1ZZ9A

Crystal structure of feii hppe
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
192
Chain Sequence
b'TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKEPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 44
structure length 192
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz9A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz9A02
2QVSB 4JVAA 3RYKA 4PU4C 1LKNA 2IXKA 3BDNA 5F1RA 3R1FA 4AVCA 1DZRA 1PNRA 4K8FA 4P9GA 3KSCA 2PUGA 3H7YA 1JFSA 3SMHA 4Q0VA 4D7TA 3KXAA 4BYYA 4JTOA 4YSFA 5K98B 2K9ZA 1RUNA 1X8EA 2MNGA 3NW4A 2HSGA 4BH9A 2P17A 3F51A 1NXMA 4LLOA 4Z5DA 2LCVA 4D7SA 3F6WA 5FPZA 1J3RA 4X6RB 4X4GA 4PU3C 3ETQA 3EO6A 4QXKA 1PRUA 2GRMA 1LLIA 4XEZA 3FYMA 5I8SA 3LZZA 4IEXA 1QP4A 5I0SA 3U3WA 2O8QA 3B02A 4O9EA 3D0JA 1H1IA 3PVBB 3NJZA 5I8YA 2C0ZA 1O5LA 5JCTA 3WW1A 2MEZA 2PUFA 4YG7B 5I91A 1IC8A 2CAUA 3KGLA 3O14A 5JSOA 3S0MA 5CU1A 3ZDSA 1OSLA 3RZZA 2PE5A 2R63A 2WC2A 4XFBA 2CGPA 1SFNA 3HQXA 4LEJA 5JR7B 1QP7A 4RD7A 3ACLA 3IDCB 4MH0E 4J1XA 4ORFA 3OMTA 3JZVA 1OCTC 2O4AA 3OP9A 4IA8A 1IPKA 1GT0C 2OYZA 1POUA 1XWRA 3VK0A 2AWIA 2XL7A 3H7JA 1O3SA 2D93A 3CJXA 1UTXA 2FQPA 1CX4A 2PAEA 3PNAA 4GQMA 3BPZA 3NL1A 2ZKLA 1Q43A 4Z82A 3DKWA 1CAWB 4PU7A 4X4DA 2IXLA 2I45A 4B29A 2IXIA 5BPXA 5C8WA 3I59B 4IERA 4PIXA 1WGPA 2IVGA 4Q0SA 4I2OA 2Q0AA 4IETA 3ZKCA 4UBGA 2L49A 2XKPA 3SCFA 4Q0UA 2GC1A 4XF1A 1L3JA 4MZUA 3CLCA 3OF1A 1NYWA 1SQ8A 4Z58A 1WA4A 2IVBA 2Z2SB 1RUOA 3GN5A 1PRAA 2PIJA 4LTAA 3SCHA 1X2LA 4YG4A 3PXPA 1H1MA 3I54A 1QY4A 3LOIA 5I0TA 1PMIA 2OZ6A 4N9IA 3IDBB 2IVQA 1YFYA 1CJGA 1O3RA 1RPEL 3QF3A 4I09A 1J1LA 2H6CA 2EWTA 1ZREA 2BNNA 4ZU7A 2XLGA 1I6XA 1FI2A 4YNIA 1E3OC 2GAUA 4AQ6A 4YRDA 1YFXA 2LYQA 3F52A 1Q3EA 2Z69A 1ZRRA 3OTFA 4MGKE 4WVZA 2ICTA 2PQQA 4AQ2A 4X4EA 3DNVB 1RZSA 2O38A 1J59A 2HINA 3UKTA 2BNOA 2KPJA 4I6RA 3FE5A 1BDHA 2R1JL 4META 2WIUB 5BUVA 1GQHA 3HIFA 4QX5A 3H9AA 1ZVVA 3BB6A 3H3ZA 4EV0A 1EFAA 1O7FA 3E5QA 4OLLA 5C6CA 1ZZCA 1YSEA 2OA2A 2LYRA 3CECA 1DWKA 3DV8A 1DGWA 1ZX5A 5FCCA 1JH9A 5BXXA 2UYAA 2JCGA 1CQTA 2H0VA 4XF9A 1DW9A 4R8HA 4LULA 2XLAA 3UKVA 4Z5CA 3CROL 4L11A 1X82A 4FAHA 3BCWA 4AVBA 1TQ5A 4HVQA 2GZUA 1YFUA 3EUSA 2XLFA 4E2SA 1G6NA 1RL3A 1X57A 2PTMA 4X4BA 3CEWA 1CGPA 4KWLA 3QYXA 4J1WA 2PAMA 2BGCA 3I7DA 3USSA 5FDBA 1U12A 2D5VA 2E9QA 3QACA 4KWJA 4PJYA 1XE7A 1OD5A 2XCJA 2EAAA 4Z07A 4F7ZA 1OI6A 1J58A 1OMIA 2ZCWA 1YUDA 5I0RA 2O49A 2OZJA 2PYTA 1PRVA 4IEVA 2Q1ZB 2XKOA 4YARA 4MCTA 2O1QA 1Y7YA 5EFUA 1JWLA 4Q29A 3N4MA 4CYDA 1HF0A 1QQAA 1ZZ7A 5HI0A 1O4XA 3JXCL 2JVLA 2XIUA 1LCCA 4Z5HA 2LYSA 1ZS4A 3IVPA 2IV1A 5FLHA 4IESA 4UBHA 3WW4A 1DZTA 4F8AA 4IVZA 5KHHA 2EBYA 5J7MA 4JQDA 2A6CA 2LYKA 1ZRDA 4FN3A 2UY8A 4ZU4A 2MPFA 5LEKA 3O9XA 3UKNA 3OQMA 3OCPA 2B8MA 3JXDL 4NDWA 3OD0A 4FAGA 1CAVA 4L2NA 1R63A 4EWDA 4HN0A 1B0NA 3B7HA 3MZHA 4Z59A 2UYBA 1ZNPA 2GU9A 2N7GA 3LA2A 3ELNA 3PLQA 2GC3A 4EWAA 1EYBA 3OQNA 4Y42A 5JSPA 3DL3A 3NSTA 4FBIA 4HLTA 4KU7A 2PFWA 3ROUA 1S7EA 3OQOA 2QDRA 2VQAA 2BYVE 4QM9A 1UD1A 4XFIA 5CVRA 4MGIE 4E2GA 2GZWA 1OFNA 4IEOA 4E2QA 3SHRA 1SQ4A 3CO2A 1WETA 1FT9A 4QGLA 3GN5B 3M70A 4TLFA 4N9HA 5KHIA 1O4TA 2D40A 4KL1A 1NE4A 1RZRD 4FBFA 5LRSA 4LUKA 2CAVA 1QPZA 1LRHA 3LISA 1JUHA 1NEQA 4GULA 3QQ6A 4IEPA 2D5FA 1ZZ9A 2QJVA 2ATFA 3OGJA 3R6SA 4OB4A 5FLJA 3CL1A 3KMHA 4IEUA 4PIZA 2LYJA 1VJ2A 4I01A 1ZPQA 3ZHMA 4I02A 5A7LA 2KEIA 1XRUA 3KCCA 3MDPA 4XETA 4WBBA 3MLFA 5FLIA 4PIYA 4ZU5A 3JXBC 1IPJA 4KU8A 3BU7A 3E5UA 4Q0QA 4LA2A 2CSFA 2XSDC 4XFAA 2WFPA 3RPQA 3EBRA 4I3PA 1ZZ8A 1YWKA 1ZVFA 3BALA 1ZZBA 1UW8A 3BS3A 2GH2A 3HZIB 2H6BA 4BHPA 1UIJA 1LMB3 1LQCA 2Q30A 4UXAA 3CF6E 4XF4A 4OFGA 5KHGA 4NVPA 1QQBA 2PUAA 1RGSA 3E6DA 5JSRA 5KHKA 1YFWA 2IC1A 3UFDA 1ZRFA 3HT1A 2HJIA 1WH8A 3IIAA 3NVCA 4LA3A 5LEJA 2ET1A 3RDIA 3RNSA 2D5HA 4MV2A 2XGXA 4I8TA 2FMYA 3FX3A 5KHJA 4MGYE 2AXVA 2Q4SA 2VECA 5T3NA 2IUOA 2BNMA 1FXZA 4I6UA 4O8BA 3E6CC 3ES4A 4X4IA 4QMAA 3U10A 4YYOA 5CADA 1PM7A 4Q0PA 3LFPA 2BEOA 3KZ3A 2AXZA 1RC6A 2XL9A 1NE6A 4IEWA 2LYPA 1R69A 3IBMA 4BIFA 4I0AA 5BV6A 4MUVA 4HVRA 2PAKA 3E5XA 1RIOA 3NKTA 2EA7A 2B5HA 4X4FA 1PERL 3U0ZA 4I0BA 4MX3A 2IU7A 2XI8A 3QOPA 1ZUGA 3S8QA 1SEFA 1YHFA 2GC0A 4I6TA 3H1WA 3H1YA 5I8TA 1DGRA 5J3UA 2KEKA 4XFCA 4PU8A 2EF8A 1UXCA 3GYDA 5BY5A 4IEQA 3DN7A 3SCGA 3FMYA 5K8SA 3H50A 3EHKA 4DINB 3H3UA 4EWEA 2GRLA 1EP0A 2DCTA 4HMZA 4O9GA 1GQGA 2KEJA 1QXRA 3S7IA 4HZFA 2PA7A 2B5AA 3FYAA 1EPZA 1CAVB 2V09A 2KZ8A 3G5GA 4JCXA 4MGZE 2AUWA 4GHJA 4EROA 2OR1L 2HKXA 3H8UA 3RYRA 3E6BA 3U11A 3WW3A 1JFTA 1UCXA 3LAGA 1RZRA 5AVPA 3KGZA 1UXDA 2MQKA 4X6QB 2AXUA 2H8RA 4A2UA 3WW2A 4YBAA 4LUMA 2KXLA 5E1RA 3CLPA 4HVOA 4QGMA 4XFHA 4XFGA 1WIZA 1YLLA 4QGNA 3FHIB 2L8NA 1QP0A 2WUSR 1NZCA 1X8MA 3EQEA 3ES1A 3D0SA 2MHFA 2XHKA 3S7EA 2FJRA 3QWGA 4F8DA 5D1IA 1O3TA 2ET7A 2LYLA 2UY9A 3LWCA 5EZWA 1LR5A 1ZZ6A 3MPBA 2PHLA 4MCXA 1RTVA 4H7LA 5FQ0B 1J3QA 1Q5OA 1QXJA 2GC2A 4ONUA 2AW6A 2EVXA 5J48A 2PUBA 2BJCA 1WLTA 1AU7A 5FQ0A 5E16A 1VPWA 2PUEA 4XFFA 1CAWA 2B9UA 1ADRA 3M3IA 1XE8A 2OFYA 2CV6A 4HBNA 2VPVA 3I59A 1VP6A 3TNPB 2IXHA 1X7NA 5I93A 1EY2A 4R52A 1WH6A 2ICPA 4XF3A 4AVAA 1Y3TA 3ST7A 4QM8A 3MYXA 3E97A 2PUDA 3L1PA 4IEYA 1BDIA 2QCSB 1QWRA 3SXWA 1UIKA 2IXCA 2CROA 1O3QA 2F4PA 1J3PA 5I0UA 4JV4A 3VHRA 4FT8A 3FJSA 4X4CA 3LA7A 4JCYA 4X4HA 4IWRA 1O5UA 5FPXA 1LCDA 3LA3A 3H5TA 2IXJA 3G7DA 3KJXA 3ZHIA 3L2HA 2XJ3A 3TNQA 1UPIA 2PHDA 2OPKA 1NERA 1CAUB 4XF0A 3FWEA 2PUCA 3BD1A 3FFQA 4HSLA 2Y0OA 3D1NI 3GBFA 1CAUA 4IEZA 4JTNA 3HT2A 1HW5A 3H1MA 3D82A 2QNKA 2K0GA 4AXOA 1VR3A 3IWZA 1LB2A 1I5ZA 1ZRCA 1CAXB 4WZCA 3FZ3A 3EJKA 5LRRA 1L1MA 3TRBA 4HSJA 3RYPA 1CAXA 5JAXA 1Y9QA 5KBFA 4YG1A 2PPXA 4KWKA 1V70A 1ZAYA 2ETEA 3C3VA 4HN1A
chains in the Genus database with same CATH superfamily
3BKZA 2E7TA 4JVAA 4YGEA 3WQ7A 2JKBA 1H0BA 1LKNA 3BDNA 4XJZA 5KXCA 4QDRA 5FY5A 2JDYA 5A3NA 5EHDA 5FBZA 4KBBA 1DZRA 1PNRA 4Z1VA 4OI1A 3KLSA 2PUGA 3PTRB 4JHTA 3KXAA 3WDYA 5K98B 4YSFA 1X33A 5LBBA 2BBVA 5IVVA 2A6ZA 1OA4A 4W65A 3W5NA 2HSGA 2BWCA 2P17A 4FPOB 5JIUA 4Z5DA 2LCVA 3MV01 5DAWA 5F3EA 4GIQA 2QQIA 4HKLA 4K40A 2YYOA 3ETQA 3B5LB 1BEV3 1MS1A 1SCSA 3EO6A 3KHBA 4XMAA 2XQXA 4QHOA 4QXKA 3I97A 4Q2JA 1LLIA 1OH4A 1UOFA 4LHNA 3LZZA 4V2WA 4IEXA 3I3QA 1QXPA 4XACA 2O8QA 1CR7A 3OBAA 2YFZA 4L92A 2YPDA 1XNKA 2GP3A 1LECA 1O5LA 1S0EA 1QJU2 3FL7A 4XUNA 5ABJC 5JCTA 2MEZA 3NROA 1COV3 4CTEA 3JQWA 1IC8A 5DPNA 3O14A 3S0MA 1AXYA 2C24A 2WA4A 5HPOA 4LKFA 2VC9A 4QX2A 1WMEA 2VH9A 4XFBA 2P5BA 3HQXA 2VOVA 2RM23 1QP7A 2ZOEB 1PO21 2RS31 2LLWA 3IDCB 4HT1T 1GOFA 2ZMNA 2HFZA 2PXJA 2RR11 1MQTA 5FY1A 5A3LA 2HWB2 2XJTA 4FOYA 4LKSA 3ZFEA 1LHWA 2AGSA 2W3JA 2ZGSA 4AG4A 1GT0C 1G9AA 1DG6A 1LNSA 1U0AA 3AP6A 4NIGA 2PXPA 1LHOA 1POUA 4YPJA 3KV9A 4RQPC 1QF3A 1H8TB 1RUJ2 3WP4A 1S2KA 5FZEA 3OPTA 1OLRA 1BBT1 2FQPA 1I1EA 3KT4A 4L97A 4P9JA 4QHZA 3ZSEA 4CCMA 5F2WA 3P1IA 3J26N 3WG4A 1GZWA 5L7OC 1Q43A 4Z82A 4COUA 5FOBB 3KM5A 3ZM8A 1RITA 4FVVA 5F2SA 5FZ6A 1JU4A 2IXLA 2KR2A 1YNAA 5LY2A 4B29A 4E9KA 4YG0A 5FMOS 2IXIA 4CXWA 3I59B 5KWRA 2IVGA 3NAPC 4XJ9A 1V6OA 5BNNA 1WCDJ 2AH2A 1UX7A 1VBD3 3ZO0B 4YM2A 2XKPA 5FFOC 1HDKA 4FFGA 5CIRA 4CCCA 3PUSA 2Y64A 4IE6A 4QWNA 4AE2A 2BQPA 3DYOA 2NLRA 2BZDA 5H9RA 1DQ0A 4D3WA 5A6QA 3BU0A 5F6KA 2QUOA 1A3KA 4XQ4A 3VBOC 3OF1A 5C8CB 5JPNB 1P8JA 1FNZA 4AEJA 1QZXA 4YZ1A 2HEVF 1CONA 3IDAA 2VUJA 1C8M3 3GN5A 2PIJA 1W06A 4LTAA 5FWEA 5GLVA 3KHCA 2W52A 2ZHMA 2VZTA 1DQ4A 2R071 5C71A 3PXPA 5J09A 1LCLA 3J8F2 5IVBA 1LEMA 4WM8C 5JVVA 4CCJA 1DULA 1CJGA 2HWE2 4UT5A 1RUC3 2BRTA 2A3XA 4AHYA 5A33A 1ODNA 4CDUA 2MXDA 1ZREA 1NLRA 1L7LA 4X8NA 2LALA 4YNIA 1BKZA 4S2HA 1W8NA 1JUIA 2PHWA 3O0XA 1Y9MA 5LBCA 2Z69A 3OTFA 5FRAA 2HCNA 2ICTA 2PQQA 2PLV2 4X4EA 5IK7A 1RZSA 4PDWA 2HINA 5FY0A 4BXSV 2KPJA 4QXHA 3FE5A 3VD5A 3H8OA 5JUVA 1PGW1 4MVTA 1ULPA 1XOYA 2ZHNA 2WIUB 1WLWA 1GZ9A 3HIFA 1PIV1 1SPPA 3MIDA 4PHZA 4Y33A 3WNKA 1VMFA 2YC2A 3CJIC 3GZUC 1SDWA 2HYXA 3H3ZA 3JB4C 1VBA2 1O7FA 4ATFA 2ARCA 4QB6A 2DV9A 4XQDA 5E88A 3ACGA 2WT2A 1HJGA 3VKOA 2ARBA 1AXZA 2LYRA 1SG3A 1DWKA 2YC4A 5H9PA 1RHI2 2BDRA 3B00A 2JCGA 5HCAA 1CQTA 5A7WA 5JI9A 1HB1A 1W9TA 4YZ4A 4CUCA 2VE1A 2XOMA 1DW9A 3I2IA 2XXQA 2XLAA 3ZMNA 4S2GA 3UKVA 4Z5CA 2VBDA 1WW4A 1FOD2 4P9XA 2DCJA 5IJRA 4BA6A 4NHLA 1X82A 1TME2 4FAHA 2TNFA 5JIAA 2C9AA 3ZYBA 1LOGA 3VHNA 1X36A 2GZUA 1YFUA 4CXYA 1HQLA 2QQOA 1SLCA 2JDKA 1G6NA 1PK6B 2XXZA 3VDDA 4EJRA 3MLKA 3SLIA 5F3CA 1G9CA 3VBFA 1QHDA 3HN1A 1HRV1 1PZ8A 3Q8EA 2PAMA 3I7DA 3T08A 5FDBA 3VD4A 2D5VA 4WVLA 3I3MA 3KCYA 4MOAA 2FFHA 1V6LA 3CQOA 3OPZA 3HOBA 4Y4YA 1OD5A 1ND3B 5FYTA 4JGYC 3PU3A 1OMIA 2XDVA 5JOXA 1NLSA 4DB5A 1PO23 2CDOA 2RHPA 2RS33 4HKWA 1JS9A 1KEXA 4NPLA 1Y4WA 1VMJA 2RR13 1GKBA 2GNTA 2HYKA 3CDZB 5F8PA 4E8CA 2Q1ZB 2ZX4A 4B4QA 2DWRA 4GH4B 1SCRA 1G7YA 1W8HA 5A80A 4DMIA 1JWLA 1APNA 3HBZA 4Q29A 4CYDA 5C3QA 3D6EA 2BERA 5K4LA 4HK8A 1ZZ7A 3ZFGC 1BBT3 1O4XA 3JXCL 2JVLA 2XIUA 2QQVA 2I74A 2W9XA 3UJOA 2LYSA 3JBG2 4QPGC 4JKLA 2BFUS 4JDNA 5KHHA 3AP4A 2EBYA 4JQDA 4UWDA 5FV3A 5FXWA 2TUNA 1ZRDA 2BP6A 3J7LA 3OY8B 5FP9A 5A70A 1JZ2A 4FTSA 1K3IA 3WF4A 5LBEA 4FAGA 3A9YA 4AI1A 3ZXDA 1OQ1A 2ZEZA 3B7HA 2GALA 2B46X 4XC9A 3WUDA 4CDWC 1ZNPA 2D6MA 2VUAA 5IVEA 1B35B 3LA2A 4M00A 3ELNA 3ZSMA 2GC3A 1JHJA 3K46A 4CA9A 4AVTA 4IV3A 3WQ1A 3DL3A 4WM7B 2ZGPA 4FBIA 4RQPB 4DXTA 3VHPA 4OUMA 1X9PA 5A7NA 3LQXA 3M3CA 3KV4A 1C3HA 2ZJCA 4H7MA 1W8WA 4ZS3A 5FYYA 2ZX3A 3DECA 4RS5C 2R073 1SDDB 4BQWA 4QM9A 4LIVA 1W2OA 3ZYIB 4Z2WA 2V4VA 3GBGA 1ALYA 1JI6A 5FK7A 4ZZ5A 4E2GA 4BPZA 4CDXA 4XXAA 3U07A 2DVAA 1HXS1 1S1AA 3SHRA 1JZ8A 1SQ4A 2X53S 1UNBA 5IYYA 4DNYA 3NNLA 4NWVA 4QGLA 5J96B 1V6JA 3BOWA 5D8AB 2RMU2 1KJLA 4R9DA 1JYIA 3IPVA 4D6QA 3ASIA 4LUKA 2W46A 1K5MB 4CP9B 1W2TA 2FDKA 4CUAA 2ZXQA 2ZX1A 1Q8OA 4GULA 3QQ6A 4DUVA 2OXBA 2XWJB 4GA9A 4RSUA 5DZGA 4YW2A 2ORZA 1ZZ9A 2QJVA 3I2DA 3JD71 4PI0A 3A0NA 4OB4A 5CFDC 3DUIA 4GJZA 3CL1A 4CDQA 3ATGA 3ZN6A 1PIV3 3K3OA 4M0NA 2BOIA 3I3BA 2GNBA 4ISQA 4YVSC 2Y34A 2R042 4MGTA 2W68A 5I0DA 4WM8B 3LEIA 1RYYA 4I01A 1E57A 3S5AA 3ABZA 1F9KA 3NJVA 3DCQA 4YW1A 2C5DA 5A7LA 1BZWA 2TBVA 2A6VA 3AK0A 4WBBA 5LW9A 3ZXJA 4ZU5A 1M4WA 2JKXA 5A7QA 3VKFC 4QB1A 4Q0QA 3K77A 4BQYA 5C3OA 3POIA 4AEDC 3VBHB 5GAGi 1XPWA 3POGA 1ZZ8A 1IG3A 1RUE1 3BALA 4I3PA 3RPQA 1UW8A 2H6BA 4BHPA 5CFCB 1S0GA 3MIHA 3ZR5A 2DVBA 5A3PA 1KGYA 1AXKA 1D4M1 2XB6C 1LOFC 4GWMA 2Q30A 4PCRA 4BQ3A 2FZ2A 3THPA 3MIGA 1VLNA 3B9IA 4XF4A 5KHGA 2G9ZA 4B7EA 4EZIA 5JZGA 1YIPA 3HWJA 2D6NA 3UFDA 1HRV3 3V0AA 1UN1A 5FY7A 2QDNA 3LEMA 3R0RA 1XQNA 2ZGTA 2B39A 2XGXA 5A3OA 3WP3A 3RI9A 4I8TA 4YW7A 2FMYA 4OHVA 1V9U1 4MGYE 2RR12 1FX5A 4K8RB 2VECA 4PF1A 2IUOA 4FOWA 4JQTA 5FZDA 2R16A 4LBKA 4Y22A 4BK5A 2D6OX 2JDHA 2WIIB 1N3OA 4IGPA 1HN0A 2BOJA 3W20A 2KD7A 4XUOA 1X50A 5F6LB 1BBT2 5DXDA 1KDMA 4PQQA 1ZRIA 4NE9A 4AGRA 2XL9A 1AUYA 4IEWA 4XPVA 3W5MA 2X5IA 1R69A 4BIFA 5CB7A 3ZXKA 1IQDC 3OUHA 3DPRB 3E5XA 3VN4A 2XMLA 3U14A 3HBKA 2WLPA 1XU2A 3BUCA 3O1MA 3K48A 4Y5Z0 1NCRB 4A7ZA 2AZ5A 1S0JA 1N1TA 1UY4A 2JENA 1M06G 2G9FA 1AHSA 1SBEA 3W9AA 2JEMA 4LBQD 3DN7A 4QXCA 4XZUG 4YZ3A 4NIAA 3VKNA 3WDUA 5K8SA 3P5BA 3H50A 4X8PA 3TBDA 5IVJA 2NQYA 2DCTA 4O9GA 1VBE1 4EZ4A 1GQGA 2RDRA 3I2OA 5JUWA 1OLME 3C8XA 5T5OA 1CAVB 1CIWA 2H0BA 1MQTC 3WG2A 1FV3A 4NOTA 4AFCA 5FZKA 3PIGA 4MGZE 3ZFEC 1LU1A 2EIBA 2JG9B 4UFJA 3RYRA 3T1MA 3RQ0A 5FMCA 2RS11 2ZAHA 3OBZA 2MQKA 3GJAA 2JDNA 2YXSA 3TWIA 3WW2A 1HXS3 3N9PA 4LUMA 2E63A 4BXFA 3AM2A 4XAAA 5JI7A 5HV0A 2VUDA 5BNOA 3WVJA 1TVGA 1WUVA 1WIZA 2OPWA 5DN2A 2JIGA 3FHIB 5JDBA 1QP0A 1X8MA 5F5AA 1W99A 2WR9A 5FPBA 2W08A 5GM0A 3TEYA 1O8SA 4XZPA 5IAXA 4GMP1 1GQPA 4YG6A 1UMZA 2DCKA 5BNNC 2PELA 3JD73 1GBGA 5EZWA 5K9YA 1LR5A 5A7SA 1Z7S2 1YI9A 2JE9A 4NR1A 5FQ0B 2LUWA 3POEA 5FPLA 5GLTA 5A3WA 5J48A 1RJ7A 2D43A 2BJCA 4WVMB 1WLTA 4YGDA 1AU7A 1LOAA 5E16A 2RS52 3N7JA 4PBPA 3MBWA 2B9UA 1PO11 3RZJA 4QX7A 1EV11 2OFYA 1OOPA 1WWYA 1X7NA 4YVWA 4R52A 3MW2A 1B09A 1OQEA 2CWSA 4F3JA 1A8DA 1RUF2 1RUE3 1UU6A 4XF3A 3T4HB 2JD4A 4AVAA 4QQPA 1KQRA 4TWTA 1UF2C 4NRPA 5LB6A 5B2GB 5DAVA 4CCEA 3KT1A 4ZONA 2XHNA 5FUNA 2NM1A 2R7EB 1D4M3 3U37A 2SBAA 4CDUC 4CP2A 3O1UA 3LEGA 3POWA 2ZGQA 5HCFA 1SMVA 4AEMA 5CISA 1W04A 3MLJA 3I8TA 1RMU3 1FMD1 4JV4A 4EQZA 1YJKA 2FCTA 2X29A 3MIEA 1NZIA 2VCCA 3FJSA 5D21A 4PBOA 1UXZA 4BWOA 1LHVA 2UWBA 4PDWC 1Q8QA 2IVJA 1RUG2 2WWSA 2RG4A 5FPXA 1QIQA 3WNOA 4K20A 3KVAA 2VY0A 3KS7A 5FZAA 1W6NB 4LNVA 1G9FA 3L9JT 1D7PM 3V0BB 1V9U3 3VUOA 3TNQA 1PGL2 3KVBA 1LODA 4CP1A 1ENQA 3ZPXA 2OPKA 2HH9A 3GCWA 1AR62 4LOTA 5K0UC 3D1NI 3MIFA 1LJ7A 4IEZA 2WN2A 4BQ5A 3HT2A 1HW5A 3H1MA 3CU7A 2QNKA 3RJ2X 4AXOA 1W9WA 5FZOA 1H1AA 2QQLA 3WF0A 4ZPIA 4NHXA 2QQJA 3H0OA 3IM0A 1IZ3A 5ACA2 3FZ3A 2JDZA 2PN5A 4ER7A 4RFT0 3H8XA 1CN1A 1OQDA 1CAXA 5GZFA 5JAXA 1Q8PA 2VUCA 1H2NA 1TG7A 2HWD2 1JZ3A 1DQ2A 1V70A 3F95A 4WVWA 1X9TA 2J1AA 3HR9A 1ZAYA 5H9QA 5A32B 3VDDC 1GZCA 2WLQA 1QJY2 2EIEA 3AJYA 5T5JA 2AREA 2W1QA 1WD4A 3VBFC 2IXKA 3B01A 5KXBA 2AYHA 1XYPA 5H9SA 1HQNA 3R1FA 3NNGA 1FPN1 4LIUA 3RGBA 3FBYA 1UZZA 4K8FA 4COVA 5GZCA 5DUXA 2FDIA 1AYN2 1WD3A 3P3PA 5C33A 3H7YA 1JFSA 1RXFA 1VBE3 2Z5WA 3ZLIA 4BYYA 5FO8B 3K4DA 1RUNA 3GGLA 1OF4A 1QEXA 4J6GA 2W1SA 3NNJA 1AF9A 3MUZ1 4DXZA 5EJ3A 4IV1A 3F51A 5K7PA 4LLOA 2OS2A 3DYPA 1PNGA 2IUWA 3LIGA 2YB7A 2RS13 2WABA 3O5SA 5FYUA 3BTYA 5JR2A 1LOCA 3AKQA 3FLRA 4DRRA 3HEIA 1VBC1 3W59A 2XJUA 4RGAA 1R1ZA 4AI3A 2KM2A 4QX0A 1PRUA 2VL4A 1TMF2 4XEZA 1S0FA 1LGBA 3AP7A 5FZLA 1QP4A 1H4HA 2BJSA 4GKYA 5BNPA 4FPJA 2VMIA 3CZUA 3NJZA 3WHUA 1RVF2 2C0ZA 1H2KA 1QH6A 1OFSA 4YG3A 1DU3D 4UF0B 4GMP3 4SBVA 3JD72 2NYYA 1AR91 3ZYGA 5I91A 3VBSA 2DVGA 4BU2A 1YEWA 3LF7A 2B4KA 2PXLA 2MEV1 1OSLA 2FBEA 2PE5A 4QKDA 3TOJA 4FPHA 3AFGA 1JOJA 3LE0A 3ACLA 3UESA 2Q5TA 4JGZB 3ZFFA 4MH0E 4ORFA 2WO2A 4IV3C 1GNZA 3OMTA 3OYWA 3JZVA 4HXCA 1OCTC 3VDAA 4MXWA 1W0NA 5GAHi 2A6XA 2JDMA 2WFF1 2HWC1 4GB31 2VVFA 4P9IA 1AX1A 1PO13 2OYZA 1ND2B 5CG8A 1NW3A 1EV13 4CDWA 4TZDA 1MVQA 1ZYBA 1GFF2 1MACA 4QX3A 3H7JA 4UW5A 2D93A 2DDUA 1Z0HA 5LBFA 3RMYA 3ZN4A 1CX4A 3PNAA 2IZWA 3GZCA 1RUH1 3C7EA 3T0AA 3AMMA 2ZKLA 4CDXC 1TZOA 2GH8A 3W21A 1CAWB 2JG8A 2FCVA 4X4DA 5F3IA 4D6RA 1MS4A 3KT7A 1AVBA 5BNNB 4CU8A 1HRI2 1RMU2 3I2FA 5FYMA 1R092 1LGNA 1GYKA 1W6PB 4ES9A 1FMD3 1DF0A 3OGVA 3GHNA 4MYEA 3RFRA 1KDKA 1OF3A 3USUA 3ZKCA 1RUI1 4UBGA 3PDQA 3NRUA 1AR82 4XQWA 1DHKB 3SCFA 1VALA 4QDSA 1V6MA 4NHMA 3MI8A 4YZ5A 4CDQC 3CLCA 3LIHA 4M4PA 1NYWA 1SQ8A 4ER0A 3IN9A 4OHYA 1WA6X 4L0PA 3OKZA 3BVCA 1WCSA 2JECA 5F7UA 1LGCA 1OT5A 2VNGA 2DUOA 3B7MA 5DTQA 2W1WA 2WZR2 4NHYA 4P08A 1YFYA 3OGGA 4OQ9A 4M3CA 1RPEL 3ZX7A 3BTXA 3ON7A 1J1LA 1K42A 1W2NA 3GZAA 1KFXL 2BNNA 2G9GA 4ZU7A 1D0HA 1GWKA 3O1PA 1FI2A 4Q4X2 5CKMA 1K5JA 5LA9A 3WSOA 4Q4W1 2QFEA 1NCQA 4OVEA 4YRDA 3W58A 4WVZA 2BU9A 1PHMA 2RDSA 1D2QA 2WSUA 4CCOA 1YC61 4URAA 3AYDA 2ZS6B 1PNFA 1SLBA 2AEYA 1ST8A 4P9YA 3QOWA 1RUD2 4GJYA 3TEZA 4META 3DM5A 4FPCA 5BUVA 1SPPB 5JZGC 4OZOA 2W92A 2AUYA 4OHXA 2YMZA 2WZ8A 1W0PA 3H9AA 1FPN3 2Z79A 4Y20B 3DF0A 5L36A 4EV0A 3AB0A 4AHXA 2D44A 2YBKA 5FCCA 1CX1A 4R4XA 2WS92 5DDJ2 5CEHA 2H0VA 3VBUA 1ENRA 1QDCA 1YIFA 2ZEYA 5KC6A 1GNYA 2YGLA 2WNUB 4LULA 4O7XA 4JZRA 3JQXA 4Y4RA 1K12A 3TB0A 1VBB1 1VBC3 3J7HA 4Q26A 1BK1A 4HL0A 2X5IC 3ZR6A 3KQ4B 4E2SA 2HEWF 4M3CE 1LESA 2DUQA 4NPMA 4NROA 3RMXA 2L1PA 3QFIA 2PTMA 3CEWA 1KS4A 4FXGB 4OUEA 3O1SA 3RWKX 4LPLA 5HV4A 2GSYA 3C7GA 3D4KA 3SC7X 1CGPA 3ZXGA 1BCXA 1MS3A 4GXLA 1ZA4A 3USSA 5A3UA 3VWSA 3Q8FA 1AR93 2ADDA 2E9QA 4KWJA 4PJYA 2XCJA 2EAAA 2MEV3 4UFIA 1EUUA 1NY72 3ZYHA 1POQA 1T6BX 2DBIA 2DFCA 4AGVA 3RZKA 1A8MA 4AFBA 4Q2FA 1DYOA 2O49A 2OZJA 4W6WA 4AVSA 1GWMA 5DAQA 5F37A 2VZUA 4MGQA 1YQ8A 4Y1VA 2XKOA 1PO12 2WFF3 2HWC3 2Y6HA 4YARA 4GB33 4Q4Y2 4K21A 4RYDA 2C4XA 5DUWA 3FN9A 3PE5A 2XBO2 1HF0A 1YRZA 1VB4A 3MV11 4QQOA 3TYJA 4Z5HA 1RUH3 3BIEA 2VEOA 1OD3A 4CEYA 1REFA 2BBAA 1IPSA 2ADEA 4IESA 4JRLA 1DZTA 1ZBE3 3UK9A 1E5IA 5J7MA 3OJBA 3KF5A 5BNOC 2XH6A 4D0QA 2A6CA 4CCDA 3AC0A 1DBNA 1REDA 4COYA 2UY8A 5C5UA 2MPFA 3UNPA 4BQ2A 3O0WA 1O59A 2B8MA 2LW8A 4M01A 3JXDL 5F39A 4NDWA 3OD0A 4ITCA 2HWF3 1F31A 3H8RA 1GWLA 1RUI3 1S0CA 3EYPA 4IQPA 5C7GA 1R63A 1U5ZA 1TEIA 2DTWA 2UYBA 4N7IA 4Y1UA 3BTZA 2E7AA 4EWAA 3OQNA 4YM0A 4KBZA 5JSPA 2GNDA 3NSTA 4PLNA 3VBRB 2Y6FA 3M7AA 5FKCA 2VNVA 4NRMA 4QPIB 1N3QA 1W6MB 4KU7A 1H2LA 2VQAA 4CDXB 2W2IA 4CEWA 3ACHA 3HQUA 4JKKA 3K75B 3KWVA 4MGIE 1DDLA 1OOPC 1OFNA 4E2QA 5GKAC 2OQ7A 5LA2A 1F35A 3NO8A 1UMHA 3CO2A 4YVWC 5TSWA 3M70A 2EXIA 4I0WB 4N9HA 4NJ4A 1W28A 1OPMA 4XTPA 4Q4W3 1WW5A 3VLBB 3VL9A 5LRSA 2J1SA 2CDPA 4WV8A 5L19A 1VRH2 5ANQA 5DZEA 5DTMA 2JD9A 3IKWA 5EWSA 2DUPA 2NPIA 3OGJA 2ATFA 2BUKA 4KH9A 5SV5A 3R6SA 2OUHA 1Y43B 5IAVA 3C7OA 4ATEA 1FPN2 2L9LA 1L7QA 2LYJA 2UURA 5GZEA 3WINE 4AZZA 3BIWE 3ZPYA 3MEJA 2YG0A 1ZPQA 4QPYA 2FDHA 1N1SA 4ZZ8A 3U1XA 2M4HA 1AR72 4I02A 3KCCA 5FLIA 3MLFA 4NO4A 3BPSA 1J1TA 1R1A1 2VXRA 4KU8A 3E5UA 3LKJA 2K2SA 3PJYA 2DU0A 2VAUA 1MPXA 1YWKA 2YHJA 4N43B 1ZZBA 4BLIA 1JYTA 4OMDA 3B93A 4N90A 2XJQA 1OUSA 1VBB3 1AL21 5IW0A 2LLVA 1AX2A 3NKGA 4XVHA 4HG6B 1H4GA 2OVUA 3UV9A 2OUJA 4UW4A 3R05A 4FOQA 2QTWB 5HXMA 5K0UA 2X09A 1WZXA 4NVPA 4EE2A 1MZ6A 1QQBA 1RGSA 1GMMA 3E6DA 3POJA 5JSRA 4JHZA 5KHKA 2EXJA 3JUUA 2VW0A 1UOGA 3UGGA 2Y26A 1BEV2 1VAKA 2VVEA 3IIAA 1WH8A 3KB5A 3P6BA 4LA3A 5BYNA 5LEJA 5J36A 4RN5A 1MZ5A 2PXFA 1A6CA 3VB9A 4C90A 1SFPA 3T2PA 5FP8A 4SLIA 3HD8B 2Q4SA 2ES3A 3VDBA 5JXGA 5FMOL 2VBPA 3SITA 4UW6A 1UO9A 5C3PA 3O1RA 1COV2 4YFZA 4X4IA 3U10A 2NN8A 4Q8KA 1GP5A 5FIXA 5CADA 1PM7A 4W4ZA 4Q0PA 4RHV1 4TLGA 3ZKUA 3ZSKA 2ZBJA 3K4ZA 4IV1C 1RXGA 4FFFA 1F5JA 5EYYA 2AXZA 4F83A 4D8MA 4LITA 2IFWA 1W6QA 2R30A 3V64A 2RM22 3IBMA 4C1XA 4DY3A 4NIHA 3BTAA 1XNDA 5FP4A 1JZ7A 1ZBE2 1OA3A 1PERL 3ILFA 4I0BA 1ZA7A 4AAPA 3U0ZA 2F4LA 3S8QA 4C91A 5CAZA 1DGRN 4I6TA 5EV7A 4AQSA 5I8TA 2VMHA 4JKMA 1DGRA 2HWF2 5BNPC 4B4PA 2GMPA 2EF8A 2PQSA 1OPOA 3WY6A 4D6SA 1C57A 3PU8A 5CZKA 4IEQA 1UZYA 3AMPA 5FXVA 3VBSC 3RSJA 4DINB 5ABJB 4RGGA 5DG2A 4EWEA 2F17A 2KEJA 4E4DX 3S7IA 1YQ5A 2PA7A 2WO7A 1US3A 4LQRA 3ZFFC 5DRTA 1BQPA 2E33A 4CU7A 2AACA 4LO7A 1VBD2 1O6UA 2OR1L 1QQP1 3U11A 3E6BA 4OYUA 1JFTA 2ZKNA 4OZXA 2BWAA 4Y20A 4CEWC 2IVIB 3WQBA 2VU9A 2ZGLA 5BNOB 4A2UA 5J98B 1H8VA 1QOOA 5FZFA 3OBTA 3OUJA 3VZLA 1DQ5A 2WZEA 1MEC1 5B4NA 3DEMA 4HVOA 1C8M2 1MS0A 2K46A 2FCUA 4QGMA 4NUBA 5T5PA 2XJRA 2L8NA 2WUSR 1DFQA 2JG8C 3EQEA 3I2KA 4Z92B 3S30A 3T4VA 1JBCA 2MHFA 1TE1B 3VD3A 2XHKA 5L7OB 3S7EA 5FKBA 3QWGA 4P9WA 5D1IA 2WKKA 3CZJA 3R4DB 2ET7A 2LYLA 1RUC2 4AW7A 1O3TA 4OI0A 4K9SA 4AGGA 4MGSA 1UAIA 2YY1A 3LWCA 4FPEA 4XBQA 1ZZ6A 1QJFA 3MPBA 1N1YA 2WQZC 1BHGA 1H8TA 3AZZA 3NAPB 3ZVXA 1RTVA 5FBJA 4RR3A 1Q5OA 2GC2A 4GWJA 2VZ1A 2ZHKA 2WWJA 3BODA 5GLZA 2PUBA 4AVVA 1A34A 2QKDA 1XNAA 3O0VA 1OOPB 3T0BA 3FFZA 1VPWA 3FBMA 5F9TA 5JPMB 4R9BA 5KC5A 1W6OB 3RZGA 2VMCA 3VBOB 2ORXA 1FNYA 1R1A3 2VPVA 3I59A 1EY2A 4H14A 4HONA 4D69A 4XYXA 2ICPA 3G6JB 3RZLA 1IOAA 1VMHA 2LTNA 3E97A 5FZCA 5IVYA 5FREA 3L1PA 1ENSA 1UWWA 2QQKA 1CQ9A 2XONA 2XUEA 1AL23 2QCSB 2YUEA 3BGAA 4IEYA 4IGQA 1C4RA 1QNWA 3R4UA 2CROA 1CJPA 4Q1RA 1HLCA 2RDNA 3WOGA 1JHNA 4FCAA 1NCQC 2WO1A 1DCSA 3LFMA 3AZVA 1O3QA 3VHRA 3GM8A 2G1MA 1WBLA 2LRPA 4AOCA 4X4CA 4AI0A 2LNMA 4INDA 4XUPA 2ZABA 4X4HA 1W3VA 3MEPA 2D98A 4B3NA 1QDOA 4QT6A 1PVXA 4LO5B 3PMSA 3ZXAC 4Q4V1 4Y1ZA 2YZ4A 3FUQA 3KJXA 2J22A 2WO3A 5JLVA 2VVDA 2XJ3A 5FMDA 2QQWA 2BFUL 3ETPA 2BW8A 2PHDA 3HN3A 3ZN5A 1F8VA 1NERA 4XF0A 5AFBA 1NXD1 3FWEA 2PUCA 2RVAA 1HQ1A 2XVLA 2JXAA 1AX0A 4HSLA 2P34A 4LE4A 2Y0OA 1W2AX 1ASJ1 3GBFA 1CAUA 1JOBA 3CJIB 4Y3OA 4JC1A 4W6XA 2WJSA 3JCIA 4WVVA 3UT0A 2P3KA 2K0GA 1OLMA 4RHV3 4JAAA 3VBUC 5AC91 3NV1A 3IWZA 1LB2A 4FSJA 3JU9A 5IK5A 1UYZA 2R1BA 1CAXB 4LORA 1PO22 2RS32 4ET7A 2GN7A 1UZVA 2CL2A 3WZ1A 3CBNA 5LRRA 3TRBA 4HSJA 3HAGA 5FAXA 5LK7B 2A73B 3HMYA 1Y9QA 4LK7A 3M3OA 1MS5A 1UXXX 4URTA 3AVRA 5FPVA 2QQPA 2D3SA 4DXSA 3HNBM 2VXJA 2DBNA 3K4AA 2YDEA 3QBQA 2QVSB 3OG2A 1G86A 2AR6A 3N36A 4PQ9A 5FYIA 3O7OA 4XCAA 4AVCA 2R061 1EAH1 1ZBA1 4QX8A 3V65A 3RZMA 3TN91 2E7QA 4Y26A 3B69A 3M3QA 3CKHA 4Q0VA 4D7TA 3QH6A 1H30A 3AXEA 4CVUA 2WSVA 2SLIA 1X8EA 1MS8A 5EJZB 4JGYB 1D2SA 3GZTB 4I30A 3IIIA 1NXMA 1PK6A 2VMDA 3ENRA 1JZ5A 3F6WA 1W2UA 4FFIA 5FPZA 1QQP3 1WW6A 3B3QE 1Y7BA 1WMXA 2ODRD 1JODA 5HCBA 1S4CA 4LK6A 2GRMA 3FYMA 1MEC3 5I8SA 1JMUB 1ND3A 3U75A 2HBTA 4CEYC 3ZFGB 1I5PA 2R072 1BK0A 3D0JA 1H1IA 4O9EA 4QU2A 3PVBB 3N9NA 1NG0A 3TFLA 2JIJA 3PVEA 3J9SA 2A71A 4QPGB 5C9AA 1KRIA 3WW1A 2PUFA 5FZBA 4XABA 3KGLA 4GH4A 1AJKA 1H6XA 4QKBA 3RWNA 3AYCA 5CU1A 3NMBA 1IKPA 3FHAA 2CGPA 3RZZA 2R63A 2WC2A 2Q8CA 2A3WA 2WNVA 1SFNA 5T5LA 2E26A 4LEJA 2VMGA 1QJX1 4MXWB 1IGOA 4J1XA 4BLJA 4IGOA 2DYCA 1LHNA 1SBFA 3T2OA 4CDWB 2KA3A 5DAXA 2O4AA 3AXDA 2JICA 4IA8A 2UU8A 4IE4A 3GZDA 1UZWA 2VW1A 3U4XA 1PGW2 3M4FA 3OBRA 2QQNA 1XWRA 3VK0A 3TRSB 2CTVA 2AWIA 3IMMA 1NA1A 1O3SA 4BCUA 5A6ZA 1PMJX 3CJXA 1UTXA 1PIV2 4H2AA 2A5ZA 2PAEA 4YGBA 3OPWA 3AP9A 2W91A 3VZJA 4BM8A 4A3ZA 3NL1A 4RS5B 2DVDA 1GZTA 4ASKA 1V6NA 1WLCA 4PU7A 3MO4A 4GALA 2I45A 1OUXA 1H9PA 1B35A 1IKQA 2VZPA 5BPXA 2QQUA 4WM7A 4P00B 4TXWA 5L9VA 3DGTA 3PVOA 1JZ6A 2Q0AA 2Y33A 2YC0A 5T55A 4IETA 2CWMA 4HPKB 4C0HA 4CRQA 4UAPA 4O65A 5IUQA 4W6YA 5FYVA 1XC6A 4Q0UA 4DZGA 4A6SA 4Q4V3 1QOTA 4WZFA 4Z58A 3N7KA 5FUPA 1CWPA 2IVBA 3KQRA 5IATA 5CFDB 5CNAA 3LDRA 1HN1A 3SCHA 4YG4A 2R1DA 2VTFA 4EN9B 1T6GC 1H1MA 4YVSB 1HRV2 2XVGA 3I54A 1QY4A 3LOIA 1K5MA 1QJU1 1PMIA 1ASJ3 3SISA 4CP9A 1QB2A 3IDBB 4A7YA 3WQ0A 3LPFA 2E51A 4I09A 3MHZA 1POV0 4LBNA 5AC93 5BNQA 5FOJB 2EWTA 1NCQB 4XURA 5C3SA 2ILMA 1I6XA 2PXEA 1GV9A 3O12A 5ANNA 1JYWA 4K7JA 2P3JA 4XHXA 4AEDB 5C70A 2LM3A 4AQ6A 5K0UB 4AF9A 1YFXA 3F52A 3NV3A 4BJ0A 2BPA2 1SHWB 2OW4A 4MGKE 4AQ2A 2HWB1 5JXIA 1WW7A 4YM3A 1E5RA 4CU9A 3RZHA 4I6RA 3O1TA 3MGUA 2IFRA 5DT2A 1GANA 2R1JL 3ZXFA 4BK4A 2ZA9A 2ZGRA 2CGOA 1OLQA 4QX5A 2CU5A 2VULA 2R063 3VBHA 1UKGA 1EAH3 1JYCA 1ZBA3 4MHUA 4QQHA 1ZVVA 3ALQA 3BB6A 4LBQB 3TN93 3WDTA 5CFCA 1EFAA 3E5QA 3TEPA 1W9YA 4NAOA 4OLLA 1ZZCA 4UFHA 4AL9A 5C6CA 2OA2A 3MICA 3CECA 5BXXA 3VBUB 1ZX5A 2WINB 2UYAA 1QOSA 3LEKA 4XF9A 3VV1A 4CPBA 5EXOA 3WG1A 3B9CA 2ZMLA 4IL7A 1ZM1A 4GWIA 2XG3A 4A41A 1EUTA 3CROL 2V5YA 3S57A 4L11A 4CU6A 3KD4A 4XAEA 4AVBA 2WUHA 4R4ZA 1TQ5A 1XB9A 2ZGKA 3WV6A 2XLFA 4COZA 2D3PA 1H6YA 2G4IA 4HVQA 3MF6A 3ORJA 2Q8OA 1SLTA 1RL3A 4X4BA 1WMDA 2VZ3A 1BYHA 1S0IA 3SEPA 5FTTC 3J8F1 3QYXA 5B4XA 4K1ZA 4ARYA 2BGCA 3EMRA 1W8UA 4YM1A 3KZ4C 1U12A 3NJXA 3Q8BA 5FPUA 1HXS2 1REEA 3AKRA 1O91A 5KXDA 1XE7A 4Z07A 2WDBA 3CMGA 3DYMA 2DFBA 5T54A 4A45A 3ZIXA 1XSRA 1UYYA 1QJX3 2EXKA 1YUDA 4LKEA 2DVFA 2ZMKA 3LQCA 4MHRA 4A42A 5JOYA 3LDKA 2EALA 3INAA 5LATA 3DPRA 2PLV1 3NNFA 1DLLA 3M9LA 5FY9A 2XXPA 1PVC1 2CY6A 4MCTA 4CUGA 2O1QA 1FAYA 1S2EA 2O0OA 4ER6A 1NCRA 5DUUA 2DCZA 2Y38A 5FZ9A 1QQAA 5L9BA 5HI0A 1UMIA 1LCCA 1YQ2A 1MQTB 2LS6A 1ZS4A 2PXUA 2UWAA 2VOWA 3IVPA 2PHTA 2WNEA 1W0OA 2IV1A 3IMNA 5FLHA 3ZFEB 4UBHA 1VBA1 2J7MA 4IVZA 2DTYA 2XVKA 4DEVA 2WQ8A 5IK8A 2LYKA 2FZ1A 2WT1A 4Y5SA 4ZU4A 1RHI1 5ERLA 3UKNA 3OQMA 3OCPA 4YWAA 3OSDA 5FY8A 3SEEA 1CAVA 2YBPA 1GZWB 1RUE2 4A3XA 3NDBB 1UU4A 3APBA 2V4AA 5C4WA 4EWDA 4HN0A 1B0NA 3VZMA 3MZHA 2PXDA 3GDBA 1GP6A 2W95A 1FOD1 1WCUA 4JDOA 4YW6A 1D4M2 1TME1 2NMOA 1DGWX 2ZGMA 2Q8EA 1HIXA 3WF2A 1H8TC 4N53A 3D3AA 1POV1 4RR3C 3VKLA 1W03A 4CEWB 2PFWA 3ROUA 2WAAA 2WN3A 3ACFA 5A1FA 1ACCA 3GZEA 3OEAA 2JWPA 2PMWB 4CE8A 1QJU3 5CVRA 4KWUA 2GZWA 4G4FA 4IEOA 5LZ6A 4DQAA 2ZX2A 4KI5M 4GAZA 3RG0A 3GN5B 4XJ8A 1W39A 2XQRA 1V9U2 2WT0A 5KHIA 3K2OA 1O4TA 2D40A 4LO4B 4FBFA 2OQ6A 4TYSA 1W9FA 1CESA 2CAVA 3IDEA 1QPZA 1LRHA 3LISA 3OWQA 4LHLA 2HWB3 1LULA 3LSDA 3UJQA 1OVSA 1LOBA 2D5FA 3BN6A 4WVMA 5C8CC 4MXVA 4XDOA 5A33B 4CDUB 2A6WA 2WL1A 4YW3A 2P6HA 2D97A 2CNAA 4QKNA 4AK3A 4FP3A 5DABA 4PIZA 2ZZQA 3TN92 3WF1A 1CZSA 3JBG1 4PDWB 1JW6A 3PUQA 1YCIA 2ZEXA 3NV2A 4OMCA 1GU3A 1QH7A 2V73A 4AFMA 2KEIA 3VZOA 1XRUA 3K51A 2VQ0A 2XXAA 3F2ZA 3MDPA 2YGMA 4TTGA 4NIDA 3JXBC 1F4AA 3BU7A 2WYFA 4LA2A 5F32A 2CSFA 1OURA 3UETA 1HX6A 2XSDC 3EBRA 5C3RA 2J1EA 2VZOA 4AR2A 4KQ7A 5FZHA 4ASLA 2GH2A 3BS3A 4UYBA 4XCBA 4FO9A 1UIJA 5A7OA 4FQZA 1LMB3 3WNPA 1Y9GA 1VBE2 2X10A 1PGSA 3KCXA 3VZKA 3WP5A 3NV4A 1KS5A 2GDFA 2VQUA 1HB3A 1W6NA 5A7WB 4EN0A 2VR4A 2J7UA 5DZFA 2Z4FA 2PUAA 3V0BA 3HVDA 1S55A 4LO8A 4OHZA 2CYFA 3WXPA 1YFWA 1W9SA 2QE3A 3PHMA 3VHOA 2RS12 3J8F3 5FO7B 3ZYPA 2C9KA 4V2VA 2XJVA 2P3YA 5A1AA 3HT1A 4PLMA 4DE9A 2HJIA 4E4SA 3THCA 3RDIA 3ITQA 5G04L 1R081 3RNSA 2D5HA 4MV2A 3VDDB 4FPFA 4LO6B 3FX3A 4FXKB 1QJX2 3AMNA 2AXVA 1IS4A 2B7YA 2BV4A 3VBFB 2RMU1 4HANA 4CXXA 1CPNA 5GZGA 3VDCA 2BNMA 1XYOA 1FXZA 3I3DA 3A4UA 4B1MA 2PLV3 4BQ4A 3ES4A 4O61A 4M3CF 1NT0A 1PVC3 3EXUA 5FP7A 5J37A 2O8OA 3SQOA 1QGLA 2PXBA 2BEOA 1ULFA 4S2FA 1PK6C 5A32A 1QJEA 3QD6A 2FHRA 4LOSA 3B94A 4I0AA 4EK9A 4MUVA 4XJAA 2VZRA 4HVRA 1SACA 5BV6A 3LGRA 2PAKA 2R041 1RIOA 3NKTA 3LPGA 1AYM1 2B5HA 4DXRA 1VBA3 4DFSA 4KNCA 4MX3A 1T2XA 2VD7A 3I2HA 5APAA 2XI8A 2W87A 3LOBA 1ND3C 1ZUGA 1EV12 1XNCA 1YHFA 4GQ7A 4LMFA 1RHI3 5A3MA 5D2AA 5GLWA 4OCTA 2VGDA 2W1UA 4KG0A 4EN7B 3PUAA 5C9AC 5ISLA 1UXCA 1RIRA 3GYDA 5BY5A 1HJFA 4YW4A 4BDVB 2HBUA 3SCGA 3FMYA 1XE0A 2PHFA 4GH4C 1FOD3 2DURA 3EHKA 4B1LA 1OH3A 3H3UA 4HMZA 1EP0A 1TME3 3IZOA 3WDVA 3ZYFA 4AHZA 3FLPA 5LA0A 1PM4A 3BYWA 4FOVA 1QXRA 2WNVC 1POV3 3GHMA 4K1YA 4HZFA 3MW4A 1FMD2 2X05A 2KZ8A 3G5GA 2GP5A 4JCXA 4S2DA 2RV9A 2AUWA 4EROA 1QNYA 2HKXA 3GZDC 4J25A 3WW3A 3LAGA 1RZRA 1UL9A 3KGZA 4X6QB 4C1WA 2FDGA 4IV3B 2FDFA 1NA1C 4H3WA 4UF0A 3UL2A 2RE9A 2WWUA 3NNMA 3LDBA 4HOOA 1Z78A 2KXLA 5DG1A 1F5FA 5E1RA 2VM9A 1MR5A 1D0GA 2VCMA 3CLPA 3LSEA 4LBLA 3SH3A 4LJHA 1YLLA 3J7NA 4QAWA 4JRAA 3D0SA 5DAPA 1B35C 4JGZA 3Q8CA 4JCKA 4AHWA 4AI8A 2VG9A 2FJRA 4F8DA 4WM7C 5SV8A 3ZOIA 3AYEA 3TAYA 2JX9A 4QHBA 1MZEA 3WP6A 1YI7A 3WCSA 3VGIA 3R09A 3IB3A 4RR3B 1ND2A 2W94A 1ODMA 2GNMA 2Y6LA 3IPVB 4YGCA 1OSGA 4A7KA 1J3QA 4A4AA 2WZPP 2UWCA 3JBG3 1MS9A 1NOVA 2EVXA 5A6YA 4QX1A 2R0FA 3FHQA 2VZQA 3A7QA 3ECQA 1CAWA 4CUBA 1ADRA 3M3IA 4GZ9A 3SKJE 4ZXEA 4CDQB 4CSWA 3RRDA 3M2MA 3ZN6B 3C2UA 5FYCA 3T3YA 1VP6A 3TNPB 2IXHA 2E32A 4OULA 5D8AC 3X29B 1W6PA 1HV0A 1F2NA 1WH6A 2D3RA 1K5MC 4IUGA 2ZACA 4XHBA 3T1LA 3BI3A 4FTEA 2FD8A 3TELA 1Y3TA 2A7AA 4LT5A 4QM8A 5CG9A 4C8DA 3UWPA 1KJRA 2EICA 4FP2A 1BDIA 1W8TA 3WUCA 1QWRA 3IAPA 1UIKA 3SXWA 1FV2A 1H2MA 3PURA 2P1BA 2RJLA 2D6KA 1RINA 2F4PA 2XR4A 4BQ1A 1WCKA 3VKMA 2WAOA 3HJRA 2XJSA 3LA7A 2QBXA 2Y6GA 4BISA 4BMBA 2ZGUA 1MFQC 1O5UA 4IWRA 5FXXA 1H9WA 2BGPA 4BE3A 1VBC2 2B42B 3G7DA 1R083 4PF5A 2P37A 3LCPA 4K3UA 5EJ1B 3VBHC 5CFCC 4BOWA 5JZGB 3HQRA 2RMU3 4RL7A 1UPSA 1CAUB 3V0AB 5FZ1A 3WCRA 1YYNA 5DMYA 1CVNA 1PVC2 3N9MA 1HV1A 1NAEA 1FATA 4JTNA 4NWWA 4AFDA 1SLAA 1AR92 5F5QA 5CBLA 3D82A 5IFPA 1HKDA 1VR3A 1BVVA 2MEV2 3MUY1 3VD9A 5FYSA 4MLOA 1Z7S1 3DXUA 2Y8KA 1ULOA 3EJKA 4Y22B 1FYUA 2VMFA 1US2A 3A22A 1L1MA 2R043 5M0TA 5HBAA 1AYM3 3K3NA 1F4HA 2RS51 1QMJA 2WFF2 2EIDA 4YG1A 2PPXA 2HWC2 3CIHA 4GB32 4KWKA 4NMIA 4NAMA 3RJRA 5AFEA 2ETEA 4YFWA 5JXJA 4UOJA 3AKSA 5GLUA 2P2KA 4HN1A 5T52A 2V5DA 2X5IB 3MLLA 3VL8A 1V6IA 3RYKA 2DU1A 3WEZA 4PU4C 3HPNA 1OXCA 3POFA 3Q9OA 4BZ4A 1RUH2 5F1RA 1RUF1 4G9SB 3WNXA 4XIKA 4ES8A 2WNUA 4P9GA 3KSCA 4DUWA 1XBFA 2QQMA 1DGLA 1XSQA 3L2YA 3SMHA 3I49A 2A75A 2Y6JA 4JTOA 4U36A 2K9ZA 1BMV1 1QJZA 5EYXA 1J84A 2MNGA 3M8LA 3NW4A 2PXTA 5DUVA 5JXHA 1NKGA 4M4RA 5FZ8A 5A6XA 4BH9A 1C1FA 1LTEA 2ZZJA 2ZGOA 4D7SA 1RUI2 3DPRC 3AJZA 3T30A 2YU1A 3DKQA 1RUG1 2ZHLA 1QKQA 3AX4A 1J3RA 4X6RB 4X4GA 4PU3C 3FMGA 4KGGA 5IK4A 2ZEWA 1NCRC 1W3XA 4FPKA 3T09A 2Q1FA 2J1UA 4CPBD 1LOEA 3ILNA 1STMA 3WF3A 5C9AB 4D7YA 1HB2A 4OI4A 4DUXA 3N9QA 5I0SA 1PGL1 3U3WA 2AEZA 3B02A 2DF7A 1N3PA 4LXLA 4B8EA 4GD4A 5I8YA 3ZXEA 1AR61 4E4HA 4LHKA 1JU3A 1F15A 4YG7B 4EKIA 1SFYA 4IDZA 5IT6A 2DCYA 1YJLA 2CAUA 2XUMA 3N7MA 5JSOA 2WNVB 2RJKA 5LWBA 2W5FA 4PT6A 2XPJA 3ZDSA 4HETA 1UY1A 3AMQA 5C4WC 3ZIWA 2JG9C 4Q4W2 5JR7B 4COWA 4RD7A 5ACA1 3NXHA 1IS5A 1UQXA 3IT8A 2BTVC 2NMNA 2Z42A 3ZDVA 1R64A 4P02B 1W8OA 4N53C 3NJYA 3OP9A 1IPKA 2HWD1 1NA1B 1OKQA 1GICA 2Y6KA 4UFMA 3U78A 4DY5A 1O4YA 4K6BA 4AI9A 1E5SA 2VW2A 5FXZA 2B45X 3SX0A 5JMOA 1VAVA 2Y60A 2XL7A 3GUUA 3QLQA 4L9BA 2OX0A 1QJY1 1UY3A 4QU1A 2JB4A 4W50A 1IS6A 4GQMA 1PZ7A 3BPZA 2D7FA 2FDJA 4W8JA 3AYAA 1ULGA 2OKXA 1V0AA 1WBFA 3DKWA 5L9RA 1UZ0A 1AYN1 1U2ZA 1VIWB 1WMFA 5C8WA 2CHHA 1GR3A 4IERA 4ISRA 1S0DA 4PIXA 4YVWB 3OOXA 1WGPA 3VBRA 5KXEA 2JDPA 3TEWA 1KXGA 1PMHX 4Q0SA 4I2OA 4QPIA 1W6MA 4B4RA 1DQ6A 1BLZA 2L49A 4N8MA 3ME5A 2JE8A 5A1LA 4ZS2A 1LEDA 2R49A 1VBB2 4QD2A 4Y1XA 2ERFA 2GC1A 4XF1A 4PI2A 1R082 5FZ7A 2C1FA 1L3JA 2J42A 4MZUA 3RVHA 1WA4A 5IHRA 1TMF1 3GNEA 4QKFA 4XW3A 2Z2SB 1RUOA 1VPHA 1PRAA 3ILRA 5C8CA 1X2LA 4N7UA 4UFLA 3SH5A 2BVBA 3THTA 1RVF1 3FLTA 5I0TA 2OZ6A 2W39A 4N9IA 5JMCA 2IVQA 3AKPA 3Q8AA 2AENA 2YU2A 3GCXA 1O3RA 1GSLA 5HXVA 3QF3A 1C8NA 3MFAA 1UY0A 2H6CA 2XLGA 2PXKA 1XNBA 1Z7S3 1C28A 3UGFA 1E3OC 1OVPA 2P3IA 4XOGA 1AYM2 2GAUA 3OGRA 4IE5A 5IWFA 2LYQA 3A9ZA 1Q3EA 1TNFA 1ZRRA 4GMP0 4MSVA 4XE9A 3DNVB 2O38A 2RS53 4P14A 1J59A 5FY4A 3UKTA 2BNOA 3POSA 4L8QA 1C5HA 5FZOB 2R0HA 4EN6B 1BDHA 1U5XA 3NQHA 1V6KA 3S5QA 1GQHA 3A21A 1WKYA 5CKNA 3T0DA 1RUF3 3ZMOA 1UY2A 2HLEA 3C7HA 2CGNA 5G05L 1KITA 2QZ3A 4N43A 3N7LA 4BMEA 3MPPG 1NUKA 3I2JA 4DPNA 2FMDA 2B9VA 1YSEA 1U5IA 2JJ6A 3DV8A 1DGWA 3HNYM 4XMIA 1JH9A 1HRI1 1RMU1 3U4SA 1R091 4JQRA 4AEKA 3H42B 3ZKYA 4I3GA 5FZ4A 4FI9A 4KG8A 4R8HA 3HNMA 5CA6A 1LHUA 1AR81 1RUG3 2VNRA 4YLZA 4Q27A 1VRBA 3O1OA 3N9OA 3QCWA 4RFRB 3FUOA 3BCWA 1JYXA 1JZ4A 2NZ9A 3WDWA 3EUSA 2ZX0A 1DQ1A 1XXNA 4IV1B 3WX5A 3OEBA 3WNLA 1JXNA 5CYYA 1X57A 2VZVA 2YPJA 5E8AA 3BOPA 2J1VA 1D4VB 2PHUA 1E5HA 3A0KA 5FO9B 4KWLA 1AR63 1HB4A 4J1WA 1OHFA 2PXQA 2WZR1 3I4IA 3ZSJA 2JDAA 2VOKA 4LE3A 4ER3A 1GNHA 4IW3A 4L99A 3QACA 4UW3A 2OIIA 4F7ZA 4Y24A 1BVP1 2Q8DA 1OI6A 1J58A 2YBSA 4ZKTB 2ZCWA 4Q4X1 5ACA3 5F3GA 3AP5A 3VD7A 3KL4A 4AAXA 5BNPB 1CZVA 5I0RA 5GZDA 2PYTA 1JN2P 1NQJA 1PRVA 2C6SA 4MADA 3JXSA 4IEVA 4LBJA 1SLLA 3WNNA 1NX9A 2HWD3 3VBSB 3D8CA 2WRAA 1Y7YA 1UU5A 5EFUA 4A44A 1RUD1 3N4MA 4IE7A 4DE8A 5EPAA 4GWNA 1QJY3 3D5OA 2ZGNA 2EF6A 1ULCA 4HKOA 1LAJA 3WDXA 1XNTA 1BJQA 4YW5A 2HEYF 5DQ0A 3ZFFB 3ZYRA 1HQWA 4TN7A 3AKTA 4ER5A 1WCQA 1SZBA 1URXA 3OYWB 3P3NA 5FP3A 3M3EA 3GXUA 4HFSA 2V3CC 3WW4A 3WG3A 1TNRA 1Q8SA 4F8AA 1AYN3 2PHXA 1G9BA 3MW3A 5ABJA 4C0BA 2WNOA 1UOBA 4FN3A 1W8FA 4OUSA 3ZSLA 2J1RA 1VB2A 1R1A2 3O9XA 2AC1A 2VCAA 2WS91 5LEKA 5C4WB 5DDJ1 4XUQA 5F5IA 4JGZC 5A7PA 3OY8A 3POYA 4L2NA 4LHSA 5JOZA 2JG8B 4Z59A 4TSVA 2GU9A 2N7GA 1DZQA 2YFUA 4N53B 1PX3A 3KV5A 1AL22 2G19A 3PLQA 4P5HA 4LKDA 1EYBA 1ND2C 4Y42A 2YROA 1U5YA 4HRAA 4Q8LA 3S6PA 2Y0IA 4HLTA 3OGSA 1TMF3 3AZXA 4FPGA 4XUTA 3PL0A 5FYHA 5FZGA 3AFKA 4ARXA 4B7KA 1N47A 2ZTNA 3LB9A 3USUB 1S7EA 3OB8A 3OQOA 2QDRA 2VJXA 4RQPA 4DIQA 3C7FA 4EYUA 5KR7A 1ULEA 2BYVE 1IHMA 1RVF3 4RGKA 2VOTA 1UD1A 4XFIA 2TEPA 4BIOA 1ENXA 5J1XA 4XJWA 5L7OA 3CNAA 5LA1A 1YQ6A 2VZSA 1WETA 1MVEA 1FT9A 2P4EA 4TLFA 5A3TA 2ARXA 1NY71 4DS0A 1IS3A 1WLDA 4KL1A 1NE4A 1RZRD 3PVNA 5FUIA 3NAPA 5IVCA 2C26A 2E31A 1S2BA 1ULDA 2WBKA 1JUHA 3RS6A 1NEQA 2J7WA 4MO3M 5D8AA 2QZ2A 2CSGA 1LU2A 4IEPA 4M3CB 4AI2A 4GKXA 3WNMA 3NWKA 3EB7A 3SNMA 1OC1A 4Q4Y1 4RHV2 2W0XA 3GF6A 1W6OA 5FLJA 2XBO1 3VBOA 2GMEA 4OI2A 3KMHA 2GMMA 4IEUA 4BQXA 1AJOA 2VNOA 4NRQA 4Z2AA 2R6QA 1VJ2A 2EAKA 4QPWA 4DEQA 5EIYB 1G9DA 1G8WA 3ZHMA 4FPYA 1UOJA 5EQUA 5F5CA 5AVAA 2X8KA 5FK8A 4WM8A 4D94A 1BMV2 4XETA 1Q8VA 1HRI3 2A6YA 4PIYA 1R093 1IPJA 5GALA 2BGOA 3GALA 1RUJ1 3E1F1 4XFAA 2WFPA 4XILA 4ZHNA 1GLHA 1ZVFA 3AL5A 2Q1MA 3HZIB 1AR83 4CCKA 3MFCA 1JOPA 4XBNA 3V56A 3GJBA 1LQCA 3PTYA 3T2QA 4P5YA 1A78A 3QH7A 4UXAA 2WA3A 3CF6E 1GOGA 4U2AA 3PIJA 4OFGA 5CKQA 2JE7A 5FZ0A 1S0BA 4ZY9A 1XYNA 2LROA 1O4ZA 4A6OA 2R32A 1QQP2 2IC1A 3ME2A 2WZR3 4FFHA 3URFA 3WR0A 1ZRFA 3SR4A 2ARAA 2HCSA 3CJIA 3NVCA 3PMEA 3WHTA 4G3YC 2EXHA 2ET1A 4AWDA 4AQTA 4Y1YA 5DSXA 3J7MA 1MEC2 2YBDA 4IE0A 5KHJA 4Q4X3 2D6PA 4OBMA 2WNUC 5T3NA 4NPRA 5HCHA 5FZMA 1YXWA 4I6UA 4O8BA 4E4ZA 4QDQA 3UGHA 3E6CC 5T50A 4CCLA 1J83A 4EKGA 1VRH1 4QMAA 4YYOA 3OD4A 2IWGB 1RUD3 3LFPA 1I3HA 3TEXA 1ONAA 2HWE1 3KZ3A 2XWBB 1C5IA 1RC6A 1NE6A 2LYPA 3LFIA 3PUIA 2F6BA 5FZIA 4NHKA 4NIIA 4UFKA 2WYSA 5FR3A 2EA7A 4X4FA 3LD8A 5LASA 3J4UH 4XJUA 5LY1A 3GBWA 1JH5A 4PLOA 4Z8BA 1DIWA 2IU7A 1LENA 1AR71 2ZPXA 3QOPA 3UYJA 1SEFA 4Q5OA 2GC0A 3H1WA 3H1YA 4EZHA 2BVVA 1Q56A 2WS93 4LR4A 4MG2A 5J3UA 5DDJ3 1KD7A 5FYBA 3WT3A 2KEKA 3AL6A 4PU8A 3M1HA 4XFCA 5FJKA 4CEYB 2WQ4A 1GOHA 1DYPA 4JGYA 4CP0A 3ZXLA 3ZPOA 1XU1A 1CPMA 3ZYJB 3N9LA 1O8PA 1W8ZA 2VTXA 1W05A 5JWPA 1VAMA 1DLCA 2GRLA 5DRYA 4Q1PA 1NLQA 3CHXA 1YO8A 2B5AA 3FYAA 1EPZA 4ASMB 2V09A 5JOWA 3THDA 2A1XA 1OKOA 1RB8G 3N35A 1QU0A 2PHRA 4CZSA 4UI9L 3ZFGA 4GHJA 3H8UA 1JYVA 4QQ2A 1UCXA 5AVPA 1UXDA 2JG9A 2AXUA 5DTRA 4QPGA 2H8RA 1BEV1 1YQCA 4AFAA 5FWJA 4Q4V2 4YBAA 3WLUA 4LLFA 2PXVA 4EQVA 3QOXA 3MIBA 4XFHA 4XFGA 3AZWA 1UYPA 4XDQA 2OT7A 2ID4A 2VTXJ 4QGNA 4XIOA 4LBMA 5E6HA 2JB8A 2JDUA 1N1VA 1NZCA 3SKVA 3ES1A 2VBBA 5IVFA 4R9CA 2GN3A 1SLIA 5FYZA 1ASJ2 1SBDA 3ACIA 1COV1 4R9AA 4CCNA 3VBRC 3I2GA 2UY9A 4Q4Y3 4RA0A 3VZNA 5AC92 4QPIC 3AVSA 2XBO3 2VO5A 2I2SA 3G0TA 2VOXA 2PHLA 3JB8A 1EPWA 4MCXA 4H7LA 2J1TA 2RM21 1UX6A 4XXPA 3PJQA 1QXJA 1W90A 4ONUA 2RJ2A 4JDMA 2AW6A 1PZ9A 1ZBE1 2XJPA 2ENRA 4XBLA 4RS5A 1KFUL 5FQ0A 2PUEA 3KF3A 3PUHA 1C1LA 2D6LX 2EIGA 4P9LA 4XFFA 5E89A 2V72A 1OA2A 4OHWA 3WD5A 1XE8A 2CV6A 4HBNA 4V1PA 1K45A 1JTZX 1IG0A 5FZ3A 2HWF1 5I93A 1RUJ3 1GUIA 4AYUA 4E8DA 4JX0A 1DYKA 3DXTA 2VMEA 4YZ2A 2R062 1AL0G 3N3HA 1EAH2 1ZBA2 1GP4A 3ST7A 1RJ8A 3MYXA 4FTBA 1CZTA 4HPKA 2PUDA 1OBNA 4FQ4A 2IXCA 3O1VA 1NQDA 1XJAA 3NZLA 1UYXA 2W47A 4BB3A 5FJHA 2NP0A 2VCBA 3A9XA 3AZYA 1J3PA 4M0HA 1I9RA 5I0UA 4FT8A 5CFDA 1UKRA 1VBD1 4JCYA 1CIYA 2P6CA 3R4SA 2I07B 3H3LA 4YVSA 4HK9A 5C5TA 1LCDA 1AZDA 5FMBA 3LA3A 3MF9A 2E53A 4XDPA 5L73A 3H5TA 2IXJA 5IFTA 2O14A 4ZXKA 2A3YA 1IQAA 2ZAAA 3ZHIA 3L2HA 4Y5TA 2YV8A 4OQ8A 1JYNA 1C8M1 1UPIA 4NN0A 4LBOA 4N43C 1CJDA 3KV6A 4E27A 4DRVA 3FC0A 3SH4A 2E6VA 4AEDA 3BD1A 5EP9A 3FFQA 2A70A 5FPAA 4QB2A 5LCWL 1VRH3 2VQTA 3IAQA 4IXLA 4KMQA 4QQLA 1RUC1 1BXHA 1VE0A 5GJ6A 2HWE3 4DO0A 5LK5A 1LOFA 1I5ZA 1ZRCA 3I3EA 4WZCA 3T2TA 4EN8B 4XTMA 4FPLA 3RI8A 4QXBA 3RYPA 3A23A 2RDQA 3AMHA 3POBA 2JQEA 1V00A 4LBQA 5KBFA 1CD3G 4H55A 1AR73 3OUIA 4KGQA 1MZFA 1PX4A 4DOUA 1DP0A 3C3VA 1L7RA 1W6QB
chains in the Genus database with same CATH topology
2E7TA 4JVAA 4YGEA 3WQ7A 2JKBA 1H0BA 1LKNA 3BDNA 4XJZA 5KXCA 5FBZA 4KBBA 1DZRA 1PNRA 4Z1VA 4OI1A 3KLSA 2PUGA 3KXAA 3WDYA 5K98B 4YSFA 1X33A 2BBVA 2A6ZA 1OA4A 4W65A 2HSGA 2BWCA 2P17A 4FPOB 5JIUA 4Z5DA 2LCVA 4GIQA 4HKLA 4K40A 2YYOA 3ETQA 3B5LB 1BEV3 1MS1A 1SCSA 3EO6A 4XMAA 4QXKA 1LLIA 4LHNA 3LZZA 4IEXA 1QXPA 2O8QA 1CR7A 4L92A 1XNKA 1LECA 1O5LA 1S0EA 1QJU2 5ABJC 5JCTA 2MEZA 1COV3 4CTEA 3JQWA 1IC8A 3O14A 3S0MA 1AXYA 2WA4A 1WMEA 2VH9A 4XFBA 3HQXA 2VOVA 2RM23 1QP7A 2ZOEB 1PO21 2RS31 3IDCB 4HT1T 2ZMNA 2RR11 1MQTA 5A3LA 2HWB2 2XJTA 4FOYA 3ZFEA 1LHWA 2AGSA 2ZGSA 4AG4A 1GT0C 1G9AA 1DG6A 3AP6A 1U0AA 1LHOA 1POUA 4RQPC 1QF3A 1H8TB 1RUJ2 3WP4A 1S2KA 1OLRA 1BBT1 2FQPA 1I1EA 3KT4A 4L97A 4P9JA 3ZSEA 3WG4A 3J26N 1GZWA 5L7OC 1Q43A 4Z82A 4COUA 5FOBB 3KM5A 1RITA 4FVVA 4E9KA 2IXLA 1YNAA 4B29A 4YG0A 5FMOS 2IXIA 3I59B 5KWRA 2IVGA 3NAPC 4XJ9A 1V6OA 5BNNA 1WCDJ 2AH2A 1VBD3 3ZO0B 4YM2A 2XKPA 5FFOC 1HDKA 5CIRA 4AE2A 2BQPA 2NLRA 5H9RA 1DQ0A 4D3WA 5F6KA 2QUOA 1A3KA 4XQ4A 3VBOC 3OF1A 5C8CB 5JPNB 1FNZA 4AEJA 4YZ1A 2HEVF 1CONA 2VUJA 1C8M3 3GN5A 2PIJA 5GLVA 4LTAA 2W52A 2ZHMA 1DQ4A 2R071 3PXPA 5J09A 1LCLA 3J8F2 1LEMA 4WM8C 5JVVA 1CJGA 2HWE2 1RUC3 2A3XA 4AHYA 5A33A 4CDUA 1ZREA 1NLRA 4X8NA 2LALA 4YNIA 1BKZA 4S2HA 2PHWA 1JUIA 3O0XA 2Z69A 3OTFA 5FRAA 2ICTA 2PQQA 2PLV2 4X4EA 5IK7A 1RZSA 4PDWA 2HINA 2KPJA 3FE5A 1PGW1 4MVTA 2ZHNA 2WIUB 1WLWA 1GZ9A 3HIFA 1PIV1 3MIDA 3CJIC 3GZUC 1SDWA 3H3ZA 3JB4C 1VBA2 1O7FA 4ATFA 4XQDA 2DV9A 5E88A 2WT2A 3VKOA 2ARBA 1AXZA 2LYRA 1DWKA 5H9PA 1RHI2 3B00A 2JCGA 5HCAA 1CQTA 5JI9A 4YZ4A 1DW9A 2XLAA 3ZMNA 4S2GA 3UKVA 4Z5CA 1WW4A 1FOD2 4P9XA 2DCJA 4BA6A 4NHLA 1X82A 1TME2 4FAHA 2TNFA 5JIAA 2C9AA 1LOGA 3VHNA 1X36A 2GZUA 1YFUA 1HQLA 1SLCA 3VDDA 1G6NA 1PK6B 4EJRA 3MLKA 3SLIA 1G9CA 3VBFA 1QHDA 3HN1A 1HRV1 1PZ8A 2PAMA 3I7DA 5FDBA 2D5VA 3KCYA 1V6LA 4Y4YA 3OPZA 1OD5A 1ND3B 4JGYC 1OMIA 5JOXA 1NLSA 4DB5A 1PO23 2RS33 2RHPA 4HKWA 2RR13 1GKBA 2GNTA 2HYKA 2Q1ZB 2ZX4A 4B4QA 2DWRA 4GH4B 1SCRA 1G7YA 4DMIA 1JWLA 1APNA 3HBZA 4Q29A 4CYDA 3D6EA 4HK8A 1ZZ7A 3ZFGC 1BBT3 1O4XA 3JXCL 2JVLA 2XIUA 2I74A 3UJOA 2LYSA 3JBG2 4QPGC 2BFUS 4JDNA 5KHHA 3AP4A 2EBYA 4JQDA 2TUNA 1ZRDA 3OY8B 4FTSA 4FAGA 4AI1A 3ZXDA 1OQ1A 3B7HA 2GALA 2B46X 3WUDA 4CDWC 1ZNPA 2D6MA 2VUAA 1B35B 3LA2A 4M00A 3ELNA 3ZSMA 2GC3A 4AVTA 4IV3A 3WQ1A 3DL3A 4WM7B 2ZGPA 4FBIA 4RQPB 3VHPA 4OUMA 3M3CA 1C3HA 2ZJCA 4H7MA 2ZX3A 4RS5C 2R073 4QM9A 3ZYIB 4Z2WA 3GBGA 1ALYA 4E2GA 4BPZA 4CDXA 4XXAA 3U07A 2DVAA 1HXS1 1S1AA 3SHRA 1SQ4A 2X53S 4DNYA 4NWVA 4QGLA 5J96B 1V6JA 3BOWA 5D8AB 2RMU2 1KJLA 4R9DA 1JYIA 3IPVA 3ASIA 4LUKA 1K5MB 2ZX1A 1Q8OA 4GULA 3QQ6A 2XWJB 4GA9A 4RSUA 5DZGA 4YW2A 1ZZ9A 2QJVA 3I2DA 3JD71 3A0NA 4OB4A 5CFDC 3DUIA 4CDQA 3CL1A 3ATGA 3ZN6A 1PIV3 4M0NA 4YVSC 2GNBA 4ISQA 2R042 2W68A 4WM8B 4I01A 1E57A 1F9KA 4YW1A 2C5DA 5A7LA 1BZWA 2TBVA 2A6VA 3AK0A 4WBBA 3ZXJA 4ZU5A 1M4WA 3VKFC 4Q0QA 4AEDC 3VBHB 3RPQA 4I3PA 1ZZ8A 1RUE1 3BALA 5CFCB 1UW8A 2H6BA 4BHPA 1S0GA 3MIHA 2DVBA 2XB6C 1AXKA 1D4M1 4PCRA 1LOFC 4GWMA 2Q30A 2FZ2A 3THPA 3MIGA 1VLNA 3B9IA 4XF4A 5KHGA 4B7EA 5JZGA 1YIPA 3HWJA 2D6NA 3UFDA 1HRV3 3V0AA 1UN1A 2QDNA 3R0RA 1XQNA 2ZGTA 2B39A 2XGXA 3WP3A 3RI9A 4I8TA 2FMYA 4OHVA 1V9U1 4MGYE 2RR12 1FX5A 2VECA 2IUOA 4FOWA 2R16A 4LBKA 4Y22A 2D6OX 2WIIB 1N3OA 5F6LB 1X50A 1BBT2 5DXDA 1KDMA 4AGRA 2XL9A 1AUYA 4IEWA 4XPVA 2X5IA 1R69A 4BIFA 5CB7A 3ZXKA 3DPRB 3E5XA 3VN4A 2WLPA 1XU2A 3K48A 4Y5Z0 1NCRB 4A7ZA 2AZ5A 1S0JA 1N1TA 1M06G 2JENA 2G9FA 1AHSA 1SBEA 3W9AA 2JEMA 4LBQD 3DN7A 4YZ3A 3WDUA 3VKNA 5K8SA 3H50A 4X8PA 3TBDA 2NQYA 2DCTA 4O9GA 1VBE1 1GQGA 5T5OA 1CAVB 1CIWA 2H0BA 1MQTC 3WG2A 1FV3A 4NOTA 4AFCA 4MGZE 3ZFEC 1LU1A 2JG9B 3RYRA 3T1MA 3RQ0A 2RS11 2ZAHA 2MQKA 2YXSA 3TWIA 3WW2A 1HXS3 4LUMA 2E63A 3AM2A 5JI7A 5BNOA 3WVJA 1WUVA 1WIZA 3FHIB 5JDBA 1QP0A 1X8MA 5GM0A 2W08A 4XZPA 4GMP1 4YG6A 1UMZA 2DCKA 5BNNC 2PELA 3JD73 1GBGA 5EZWA 5K9YA 1LR5A 1Z7S2 1YI9A 2JE9A 4NR1A 5FQ0B 2LUWA 5GLTA 5J48A 1RJ7A 2D43A 2BJCA 4WVMB 1WLTA 4YGDA 1AU7A 1LOAA 5E16A 2RS52 3N7JA 4PBPA 2B9UA 1PO11 1EV11 2OFYA 1OOPA 1X7NA 4YVWA 4R52A 3MW2A 1B09A 2CWSA 1OQEA 4F3JA 1A8DA 1RUF2 1RUE3 1UU6A 4XF3A 4AVAA 2JD4A 4QQPA 1KQRA 4TWTA 1UF2C 5B2GB 3KT1A 2NM1A 1D4M3 4CDUC 2SBAA 4CP2A 3POWA 2ZGQA 5HCFA 1SMVA 4AEMA 3MLJA 3I8TA 1RMU3 1FMD1 4JV4A 1YJKA 2X29A 3MIEA 3FJSA 4BWOA 4PBOA 1LHVA 2UWBA 4PDWC 1Q8QA 1RUG2 2WWSA 5FPXA 4K20A 2VY0A 3KS7A 1W6NB 4LNVA 1G9FA 3L9JT 3V0BB 1V9U3 3VUOA 3TNQA 1PGL2 1LODA 4CP1A 1ENQA 2OPKA 1AR62 5K0UC 3D1NI 3MIFA 1LJ7A 4IEZA 3HT2A 1HW5A 3H1MA 3CU7A 2QNKA 3RJ2X 4AXOA 1H1AA 3IM0A 3H0OA 1IZ3A 5ACA2 3FZ3A 2JDZA 2PN5A 4RFT0 1CN1A 1OQDA 1CAXA 5GZFA 5JAXA 1Q8PA 1H2NA 2HWD2 1DQ2A 1V70A 4WVWA 3VDDC 3HR9A 5A32B 1ZAYA 5H9QA 1GZCA 2WLQA 1QJY2 3AJYA 5T5JA 2AREA 1WD4A 3VBFC 2IXKA 3B01A 5KXBA 2AYHA 1XYPA 5H9SA 1HQNA 3R1FA 1FPN1 3FBYA 1UZZA 4K8FA 4COVA 5GZCA 5DUXA 1AYN2 1WD3A 3P3PA 5C33A 3H7YA 1JFSA 1VBE3 2Z5WA 4BYYA 5FO8B 1RUNA 4J6GA 1AF9A 4DXZA 5EJ3A 4IV1A 3F51A 5K7PA 4LLOA 1PNGA 2RS13 3O5SA 1LOCA 3AKQA 3FLRA 4DRRA 1VBC1 3W59A 2XJUA 4RGAA 1R1ZA 4AI3A 2KM2A 1PRUA 4XEZA 1TMF2 1S0FA 1LGBA 3AP7A 1QP4A 1H4HA 4GKYA 5BNPA 4FPJA 2VMIA 3NJZA 3WHUA 2C0ZA 1RVF2 1H2KA 1QH6A 1OFSA 4YG3A 1DU3D 4GMP3 4SBVA 3JD72 2NYYA 1AR91 3ZYGA 5I91A 3VBSA 2DVGA 2MEV1 3TOJA 1OSLA 2FBEA 2PE5A 4FPHA 3AFGA 1JOJA 3ACLA 2Q5TA 4JGZB 3ZFFA 4MH0E 4ORFA 4IV3C 1GNZA 3OMTA 3OYWA 3JZVA 1OCTC 4MXWA 2WFF1 2A6XA 2OYZA 5CG8A 2HWC1 4GB31 2VVFA 4P9IA 1AX1A 1PO13 1ND2B 4CDWA 1EV13 4TZDA 1MVQA 1ZYBA 1GFF2 1MACA 3H7JA 4UW5A 2D93A 1Z0HA 3RMYA 3ZN4A 1CX4A 3PNAA 2IZWA 1RUH1 3AMMA 2ZKLA 4CDXC 2GH8A 1CAWB 2JG8A 4X4DA 1MS4A 3KT7A 1AVBA 5BNNB 1HRI2 1RMU2 1R092 1LGNA 1GYKA 1W6PB 1FMD3 1DF0A 3GHNA 4MYEA 1KDKA 3USUA 3ZKCA 1RUI1 4UBGA 1AR82 4XQWA 1DHKB 3SCFA 1VALA 1V6MA 4NHMA 3MI8A 4YZ5A 4CDQC 3CLCA 1NYWA 1SQ8A 3IN9A 4OHYA 1WCSA 2JECA 1LGCA 2VNGA 2DUOA 3B7MA 2WZR2 1YFYA 3OGGA 4M3CA 1RPEL 3ZX7A 1J1LA 3GZAA 1KFXL 2BNNA 2G9GA 4ZU7A 1D0HA 1FI2A 4Q4X2 4Q4W1 2QFEA 1NCQA 4OVEA 4YRDA 3W58A 4WVZA 1PHMA 1D2QA 2WSUA 3AYDA 2ZS6B 1PNFA 1SLBA 4P9YA 1RUD2 4META 4FPCA 5BUVA 5JZGC 2AUYA 4OHXA 2YMZA 1W0PA 3H9AA 1FPN3 2Z79A 4Y20B 3DF0A 5L36A 4EV0A 3AB0A 4AHXA 2D44A 5FCCA 4R4XA 2WS92 5DDJ2 2H0VA 3VBUA 1ENRA 1QDCA 1YIFA 5KC6A 2YGLA 2WNUB 4LULA 3JQXA 3TB0A 1VBB1 1VBC3 4Q26A 1BK1A 4HL0A 2X5IC 4E2SA 2HEWF 4M3CE 1LESA 2DUQA 3RMXA 2PTMA 4FXGB 3CEWA 1KS4A 2GSYA 3D4KA 1CGPA 3ZXGA 1BCXA 1MS3A 4GXLA 1ZA4A 3USSA 1AR93 2E9QA 4KWJA 4PJYA