 2BPA2 1ZZ7A 1QWRA 5IK7A 4R4ZA 2XJPA 1QF3A 2DCKA 1W6QB 3D82A 1IC8A 1AR93 1ZZCA 2KA3A 4HN0A 5C9AC 3ZXGA 3H1MA 3WG1A 5LEJA 3RDIA 3H1WA 2OFYA 3RPQA 3QH6A 5GZGA 1Q8SA 1NG0A