1ZZ9A

Crystal structure of feii hppe
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
192
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKEPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 44
structure length 192
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz9A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz9A02
3OTFA 1IPKA 1SQ8A 3HZIB 1U12A 3RZZA 2PUEA 3IDBB 3BDNA 1NE4A 3QACA 4N9IA 2LCVA 1DGWA 2LYSA 1EFAA 4LA3A 1QQBA 1YHFA 4H7LA 4Z5HA 4XFHA 5FQ0B 1R63A 4BHPA 3RPQA 4FAGA 1G6NA 1UXCA 5I0SA 4I6TA 2PUBA 3E6CC 4ONUA 4Q29A 5KHHA 2AWIA 4X4FA 4JCYA 3BB6A 3RNSA 2OFYA 2B5HA 1J3PA 2ZCWA 1CAXA 3H3UA 3NL1A 5FDBA 4IWRA 4YG7B 2E9QA 3ZHMA 2OR1L 4PU8A 1PERL 1ZZBA 2VPVA 4EWEA 3KJXA 5BY5A 4F8DA 5EFUA 4BIFA 3CROL 1ZX5A 5T3NA 1CAWB 3QQ6A 4MGYE 1O4XA 4YARA 4P9GA 3OGJA 5BUVA 3M3IA 4GHJA 2XLFA 3DL3A 1JFTA 4J1WA 3DN7A 1NXMA 4LTAA 4Z5DA 2Q0AA 1RL3A 1TQ5A 5I8SA 1LR5A 1XE8A 4X4EA 3D1NI 3HIFA 4HBNA 3OQMA 3ZKCA 5LRRA 4X4CA 2OZ6A 3CF6E 3USSA 1PNRA 5LEJA 4QM8A 1CAXB 2CAUA 2PE5A 2ET1A 3NVCA 3WW1A 2MQKA 4EWDA 3UFDA 4WVZA 3E5XA 4KWLA 1UTXA 2XI8A 5J48A 1S7EA 3NW4A 4HN1A 3FMYA 1PM7A 2PUAA 5HI0A 1VJ2A 3U11A 2XL7A 1CAUB 4FN3A 1BDIA 4FAHA 4FT8A 5K8SA 3MLFA 2IXKA 1JWLA 4XFAA 4AQ2A 2C0ZA 4HSLA 3MYXA 3LA2A 4I2OA 3OQNA 5I91A 3KCCA 3MPBA 2ET7A 4DINB 2AXZA 3EBRA 5I93A 2LYKA 2QDRA 1GT0C 4JTOA 2JCGA 1NEQA 1UW8A 1GQHA 4HLTA 4QMAA 4Q0QA 3IDCB 3R1FA 2B8MA 4PJYA 2VQAA 1O5LA 4HVQA 1L3JA 3ROUA 1WH6A 4UXAA 3H7YA 2IXJA 2ATFA 5CU1A 4KWKA 2GH2A 3BCWA 3SCFA 3F52A 3KSCA 4L11A 4LEJA 1O3RA 2IU7A 4HZFA 2CGPA 4XFIA 3IBMA 2EBYA 3I59A 2HINA 4GQMA 2IV1A 4XFCA 3EUSA 4IEZA 3JXDL 2LYJA 1WH8A 1HF0A 1WIZA 3H3ZA 1RTVA 3F51A 4IEQA 1I6XA 1UD1A 1XRUA 2QVSB 4D7TA 4X4BA 1B0NA 1RZRD 2ETEA 1PRAA 2GU9A 1J59A 1FT9A 4HSJA 3SHRA 2IVQA 3B02A 2XCJA 1X8MA 1QPZA 2H0VA 1ZRDA 4YG1A 4MH0E 1O3SA 3ACLA 4I3PA 1YFXA 2V09A 2Z69A 3ZDSA 1Y3TA 1JFSA 3GBFA 2DCTA 1OSLA 2Q4SA 1VP6A 2ICPA 2OZJA 3GYDA 4PU7A 2MEZA 1NYWA 4GULA 3OD0A 5JSPA 4X6QB 4Q0SA 4IVZA 3DNVB 2N7GA 4MGKE 4KU8A 5BPXA 4XF1A 4E2SA 4UBHA 1RPEL 3CLCA 2GC0A 2PIJA 1CX4A 1DZTA 4EROA 5FPXA 3CLPA 1Y9QA 5I8YA 4NVPA 4WZCA 3WW3A 3EHKA 3PLQA 4Y42A 4IEWA 1Q5OA 2GZWA 2LYPA 1EPZA 3RYRA 1QQAA 3PVBB 3UKTA 4BYYA 5FLIA 2AXVA 1UIJA 3VHRA 3MZHA 2PA7A 2PYTA 3FZ3A 3QF3A 1O3QA 3ELNA 2OA2A 2OPKA 3G5GA 3KGZA 4LA2A 3U0ZA 1X2LA 5FCCA 3S7EA 1QXJA 1IC8A 4X4GA 3MDPA 3SMHA 1ZRRA 1VPWA 3WW2A 2HJIA 1QWRA 4AXOA 2HKXA 5FLHA 3FWEA 1GQGA 1J3RA 4HVRA 3QWGA 1ZS4A 1RZRA 1ADRA 1UXDA 3OP9A 1QP7A 3SCHA 5KHGA 2QNKA 3C3VA 2D93A 3PNAA 2D40A 2LYRA 1ZZ6A 3M70A 4D7SA 2O4AA 1ZNPA 2KPJA 2KEIA 3F6WA 2H8RA 2H6BA 2F4PA 4FBIA 1HW5A 3I54A 4N9HA 1RUNA 3ZHIA 1UCXA 4PIZA 2GC1A 5EZWA 2EAAA 1YUDA 4AQ6A 4AVCA 1ZAYA 2GC2A 2A6CA 3CJXA 2HSGA 1BDHA 3D0JA 4QGMA 2BGCA 2GZUA 2PHLA 4I02A 4IA8A 3D0SA 1J58A 4IEUA 4XF0A 1H1MA 1POUA 3DV8A 2IXHA 2XGXA 1YLLA 2K9ZA 3EQEA 3LA7A 3O9XA 1ZVFA 1O5UA 1DW9A 2PAKA 2OYZA 4I6UA 5C6CA 4XFFA 3SXWA 1OD5A 3LAGA 3BS3A 5D1IA 1PRUA 2KEKA 2EWTA 1CJGA 3E6BA 3IIAA 1ZVVA 4BH9A 3KGLA 3SCGA 5K98B 3GN5A 1JH9A 2FJRA 3JXCL 2L49A 1EP0A 3B7HA 1CQTA 3ES4A 3E5QA 1RZSA 3N4MA 1DGRA 2BNOA 2UYBA 1R69A 1Q3EA 4MX3A 4JCXA 4NDWA 1JUHA 3EJKA 1CAWA 1EY2A 1QXRA 2KZ8A 4FBFA 5JSOA 4TLFA 3FYMA 3U10A 1LRHA 3RYKA 3D82A 4IEPA 1WA4A 3FFQA 4I8TA 1NERA 1WLTA 2BEOA 4LLOA 4XEZA 3FX3A 3JZVA 4XF3A 1FI2A 3QOPA 2PUCA 4E2GA 4LUMA 3G7DA 2QCSB 1RIOA 2I45A 2XKOA 3TNPB 1LMB3 1CGPA 1RC6A 2PFWA 2B5AA 1WETA 4YYOA 2CROA 4CYDA 3FYAA 3HT2A 2BNNA 2AXUA 3NKTA 1PRVA 3OCPA 4O9GA 1J3QA 1ZREA 5BV6A 2XLGA 4I0BA 2Y0OA 4L2NA 3GN5B 4MV2A 4QGNA 1CAUA 4MGIE 2FQPA 2K0GA 3OMTA 5KHJA 3HT1A 1ZZ7A 4MCTA 1QP0A 3LWCA 1O7FA 2KEJA 3H50A 4JV4A 2D5FA 3PXPA 2IVBA 3L1PA 5CADA 2PAEA 2WFPA 2D5HA 3UKVA 3LOIA 1SEFA 2BYVE 5JCTA 5I8TA 2IXLA 2R63A 2CAVA 2WC2A 1OI6A 4LULA 4K8FA 4F8AA 4KWJA 2QJVA 2AW6A 4IEYA 4Z82A 2IVGA 1LKNA 4OLLA 5JR7B 3JXBC 4OB4A 4MZUA 5J7MA 1X57A 5J3UA 1QP4A 5LRSA 2EA7A 2XSDC 3U3WA 5KHIA 2O1QA 3LFPA 4X4HA 1LQCA 4I0AA 5FLJA 1ZRFA 2XLAA 2JVLA 1XE7A 4AVAA 2BNMA 3I59B 4XFGA 4EWAA 3KXAA 2PAMA 1X82A 4XFBA 3TRBA 2Q1ZB 4XETA 2XHKA 3WW4A 3H7JA 4PU4C 4MUVA 4IEOA 2R1JL 3H1YA 4IEXA 1ZZ8A 4I01A 4I6RA 2MNGA 2IUOA 1OCTC 5KBFA 1O3TA 3CO2A 3L2HA 4HN0A 5I0RA 2EVXA 5C8WA 4XF4A 5AVPA 3DKWA 2XKPA 3I7DA 4PIYA 3IWZA 3KMHA 2EF8A 4JQDA 2Q30A 2PPXA 5FPZA 4KL1A 2D5VA 1Q43A 4J1XA 1ZUGA 3H8UA 4X6RB 1OMIA 4X4DA 4META 5E16A 3R6SA 3H5TA 2PUFA 1I5ZA 4O9EA 4R52A 5A7LA 3FJSA 4PU3C 3UKNA 2CSFA 1UIKA 1H1IA 1CAVB 3CEWA 3CL1A 4QM9A 5I0TA 4Z5CA 2MPFA 4YSFA 3FE5A 4YBAA 2LYQA 3BD1A 4QGLA 4IEVA 3BALA 2UY9A 4EV0A 1SQ4A 3O14A 3E97A 1IPJA 1AU7A 3LISA 4X4IA 4ZU7A 4XF9A 1YFUA 1ZZ9A 3QYXA 2MHFA 1LCCA 2PTMA 4Z58A 2BJCA 1Y7YA 2ICTA 4MCXA 5E1RA 2B9UA 2ZKLA 3HQXA 4Q0VA 2KXLA 5FQ0A 5BXXA 2XJ3A 2O8QA 3H1WA 2P17A 2IXIA 3LA3A 5I0UA 4RD7A 5CVRA 4YRDA 1YWKA 1EYBA 4HMZA 4QX5A 3OF1A 1NZCA 3RDIA 1LCDA 2PQQA 1L1MA 2LYLA 2CV6A 1SFNA 3FHIB 3BU7A 4PIXA 1ZPQA 4OFGA 2IXCA 2WIUB 1PMIA 2XL9A 3E5UA 3TNQA 1CAVA 4Q0UA 5KHKA 2O49A 4ZU5A 4QXKA 4UBGA 4IERA 2Z2SB 2UYAA 3H1MA 5LEKA 4YNIA 1X8EA 3OQOA 2IC1A 4A2UA 2H6CA 5JAXA 4ZU4A 4Q0PA 5JSRA 1NE6A 2GRLA 2FMYA 2PHDA 3E6DA 3ETQA 2WUSR 4LUKA 3CECA 1YFYA 2GAUA 1J1LA 1RGSA 4AVBA 3ES1A 4YG4A 3NJZA 5F1RA 2O38A 4JTNA 4MGZE 1UPIA 3S8QA 2UY8A 4ORFA 1YSEA 3S0MA 1LB2A 2GC3A 3NSTA 4R8HA 1DWKA 4Z59A 3LZZA 4KU7A 2AUWA 2VECA 4IETA 4WBBA 3IVPA 2GRMA 4O8BA 2L8NA 2PUGA 3EO6A 3S7IA 4E2QA 1DZRA 1X7NA 1YFWA 4HVOA 1QY4A 3RYPA 1FXZA 1XWRA 1O4TA 3H9AA 4I09A 4IESA 3KZ3A 3VK0A 2PUDA 3ST7A 4JVAA 3BPZA 1LLIA 1V70A 4F7ZA 4B29A 1ZZCA 1WGPA 1ZRCA 1OFNA 2XIUA 1VR3A 4Z07A 1RUOA 1E3OC
chains in the Genus database with same CATH superfamily
3OTFA 3T0AA 4Q2JA 1F4HA 2ZGLA 1G7YA 3VBUC 4N9IA 2VH9A 5CIRA 1U5IA 5CG9A 1EFAA 2FFHA 1YHFA 2VVFA 4IV3A 3GXUA 5GLUA 5B4NA 1R63A 4FAGA 2DCZA 4JHTA 2HWB3 5LA0A 1QJZA 1HQNA 1VBC3 4P9LA 1V6NA 3A0NA 5T5PA 1AYM1 5A7SA 5DPNA 4OHWA 3WG2A 4FFIA 3Q8EA 3RNSA 4C0HA 3ZSJA 1BEV3 3A4UA 4WVWA 2ZCWA 1CAXA 1YYNA 3T30A 4CDWB 1LHNA 3UK9A 1QQP3 3H3UA 3NL1A 3TELA 5FY7A 5HCFA 1B09A 1W8WA 5FRAA 1PERL 4EWEA 4M4RA 4AEDB 3GM8A 2NQYA 4C0BA 5JPNB 2V4AA 3VDAA 4B7KA 4FI9A 3WDWA 1UOGA 5JMCA 5EYYA 1N3OA 2NLRA 4QB2A 2FDKA 1W3VA 5J98B 2Z42A 1NX9A 2XBO2 3AYEA 3MIEA 4JX0A 4UYBA 3VZJA 1OQ1A 5T3NA 2NP0A 4ER3A 3R4UA 4P9GA 2B9VA 2QKDA 3DGTA 2XLFA 4DUVA 3LE0A 1AJKA 2P34A 3K4AA 5FZHA 5FP9A 3NDBB 2LW8A 2TEPA 5JXIA 4BQWA 1RL3A 1TQ5A 1XNDA 3MIGA 3ZDVA 3ZXGA 3RI9A 2CWSA 2BOIA 4DMIA 5C33A 1U5XA 5CAZA 5DMYA 1A34A 4BM8A 4D69A 3H8RA 1XE8A 2I07B 3K51A 1AL23 1HDKA 4OYUA 3MHZA 4IGOA 4N53C 3FN9A 4D6QA 4AQTA 3ZFEB 1ACCA 3USSA 1F8VA 1PNRA 1JI6A 2B7YA 2PXDA 4QM8A 5LEJA 1YO8A 3KT7A 1ZBE1 1MFQC 4QWNA 2CAUA 1E5IA 4NIDA 4RS5B 2JQEA 3AKQA 1RUF1 3J9SA 4NROA 3UFDA 2B42B 5JXGA 1UTXA 2VNRA 3K48A 3I3DA 3ZFFC 1S7EA 1CWPA 1UY4A 4RA0A 2PUAA 3GNEA 5KXCA 2XL7A 4LK7A 2YYOA 2QFEA 1C8M2 4OI1A 3KCYA 2VZPA 3VZLA 4FAHA 1F35A 1ULOA 2W08A 3B9CA 1RUJ2 2D6OX 2IXKA 2ZACA 4LOTA 5KC5A 3MLJA 5C3OA 2PXQA 1RIRA 1D2QA 4HSLA 4ES8A 5GALA 1GLHA 5JUWA 2WNUB 3N7LA 1H2MA 2W1UA 3EBRA 4PBPA 5I93A 2QDRA 1GT0C 2VMFA 2W9XA 2JCGA 2X53S 5FPUA 3LD8A 4HK8A 4N53A 1AVBA 5BNPC 3CMGA 3O12A 4XABA 4Q4Y2 3TN93 1NY72 2VC9A 3R1FA 1QJX1 2Y64A 2P4EA 3UGFA 4AI2A 3ROUA 1PM4A 3L2YA 2G9GA 2W91A 5EJ3A 3VBSA 2VVDA 4ATFA 3H7YA 2FDIA 3ZFGC 1ULEA 1VAMA 1JN2P 1XPWA 2OKXA 2ADDA 2Q8CA 4XCBA 2RS33 1XC6A 3SC7X 5KC6A 1O3RA 4CP2A 2X05A 1HQ1A 4HZFA 3ACFA 4Y3OA 1COV1 4HETA 4GH4B 2RE9A 2YPDA 2G4IA 1MS4A 3I59A 2HINA 2WNEA 2IV1A 4OI4A 4XQDA 1R64A 1HRI1 3SH3A 4EJRA 3NAPC 5DAXA 5GAHi 1WIZA 1TME1 1ULFA 4Y1YA 5D8AC 2P3YA 1IKPA 3PVEA 1HLCA 1RUF2 2VEOA 2QVSB 3OBZA 4LE3A 1PNFA 4LR4A 4ZPIA 5EJZB 5FMBA 3VKMA 4D7TA 1GWKA 4QPYA 1O59A 2NMOA 1XSRA 2IVQA 1N1VA 2ENRA 2ZHMA 2XCJA 1PIV2 1QEXA 2H0VA 1L7RA 4BDVB 3C7FA 1ZRDA 2JIGA 1O3SA 2RMU2 1FOD2 4I3PA 2ZMKA 4ZXEA 1YFXA 2DCYA 1NKGA 3ACGA 4JGZB 1JFSA 1CZVA 1XB9A 1DQ2A 5FJHA 5GLZA 4XACA 3ZDSA 3B7MA 1BZWA 1TG7A 2ZKNA 3HN1A 2Q4SA 1BK1A 1OA2A 3I97A 5DDJ3 5LA9A 4ZZ5A 2YFZA 2Z79A 4QQPA 2D97A 3THPA 1V6MA 1OBNA 2Y6FA 3N9MA 4BB3A 2A6ZA 4YW4A 3OD0A 5JSPA 1RUE3 4FPLA 3ACHA 2WKKA 4MGKE 4Q0SA 1R1A2 5GM0A 5BPXA 4XF1A 3WEZA 2FHRA 4E2SA 3AFKA 4XMIA 3CLCA 1X50A 2PIJA 1AR81 3EHKA 1JHNA 1HB4A 2CU5A 1O4YA 3PLQA 1U0AA 4MXWA 3RYRA 1QQAA 5JXJA 2XOMA 4LMFA 3DPRC 2J42A 4QB6A 5L7OA 3MZHA 4NUBA 2JDAA 4RFRB 3ZVXA 4C91A 2AYHA 3JD73 3BTZA 1QOOA 2OA2A 1V0AA 1BJQA 1QXJA 5FYHA 1Q8SA 3MDPA 3MO4A 4W6YA 4Y20B 5FPAA 1QWRA 4PDWC 4GB31 5FLHA 1AZDA 3FWEA 1GQGA 4HVRA 5FZ1A 1YQ2A 1T6BX 1RZRA 1ADRA 1UXDA 5CNAA 5GZDA 5ANNA 1QP7A 3PTRB 2JE7A 5F3IA 1NA1C 2D93A 4QXBA 1W8OA 2QUOA 3HQUA 3M70A 2XQXA 4ARXA 1RINA 4D7SA 5JOWA 4TZDA 4P5HA 3PU3A 3F6WA 1HX6A 5F6KA 3ZYJB 4TN7A 3F95A 3OWQA 4GD4A 5A1LA 4LQRA 5C5TA 5A3WA 4IW3A 2W94A 4AEDA 5A3PA 2WQ8A 3UGGA 3VDDA 3HAGA 2R0FA 4G9SB 3W5MA 3U14A 3DXTA 5JPMB 2QE3A 1SCRA 3RJRA 3PHMA 1FNZA 2GALA 2WSVA 1W6OA 4UW6A 2BFUS 2BGCA 3APBA 3MV11 2EXHA 3I49A 4ZKTB 4I02A 1GU3A 5KWRA 4W50A 4Q5OA 3VZNA 2VOVA 4XF0A 3UJQA 1H1MA 5GAGi 2VGDA 2X5IB 4Y4RA 4GIQA 4H14A 3VV1A 5C8CC 1LOFA 1W28A 3C7OA 4NE9A 2PXVA 5FZMA 2VOTA 1ZVFA 1S0DA 3VB9A 1V6IA 3HBKA 1O5UA 1S0FA 3I2GA 1MEC3 2V73A 4FP3A 4CU7A 4L9BA 4RHV3 1RHI1 2ILMA 2YMZA 4XFFA 4YVSC 1RUD1 4D3WA 3K4ZA 3AMQA 1VBE1 3FLRA 1GBGA 1HIXA 3HPNA 2VUCA 3LAGA 5D1IA 4ZS2A 1PRUA 2JXAA 3O1UA 2GSYA 1VAVA 1CJGA 1X9PA 2JKXA 1SLCA 1KRIA 4YVSB 4BH9A 1SBDA 1OQDA 3SCGA 1S55A 3B7HA 1OT5A 3LQCA 4AE2A 1URXA 2HWB2 3I2JA 3ES4A 3E5QA 1RZSA 1RITA 2BQPA 1LHUA 1W2NA 2ERFA 1DGRA 2JG9C 3ZIWA 4QB1A 1IS6A 3DYOA 5JIAA 5LZ6A 1CAWA 1EY2A 1BEV2 4CDUC 2VXJA 4FBFA 3HD8B 5J96B 1DDLA 4TLFA 2FDHA 2R6QA 2A7AA 4NHYA 1LRHA 5JZGA 3AK0A 3AL6A 4CU8A 1QDCA 1JZ5A 3NXHA 2ZZQA 5ABJA 1NERA 2IFRA 4PDWA 2BEOA 2QZ3A 4LLOA 4XEZA 4AHYA 1LESA 2E33A 3V65A 3JZVA 3ZIXA 4N43B 1WLCA 1WW7A 1W90A 2YBKA 2Y6GA 4PDWB 4Z1VA 2XBO3 1SCSA 2ZEZA 1C28A 1GP5A 1RVF3 3G7DA 4EN0A 2IWGB 2MEV3 5FUNA 3IIIA 4C8DA 2KM2A 2XKOA 4RSUA 3VHOA 3O0XA 1VBA2 5L7OC 1FPN2 1GMMA 2JE8A 2PFWA 3ZR6A 4CYDA 3B00A 2J7WA 2HWC2 3DUIA 3OCPA 4AHXA 4XBLA 1GZCA 1W0PA 2XJTA 5GZEA 5LATA 1AR92 1DF0A 1AL22 2OIIA 2VZVA 1C1LA 4P9JA 4Y1VA 2XQRA 5CKQA 3WG3A 5F3CA 4KI5M 2KA3A 1SPPA 3J7LA 4LLFA 1CAUA 3AL5A 3AZWA 1CQ9A 1TVGA 1RUI3 2FQPA 1Z7S1 5FP7A 5KHJA 2PELA 3H8XA 4YM1A 1ZZ7A 1QP0A 2RM21 5LK5A 1KEXA 1OVSA 1UL9A 2Y0IA 3J26N 1HV0A 4RR3A 4V2WA 1W0NA 3H50A 3PXPA 3L1PA 1UX7A 2HWD3 4FO9A 5EJ1B 1ZM1A 4IQPA 2QZ2A 2UWAA 3UKVA 2WWUA 2ZHLA 4XAAA 1ZBA1 5C71A 3AZVA 1H2NA 1AR71 3VBHA 1W8UA 2IXLA 3WVJA 1YEWA 2ZEYA 2R63A 3ZXEA 1HXS1 3OEAA 4YGCA 4LULA 3NJYA 5L36A 4IE5A 2QJVA 1F15A 4LKSA 4NPRA 5I0DA 5T50A 2IVGA 4Q1RA 1JBCA 3VBRB 3HMYA 2WNVB 2C9KA 3KWVA 5AVAA 1X57A 5J3UA 3JU9A 3JBG2 2EA7A 3U3WA 2JX9A 1OA3A 3VDCA 4CDUB 2UWCA 4CDXB 5FLJA 1ZRFA 1DZQA 3M3OA 2BTVC 2WAAA 5GZCA 2C9AA 2NZ9A 5FBZA 1QJU1 4AVAA 4OCTA 4URTA 4H7MA 1LHWA 3KXAA 1AL0G 2PAMA 1X82A 2J1VA 3TRBA 5H9QA 2Q1ZB 3H0OA 4XETA 1IG0A 1QJFA 4PU4C 3TB0A 4MUVA 1YQ5A 4V2VA 1PK6C 3DYMA 4XJUA 2J1UA 2HWC1 4I01A 3WCRA 5T54A 3KD4A 2PXTA 1VBD1 3J8F1 2BGOA 3NJXA 3FFZA 5FYCA 5KBFA 4LHLA 2Y34A 1KGYA 1RJ8A 4D6RA 3L2HA 5L7OB 2UWBA 1Q8VA 2EVXA 3NWKA 5C8WA 1S2KA 4HKLA 1XYOA 1IG3A 3NNGA 2D6LX 1N1SA 1QJY3 4YM2A 2BV4A 3ABZA 3VBOB 2W87A 3PUHA 1QDOA 1N1YA 2EF8A 4OZOA 1JZ7A 3O1VA 4Q4W2 1W6MA 2D5VA 3M9LA 4J1XA 1LECA 2GDFA 1TMF2 5DTMA 5C4WC 3OB8A 4META 1OD3A 1UKRA 2P6HA 3MPPG 3WDYA 3IB3A 3ZR5A 4PU3C 4E27A 4MXVA 3LDBA 4Q4V2 1CAVB 3VBFB 4Z5CA 5IVFA 4XUNA 2AEZA 3A0KA 4BZ4A 1R1A3 2LYQA 1BVVA 4OHZA 3U37A 4FPHA 1AR61 2CL2A 1S0CA 3ZYPA 1UF2C 3USUB 1PO21 1RUD2 3MFCA 4YGDA 1YRZA 3NV3A 1B35A 3H3LA 4COZA 1YFUA 4QHOA 1XNBA 2X5IA 3WZ1A 3KV9A 4NRPA 3QH7A 2PTMA 4NWWA 1Y7YA 3RGBA 1B35C 2WUHA 2XJUA 3PJQA 1ND3C 5FJKA 2F6BA 2O8OA 2YBDA 3JUUA 4K9SA 2HCNA 1POV3 2RDRA 4Q0VA 2G19A 2K46A 3BODA 5FQ0A 4IE6A 2HEYF 2TBVA 3RWKX 2EICA 5H9PA 4Y5TA 3JQXA 3SKJE 2W1QA 2FCUA 4JDNA 3LDKA 2VOWA 2VW0A 1WWYA 4RD7A 5GKAC 4YRDA 2DUPA 2GNTA 1EYBA 4QX5A 4BQYA 3OF1A 2J7MA 2DWRA 1LCDA 3WDVA 4COVA 4IV1A 1SFNA 4KWUA 1PHMA 1H0BA 3FHIB 4MADA 5CFCC 2UU8A 1LEMA 2IXCA 2RR11 2XVGA 4NJ4A 4QQOA 2XL9A 3E5UA 4IXLA 2R042 4Q0UA 5FYZA 3PL0A 5LBEA 1ZA4A 2BW8A 5C4WA 1XNCA 1OPOA 1SDDB 4Q26A 2YROA 2AACA 3ETPA 4QXKA 4R4ZA 1PGL2 1LCLA 1MS5A 1GNHA 1N1TA 3H1MA 3MFAA 3CIHA 3NNMA 3QLQA 3ZFGB 4BQ2A 2ADEA 4YW1A 5DRYA 1X8EA 2LLWA 2HWF2 2R072 4MHUA 3ZOIA 5JAXA 1ZBA2 3O7OA 1TNFA 2WUSR 5JZGB 4BWOA 5DTQA 3CECA 4XXAA 1J1LA 4AVBA 2DFBA 5B4XA 2AC1A 4YG4A 3NAPB 3O0VA 5A6YA 3VZKA 1PX4A 4JTNA 5A3MA 4WM7A 2VMCA 4DOUA 4ER5A 2VW2A 3ACIA 3MICA 4D94A 1OUSA 3AMPA 4OQ9A 3C8XA 1YSEA 4ORFA 1V00A 3MF6A 3GBGA 3OSDA 4LBQA 4A7ZA 2FZ2A 2GC3A 3NSTA 2D43A 1DWKA 4S2DA 4WBBA 1C8NA 2ZMNA 1VRH2 4J6GA 5FO7B 3ZFEC 1WD3A 1OKOA 1V9U2 2PUGA 3S7IA 2P3JA 3K46A 3THTA 5FZ9A 3WD5A 5KR7A 1PGW2 4HVOA 3RYPA 3IMMA 1FOD3 1QY4A 5DSXA 1DLLA 3B93A 5GLVA 3ZMOA 4AEMA 1VMHA 4IESA 2D7FA 1W9SA 1D4VB 1DIWA 3QCWA 5ERLA 5LWBA 3QOXA 2GNMA 3WNXA 4P9YA 3SISA 4AI0A 4JVAA 1LLIA 3CJIA 4F7ZA 3RMYA 3CBNA 3NNJA 1WGPA 2W95A 1ZRCA 5LK7B 1RUE2 2PLV3 5F2SA 4OHVA 3T0BA 4EK9A 4Z07A 3LSDA 4ER0A 2GNDA 1LU2A 2IFWA 3T2QA 4QU1A 2A6WA 2XDVA 3VBHC 1W99A 1PNGA 1D0GA 4K20A 1YJLA 1IPKA 1SQ8A 3HZIB 1UQXA 4HKOA 5FZBA 1FX5A 3K77A 5CFCB 1NE4A 1PMJX 2LCVA 1DGWA 2RS53 5DABA 1F4AA 4TSVA 5IVBA 3VBHB 1RMU1 4MYEA 3RG0A 4JAAA 4AFBA 2Y60A 3VBUB 2YXSA 4F83A 1UXCA 1AXZA 1LGNA 1STMA 3PIJA 4I6TA 1MVQA 4AK3A 4Q29A 3VBUA 3D4KA 2AWIA 4X4FA 4JCYA 4TLGA 5FV3A 3VD7A 3I2OA 3BB6A 1RVF2 1LGBA 4JRLA 2MEV2 1TEIA 2FCTA 1W8FA 1VBA3 1W39A 2Y6KA 4YVWC 4IWRA 1VBC2 5EXOA 4R9CA 5F9TA 5JZGC 2OR1L 3AZZA 1UU4A 1V6OA 2VPVA 5LCWL 4NIHA 1DGRN 1VB4A 4CDUA 4XAEA 1MS9A 1SHWB 1A6CA 5CYYA 3WNOA 4F8DA 5EFUA 3T1MA 4GMP1 2DUOA 1RUG1 2QQUA 5JXHA 1ZX5A 2B45X 2G9FA 2O0OA 4P08A 3QQ6A 2NM1A 1O4XA 2ZX3A 3T4VA 3UJOA 2W47A 1WBLA 1HRV1 4GHJA 3DL3A 4EE2A 4BQXA 5JDBA 3DN7A 1AR72 4LTAA 4GXLA 2ARCA 2VNOA 2IVIB 4QPIA 3X29B 4LBOA 3A7QA 2WNUA 3IPVB 1O6UA 2A6XA 4XVHA 4X4EA 1XBFA 3HEIA 4TXWA 3V0AA 1H30A 3U07A 2VJXA 2JDUA 3ZKCA 1W8NA 4WV8A 1W04A 4YW3A 1SFYA 2NPIA 4RS5C 5LRRA 1PZ7A 1VALA 4JGYA 5FZ3A 3A9YA 1OLQA 2R32A 1GR3A 1L7QA 5JUVA 1JOJA 1OLMA 4N7UA 2PE5A 4HK9A 3NVCA 1ULCA 2MQKA 1C4RA 4Y33A 5C8CB 4UFHA 5FO8B 2VXRA 3E5XA 2JEMA 3T0DA 4UF0B 4EZIA 1NLSA 3RZMA 4RHV2 3FMYA 4GMP3 1MR5A 3NZLA 1VJ2A 3UL2A 1G9DA 1BBT1 4FN3A 5FZCA 1I1EA 3O1SA 2VMDA 3D6EA 3KCXA 1FV3A 3W21A 3M2MA 4R9DA 2F17A 4CEYA 3JBG3 1VIWB 2WNUC 4AYUA 2YPJA 4HANA 2PHXA 1UOFA 4W8JA 3LA2A 3OQNA 1GOFA 2W1WA 3MF9A 2XPJA 5EQUA 3AKPA 3KF5A 5LBCA 5CISA 3GUUA 2AXZA 3T08A 2VMHA 4JTOA 4D6SA 3GZDC 1NEQA 1UW8A 1CESA 5FZ4A 2VG9A 3HNYM 2RVAA 4QMAA 3NRUA 2ZEXA 3WV6A 1RMU3 2WYFA 2B8MA 4CDWA 4LO6B 4Q2FA 2VQAA 2RS51 4QHZA 4HVQA 4M0NA 5F5AA 1L3JA 5CA6A 4DE8A 3DYPA 4I3GA 3DECA 4XTMA 5DAWA 1WKYA 4KWKA 1QOSA 4NMIA 4Z2WA 4LEJA 2PLV1 4YFWA 2D3RA 1BMV2 4ER7A 1H4HA 3WUCA 3IBMA 4H2AA 4M3CE 2EBYA 4UWDA 4DO0A 3AM2A 1MZ5A 3ILRA 3SEEA 5CG8A 1NAEA 2VBBA 2Y8KA 2LYJA 1WH8A 1HF0A 5DTRA 2WZR2 5FY4A 1RTVA 3F51A 4IEQA 3UGHA 5K7PA 3OYWB 5L19A 1RZRD 2VBPA 4BQ3A 4IGPA 1GICA 1FT9A 2LALA 3WHUA 2H0BA 3B02A 1RUI2 1ALYA 4YG1A 4GZ9A 4MH0E 3THDA 1F2NA 1R091 2Z69A 2RJ2A 2I2SA 1PZ8A 3GBFA 2Q8OA 1OSLA 4YFZA 3GALA 2PHFA 4HONA 1PIV3 4DB5A 1AR62 4OHYA 1AX2A 2GMMA 1NCQB 1VP6A 1WMDA 4C1WA 3SLIA 1ND2A 2XH6A 3GYDA 1WW5A 1QH6A 4GAZA 3BTAA 3GZCA 4JHZA 3WF4A 1XQNA 4X6QB 3DNVB 1FV2A 4K1ZA 1D0HA 2DBNA 1H6YA 5JI7A 4FXKB 3VD5A 1E5HA 1JH5A 1RPEL 1KDMA 2GC0A 1DZTA 1OSGA 4Q4X1 4E8DA 5FPXA 5I8YA 4NPMA 4NVPA 2Y6LA 4KG0A 3B01A 4CCMA 3GZTB 1LOBA 2BFUL 2GZWA 1OLME 2RR13 1N3QA 2FCVA 3ENRA 3UKTA 5F37A 4BYYA 4FVVA 1Q8OA 4QQ2A 5FLIA 2AXVA 4CP9B 5ACA2 2PA7A 1SLTA 3FZ3A 2R043 1R092 4Y1XA 1O3QA 4CZSA 3I3BA 3MBWA 3PDQA 3U0ZA 1K12A 2E51A 2VMEA 2WA3A 4HXCA 3S7EA 1TE1B 5C9AA 5JOZA 4FOYA 5FMOS 1ZRRA 3SMHA 1DG6A 2XJRA 4UW3A 1OVPA 1NA1B 4PF1A 5H9RA 1JYWA 4LIUA 4LHNA 1RUH1 4HPKA 1HN1A 4JQTA 3WP4A 3N9OA 4E4SA 3AP5A 1MQTA 5CFCA 4FPJA 5KHGA 1PVXA 3C3VA 5FR3A 2D40A 2VR4A 2WLQA 3JXSA 4OUEA 1BLZA 4CCLA 4URAA 5JOYA 2H6BA 5DUUA 1FMD2 1PO12 1EAH2 1HW5A 1OF3A 2DCJA 1OA4A 4CE8A 3MLLA 1R1A1 4DE9A 3WF2A 1LODA 3FHAA 1YI9A 1JTZX 4RS5A 1UO9A 4QPWA 1W9YA 2EIDA 1VRH3 2JG8C 1W6QA 3I3EA 2MXDA 4AQ6A 1ZAYA 1H8TA 1ND3A 1ENRA 1S4CA 1Q8PA 3CJXA 1S2EA 5C9AC 3VBSC 1CX1A 1DGWX 4GWJA 2JG8B 2R0HA 4PHZA 2HLEA 4YGEA 3D0SA 1WA6X 1MZ6A 4IEUA 5DUXA 3WR0A 1IQDC 2AEYA 3POEA 2LLVA 5B2GB 4KG8A 3N7JA 2XGXA 4Q4V3 1PX3A 1WMFA 2JENA 2RS12 2W46A 4YWAA 4XMAA 1QJY1 1UU6A 3WG4A 3KLSA 1DW9A 2PAKA 3RS6A 2LTNA 2YB7A 4K6BA 5EPAA 3SXWA 2XHNA 1OD5A 2KD7A 1MS1A 2BDRA 2PHWA 2WO2A 3BS3A 1BHGA 3LKJA 4A6OA 3W5NA 2KEKA 3QFIA 1AUYA 5FWJA 5HBAA 1ZVVA 3AP9A 1KJLA 3AZYA 5K98B 2J1EA 3GN5A 1JH9A 1LHOA 4FPGA 2L49A 4QQHA 4BLIA 1CZTA 1CQTA 1FATA 4GWNA 1GNZA 4FPFA 5A6XA 1R69A 2PXPA 1Q3EA 4Y4YA 5FPVA 4BU2A 4CEWC 4JCXA 2E26A 3TFLA 1LOGA 1JUHA 1DGLA 3T4HB 2KZ8A 3TYJA 2VMGA 4NHLA 1S0JA 4O61A 4CXWA 2G9ZA 2K2SA 5HCBA 4I30A 3DCQA 4NO4A 3KHCA 4C1XA 4QQLA 4I8TA 1T2XA 1N3PA 1WLTA 1XU1A 2A73B 4K3UA 1AX1A 3S30A 3QOPA 4NIAA 4YZ1A 1XNAA 3I4IA 1KQRA 1IS5A 1H2LA 2GN7A 2PUCA 4AFMA 4E2GA 4CDQB 4S2FA 4LUMA 3NV1A 4FP2A 1UU5A 1W2TA 1CGPA 1AR73 1RC6A 3Q8CA 1QB2A 5A33A 4BXFA 2WNOA 1RUG2 3FYAA 2YU2A 3DPRA 3HT2A 2BNNA 1ZBA3 5T5LA 2XUEA 1U5YA 2R16A 4JGZA 2BWCA 3WQ0A 1LOEA 4I0BA 2Y0OA 5TSWA 3VBRA 1QXPA 2EXIA 2HYKA 1Y9MA 2EIGA 1NQDA 4MV2A 2YY1A 3POWA 2HWD1 1KS4A 2DCKA 4AHWA 4CUBA 5FY9A 3PUAA 3VKOA 4YW7A 4AR2A 4LITA 2CY6A 3OBTA 5F5CA 4IDZA 2J1RA 2DU1A 4WM7C 4U2AA 1FYUA 3AJYA 3OGVA 4EQVA 3IDAA 1OLRA 4NRQA 1PZ9A 4Q1PA 2W5FA 1W6PB 3P1IA 5HXMA 4JV4A 1VBE2 2D5FA 3WNLA 3LPGA 4G4FA 2X09A 1I3HA 2YU1A 4QXCA 5FUPA 4JCKA 5K4LA 2D5HA 2WFF2 4IV3C 2Y38A 4LKFA 4CPBA 5DUVA 4CEYC 3ILFA 1HB3A 2BYVE 5IK5A 5I8TA 4DXZA 1WCUA 3WCSA 1ODNA 3S5QA 3LIHA 3OEBA 2XXZA 1RVF1 4F3JA 4Q4V1 1SDWA 1HB2A 2PLV2 3BU0A 2WJSA 2DVAA 4O65A 1H9WA 4Z82A 1QU0A 4WVVA 2Q5TA 1LKNA 4OLLA 1VRBA 5JR7B 5BYNA 1KJRA 2RDQA 3AP4A 3M3QA 4XQ4A 3AKSA 1C1FA 3LPFA 4PLMA 1QP4A 5BNNB 1MQTC 1KD7A 3KV5A 3UYJA 2WDBA 1AHSA 3LFPA 3FHQA 1VLNA 1X33A 1VRH1 4DUXA 4UAPA 3VL9A 4EWAA 2BOJA 2ZOEB 3AKRA 4DUWA 1JZ6A 1H9PA 4A44A 3AMNA 4LBNA 5F32A 3WW4A 1REDA 5ABJB 2FD8A 1UPSA 4X8PA 3AZXA 2WT2A 3J8F2 1ZZ8A 4IL7A 1G9CA 2IUOA 4PI0A 4AW7A 3AXEA 4IGQA 2BWAA 4CP9A 5A32A 1MZEA 1RUH3 2R062 1QH7A 2XWJB 2OS2A 3Q9OA 4GALA 4XF4A 3WF3A 1EUTA 1MEC1 3DKWA 2LRPA 3LQXA 1QJU2 2XKPA 2YBSA 4XIKA 3O1PA 3IWZA 2E7AA 5BNQA 2J1SA 2PPXA 2WSUA 3RFRA 5AFEA 4QDQA 3MEJA 1N47A 5E8AA 5FY5A 2R041 5FZGA 3H8UA 1XYPA 1QJY2 1GZWA 3CJIB 2P2KA 5FWEA 3KM5A 4X4DA 3PE5A 1DULA 2QQIA 3BIEA 2Q8EA 2XVKA 4R52A 5L9RA 1ST8A 4LBKA 4HL0A 2OUJA 1IS4A 2Q1FA 4MHRA 4YVSA 3UKNA 4BIOA 4QM9A 2W68A 1HXS2 4Q4X3 1UKGA 4YSFA 2XJQA 2XJPA 4YBAA 4EYUA 2P5BA 3FUQA 2YZ4A 4IEVA 3VGIA 1SQ4A 1UYPA 3KVAA 1POQA 1E5RA 1UOJA 4X4IA 1SLBA 3WP5A 5C7GA 4JKMA 2OPWA 2MHFA 2RR12 3ON7A 1A78A 4XYXA 5ANQA 1PO22 3ZSEA 4GQ7A 1PIV1 2ICTA 4JDOA 5EYXA 4AI1A 1ENQA 2VL4A 1EUUA 1R093 2ZKLA 2DYCA 3HQXA 4GB33 5BXXA 2F4LA 2XJ3A 3R0RA 3A21A 5A7PA 4YLZA 3LA3A 3PU8A 1RUC2 3ZYBA 4L97A 3J7HA 4CP0A 3JD71 5CFDB 2TNFA 3GCXA 1NZCA 1J1TA 3EB7A 4DEVA 4LT5A 3ZPOA 2LYLA 2CV6A 4LO5B 5HXVA 1NCRA 4UFLA 1Q56A 1ZPQA 2EAKA 2LM3A 4OFGA 4CDWC 4QXHA 1PMIA 1IS3A 3TNQA 5A1AA 1NCRB 3RZJA 2PXLA 1REEA 3KZ4C 4ZU5A 3BKZA 1K42A 2EF6A 1FAYA 1QNWA 1W9FA 2PN5A 3ZKYA 5DXDA 1SLAA 1UZVA 2JICA 5CKMA 5A7WA 4YM3A 1QOTA 1NY71 1RUE1 1VBB2 4ZU4A 2NMNA 2A71A 4NIGA 3E6DA 2XR4A 3MV01 2QDNA 1YFYA 2GAUA 3V0BA 3JB8A 3R4SA 4CDQA 3K4DA 5DDJ1 3NJZA 5FP8A 4OHXA 4QX7A 1U2ZA 4XPVA 1I5PA 3BUCA 2O38A 2W1SA 4ASMB 4MGZE 1UPIA 2E6VA 4E9KA 3GZUC 1UWWA 2QQWA 1BK0A 5D8AA 4CCOA 2AUWA 4IETA 4XUQA 3UETA 3WNMA 2VCCA 4O8BA 4MO3M 5FZDA 3EO6A 3GZEA 1UNBA 2C24A 1YFWA 5J1XA 3CQOA 5A80A 1BVP1 1O4TA 3GZDA 2VBDA 3JBG1 1K45A 3HNMA 1JYVA 4I09A 2PXKA 2ZGUA 1GWLA 4BK5A 1UMIA 1TME3 3AP6A 1H8TB 2PUDA 1BBT3 2WS92 5C3PA 1RHI2 1HRI3 2A5ZA 4PLNA 1ZBE2 3OD4A 3VDDB 3BPZA 4E4DX 5FZKA 4CCEA 1X9TA 1H8TC 4AGVA 5IT6A 1OFNA 3RWNA 1OURA 1YJKA 5DT2A 3MW2A 1JYCA 2ODRD 3OKZA 1E3OC 4PCRA 2WBKA 1UY2A 2QQVA 5K9YA 2VZOA 2CDOA 2JDKA 3BDNA 5FIXA 2VE1A 3OUHA 3WUDA 1QJX3 4YZ2A 2LYSA 4LA3A 1IPSA 3TN91 3I8TA 4H7LA 4Z5HA 1S0IA 4XFHA 4CVUA 3N7MA 5FQ0B 1UZYA 2LS6A 2PUBA 2QQOA 2RS52 3GJAA 4ONUA 5F5QA 2C5DA 3TN92 4B4QA 3E6CC 3CKHA 3POGA 3PUIA 1EV12 5IAVA 4YG3A 5JMOA 2OFYA 4UT5A 4K7JA 1GQPA 5FK7A 1WD4A 1HRV3 4V1PA 5FDBA 4KNCA 3W9AA 2E9QA 1YQ8A 3ZHMA 1GZTA 1RUG3 5IFPA 3CU7A 3KJXA 2FBEA 1DQ4A 4K21A 5E88A 3T1LA 2JDHA 3PTYA 3W20A 3M1HA 2WAOA 4W65A 1SZBA 3CROL 3HVDA 3WT3A 1CAWB 1LOFC 1DQ6A 2X29A 4DIQA 1VBA1 1RUF3 5BUVA 3M3IA 1UYZA 5FYSA 1JYIA 4J1WA 5FYTA 4L99A 3KF3A 1YIPA 4Z5DA 5J36A 3GHNA 4RQPB 3KL4A 5FPLA 5A3UA 1W2OA 3ALQA 3AJZA 1RB8G 4QKBA 1LR5A 4RN5A 5I8SA 4COWA 1NQJA 4GH4C 2YV8A 2ZX0A 2DVFA 4JRAA 4PLOA 3GCWA 4A41A 3LF7A 3HIFA 1XSQA 2J1AA 1UY0A 4X4CA 1UXXX 2OZ6A 3TBDA 4A3XA 1OOPC 1KDKA 2ZAAA 3CF6E 2CGNA 3W58A 2WL1A 1D4M2 3OJBA 2R1DA 3G6JB 3D5OA 4YZ5A 3CZJA 4Q27A 1UOBA 3KS7A 4WVZA 4KWLA 1IGOA 1LULA 2XI8A 1LAJA 4FCAA 4HN1A 3POFA 1PM7A 1JW6A 4X8NA 5F39A 4DXSA 5HI0A 3U11A 1CAUB 2AR6A 1UXZA 4WVLA 2ARXA 4JZRA 4FT8A 3MLFA 2WO7A 3WXPA 3IM0A 4YPJA 1OHFA 4KGQA 5IVVA 1T6GC 1JWLA 4DPNA 4E8CA 1FOD1 4BXSV 1XOYA 4INDA 1L7LA 4ZS3A 2HH9A 1LJ7A 2VZ3A 4XFAA 2OQ7A 1J84A 5D2AA 2XXQA 4LO8A 4OMDA 4AEJA 4C90A 5EIYB 2PXJA 4BMEA 1IQAA 4CEWA 3LFMA 5I91A 2LROA 2DUQA 2BBAA 3KCCA 3MPBA 4DINB 1OOPA 1GOGA 2LYKA 4CEWB 1Y7BA 1CVNA 1LEDA 3IKWA 3ME2A 4NHMA 1GQHA 2HWB1 3MGUA 4HLTA 3UNPA 3LFIA 3PVNA 3FC0A 2DVBA 5FP3A 3OGGA 3IDCB 1WCQA 2QTWB 2VUAA 4LK6A 5KXDA 4SBVA 4WVMA 1G8WA 4P00B 4UXAA 4AFDA 4LO4B 4LHSA 2OW4A 2BUKA 2SLIA 1QQP2 2ATFA 2IXJA 5CU1A 3U75A 4CPBD 2GH2A 2VZRA 1MS0A 3F52A 3AYCA 3KSCA 3GDBA 4XQWA 4AVSA 4LBQB 5A3LA 5DAVA 2JECA 2HCSA 3SH4A 2CGPA 1K3IA 4XFIA 2ZX1A 2VUJA 4N7IA 5A70A 1JYNA 3ITQA 4BPZA 4XFCA 4NAMA 3VDBA 3EUSA 4HRAA 2RDSA 3U4SA 1GANA 1CIYA 4GMP0 4CDXA 3H3ZA 3KV6A 3POYA 1SLLA 1I6XA 3WLUA 1XRUA 1WLDA 3OOXA 4QDRA 4X4BA 4NOTA 3ZKUA 2WO1A 4M0HA 1PRAA 2B39A 2GU9A 2EXKA 2HYXA 3SHRA 4BQ4A 4ZZ8A 1C5IA 1W9TA 3OPWA 2WZR3 1QPZA 4D8MA 2VU9A 1R081 5FMCA 5A7WB 3D3AA 5FZOA 4N53B 1BKZA 3ASIA 5JLVA 1POV1 1V9U1 2W3JA 5E89A 4Q8KA 5A6QA 2X10A 5F8PA 2JG9A 5IW0A 1MEC2 4LBLA 2DDUA 5A7QA 3C2UA 4MGQA 1PO23 4XUPA 1AR91 4PU7A 2MEZA 4FFFA 4ASKA 4KBZA 2RHPA 2VZQA 5FXVA 4NAOA 1AR63 5FFOC 2BERA 5BNOC 4GB32 4KU8A 1OKQA 3O0WA 3ZYGA 3IZOA 4GH4A 4UBHA 5HV0A 4GJZA 3SX0A 1CX4A 2ZGTA 3GBWA 5LA1A 1Y9QA 4WZCA 3WW3A 2ZS6B 4D7YA 5GZFA 5BNOB 4ES9A 3ZXLA 2ZA9A 4IEWA 2XJVA 2A75A 4DNYA 5T55A 1EPZA 5DAPA 4ER6A 2VQ0A 2CHHA 3PVBB 1GFF2 3E1F1 1UIJA 4A42A 4M4PA 2LNMA 3KQ4B 3QF3A 2WR9A 3PIGA 5CBLA 4PI2A 1OUXA 3ELNA 3I3MA 2E7TA 2OPKA 3G5GA 4QD2A 5C3QA 4LA2A 1XJAA 4BQ1A 1VMJA 4X4GA 1K5MB 2VMIA 3WW2A 4QX2A 4AXOA 1K5MA 4CDQC 3QWGA 4BQ5A 1ZS4A 3P6BA 4ISRA 3ZO0B 1AXYA 5GZGA 3OP9A 2JDYA 4ZY9A 1US2A 2Z5WA 3NQHA 3J8F3 4RGKA 3SCHA 1VBD3 3PNAA 2ZMLA 1ZZ6A 2HWC3 2RS32 2ZGPA 3M3CA 3C7HA 1DQ1A 1HB1A 2O4AA 3MLKA 3UT0A 3VN4A 4OUSA 2KPJA 4BCUA 2H8RA 4J25A 1KITA 4FBIA 3I54A 4MXWB 2GN3A 4M3CB 4N9HA 1S0EA 1UCXA 4OI2A 3Q8BA 1RUNA 4PIZA 2WS91 2GC1A 4CU6A 3AVRA 2VM9A 4IV1B 1QJU3 2L1PA 1H8VA 1YUDA 2YGMA 4LBQD 2W92A 2W0XA 5FYMA 2XWBB 3BOWA 2W52A 1FMD3 1PO13 1W03A 1WBFA 2GC2A 4YZ3A 2A6CA 2XMLA 2HSGA 5K0UA 3TOJA 4DXTA 5HCHA 3D0JA 3HN3A 2GZUA 5C3SA 4Y5SA 1SG3A 2PHLA 2VD7A 1DQ0A 2ZBJA 4BE3A 2PHTA 4CTEA 1BBT2 1UX6A 3WX5A 3POJA 1S1AA 5IK8A 2V3CC 1QZXA 1LOAA 2QQJA 4IV3B 1WW6A 1JHJA 1YLLA 2VNGA 2YBPA 3LA7A 2BU9A 4M00A 1TMF1 1HXS3 4Q4X2 4B1MA 4DRRA 5JR2A 3LB9A 1XNKA 1F9KA 4I6UA 3FL7A 3ZPYA 2RV9A 1PVC2 2BVBA 3I2DA 1UY1A 3ECQA 4HG6B 5DZEA 3SKVA 2YDEA 3I2IA 3IIAA 2GH8A 3KGLA 4MGSA 2JWPA 3JXCL 3BIWE 4UFIA 5JI9A 2W2IA 4XJAA 1WMEA 4OULA 1NLQA 4W4ZA 4NDWA 1W2AX 1UZWA 2CNAA 2FMDA 2G1MA 1QXRA 2RM23 4EQZA 2ZPXA 3FLPA 5FO9B 1Z7S3 5JSOA 1HJFA 1RUI1 2ZGOA 5A7NA 3ZYIB 3FYMA 1HJGA 3RYKA 2NN8A 4FTEA 3D82A 3JD72 2PXUA 1WA4A 3M7AA 2PXBA 1RUC1 3ORJA 2J1TA 4AGRA 2BJSA 2D3PA 5ABJC 4XF3A 2FDJA 5BNNC 2D6MA 3CDZB 1NG0A 3ZN4A 1R1ZA 3OUIA 1Y43B 1POV0 1Z78A 3GHMA 3OBAA 2WZEA 4N8MA 2QCSB 1RIOA 3INAA 2I45A 3TNPB 5FXWA 1LMB3 2MEV1 2ARBA 5FYIA 4YYOA 2QQMA 2XBO1 3WF0A 3B3QE 3FMGA 1VBB3 2AXUA 1W3XA 3NKTA 1PRVA 2RS11 2VCBA 1Q8QA 4L2NA 2P37A 4MG2A 1XE0A 3ZFGA 1YI7A 2WN2A 1IOAA 4WM8C 2X5IC 4QGNA 1ND2B 1G9BA 1UYYA 2RJKA 4BA6A 4NN0A 3AC0A 2ZX4A 2K0GA 3OMTA 3LWCA 2L9LA 4CUGA 2DTYA 1SMVA 5BNPA 2JDPA 2JJ6A 5F2WA 2R49A 3MW4A 1YIFA 3M8LA 1OFSA 2BGPA 1H2KA 2VVEA 3WG1A 3MW3A 3ZN6B 2IVBA 3MEPA 4WM7B 4RFT0 4BLJA 5FOBB 4AOCA 2PAEA 4B4RA 2WFPA 2WT0A 2YC0A 3VKNA 2CWMA 5F5IA 5DN2A 1VBE3 5J37A 2VNVA 1IZ3A 3LOIA 4AL9A 1RUD3 1YQCA 2ZTNA 5JCTA 3I2FA 2CDPA 1RHI3 4XDQA 4XJ8A 3VD4A 4RHV1 2ZHKA 4HT1T 5A3OA 4O7XA 4SLIA 3IPVA 4XTPA 2FDFA 3FLTA 2ZAHA 3AP7A 4XUOA 1JYXA 2WC2A 5HPOA 4K8FA 5A1FA 4F8AA 4IEYA 4Y1UA 4NIIA 5JIUA 2OX0A 3DEMA 3JXBC 3ZPXA 1G9FA 4Y22A 4QPGC 2JG9B 1AYN2 2OUHA 3POIA 3BTYA 4CCKA 2ZGRA 4Y22B 5IAXA 4Q4Y1 2QQKA 1LU1A 2YC2A 3FUOA 1LQCA 4MOAA 1SBFA 2ORXA 4I0AA 4QKDA 4UFKA 2PHRA 2XLAA 4A7YA 2UURA 2D6NA 1HQWA 2JB8A 5JOXA 1XE7A 2BNMA 3I59B 4XFGA 2Y26A 1AXKA 2DBIA 2W39A 5CB7A 4JC1A 1RYYA 2WA4A 1CD3G 4XFBA 2C26A 3NV4A 1W9WA 1HRV2 2E53A 5BNOA 3H1YA 4FPCA 3K3OA 4OZXA 3ZXAC 1OXCA 2VCMA 4ASLA 2XXPA 5IWFA 2HFZA 1C5HA 1RUJ1 2JDNA 4AVTA 4RL7A 2MNGA 3OGSA 1GYKA 2P3IA 1V6KA 4AAXA 5I0RA 5FZ6A 1QKQA 4FXGB 5AVPA 2VCAA 2WT1A 4Y24A 4DZGA 5A3NA 4UW5A 3ZYRA 1W2UA 4PIYA 4YW5A 5FMDA 3KMHA 2Q30A 1JOPA 4L92A 5FPZA 1GP4A 1ENXA 3AFGA 2C4XA 1ZUGA 4OVEA 2VUDA 4X6RB 5C5UA 5E16A 5FPBA 5IFTA 3TEWA 2WRAA 4XW3A 4OI0A 3H5TA 4O9EA 1I5ZA 1W6PA 2PMWB 2V5YA 3HOBA 4P9WA 3WNPA 4A3ZA 1DP0A 3FJSA 4AFAA 4DRVA 2CSFA 4IE4A 1UIKA 1H1IA 3CEWA 3CL1A 5C4WB 1AR83 2YFUA 1JODA 1EPWA 1UMZA 2MPFA 1D4M3 1SACA 3ZX7A 2VQTA 3FE5A 3NNLA 4L0PA 3BD1A 4OUMA 2AGSA 4FTBA 1WUVA 2XJSA 4HFSA 4DY5A 3BALA 2UY9A 1UY3A 3O14A 4Z2AA 3E97A 1SBEA 1G9AA 1NUKA 3UESA 1YXWA 3LISA 3ZMNA 4ZU7A 3T2OA 5K0UB 4XF9A 1NT0A 5CZKA 1ZZ9A 1LCCA 4Z58A 2BJCA 5IVCA 4FPYA 1NOVA 1W6MB 4EKIA 3NAPA 2BVVA 4ATEA 4U36A 5F3EA 2KXLA 1DBNA 2QQLA 3POSA 3VBRC 1DQ5A 1PGW1 2A1XA 3S6PA 2IXIA 5I0UA 4DFSA 4HKWA 2VO5A 4RYDA 5CVRA 4HMZA 4MGTA 2E7QA 3LEKA 2PXFA 5FXZA 3RDIA 2P3KA 5FP4A 4XXPA 3BU7A 4PIXA 1MVEA 2SBAA 5CKNA 1JOBA 5CFDC 1CAVA 4EZ4A 3N9NA 1E57A 3OG2A 4EN8B 2O49A 5FZIA 4UBGA 2J7UA 1LGCA 1MS3A 1COV3 2JIJA 5LBBA 4IERA 2Z2SB 2OXBA 1GSLA 2UYAA 4LHKA 3V64A 5LEKA 1NLRA 1CR7A 2IC1A 2RS31 5LY2A 3N9QA 4QPGA 4A2UA 4CSWA 4E4HA 5C70A 4Q0PA 1LHVA 2PXEA 3NJVA 3G0TA 3B69A 1NE6A 4KH9A 2FMYA 2PHDA 2V72A 3J7MA 3POBA 5IYYA 4MLOA 2Y33A 3QH6A 1RGSA 3MIDA 2ZGSA 4KBBA 1M4WA 3OYWA 5AC91 1Z0HA 2WQZC 2XUMA 5F1RA 1MPXA 2P1BA 3K2OA 1JZ8A 1RXFA 3ZFFA 2E63A 3GJBA 2C1FA 5FYVA 5L73A 1LB2A 4P9IA 5F6LB 1M06G 2XVLA 4Z59A 4RR3B 4N90A 3IVPA 3TWIA 2L8NA 5DG2A 4RGAA 4E2QA 1XXNA 4GKYA 2JE9A 4M3CA 2RMU1 1FXZA 1FNYA 3BVCA 3H9AA 3AYAA 3VKFC 1GOHA 3DKQA 2JDMA 1ND3B 3KQRA 3VK0A 1XYNA 4XDPA 1PK6A 3NROA 3BOPA 4QX8A 3RRDA 4FQ4A 1DYPA 3ST7A 4AI9A 1QF3A 1ZYBA 4JDMA 2EIEA 4B29A 1YCIA 2VQUA 1TME2 3OBRA 2ZGNA 2XIUA 4WZFA 5IK4A 4BOWA 3AMHA 3MI8A 1HRI2 3VDDC 1ZBE3 2AUYA 2JG8A 3MIHA 4XBQA 1U12A 2R30A 3RZZA 2PUEA 3IDBB 4XIOA 4N43A 1GNYA 3QACA 3H42B 2WYSA 1QQBA 1UN1A 4P5YA 5FXXA 4AVVA 1AL21 1MZFA 3WNNA 4BHPA 1AF9A 4K8RB 3RPQA 4FPKA 1G6NA 4LOSA 4AAPA 3L9JT 1RMU2 5I0SA 2DV9A 4FOVA 2DU0A 3ZLIA 5KHHA 5DAQA 5HCAA 3CZUA 3LEMA 2AENA 3VLBB 3WINE 2B5HA 3RZLA 1J3PA 5ACA1 3C7GA 2VOXA 4DQAA 1KFUL 4FOQA 4M3CF 4YG7B 4PU8A 1GP6A 1ZZBA 2NYYA 4HPKB 4YGBA 3J7NA 1EV13 1QGLA 1GUIA 2HEWF 4WM8A 4CA9A 1H1AA 3AX4A 5T52A 5IK7A 3DM5A 2BRTA 4KGGA 4EN9B 5BY5A 4BIFA 2R1BA 2ORZA 1DLCA 2HWF3 2R073 3W59A 4ARYA 3TEPA 4MGYE 4YARA 4R4XA 1QQP1 3OGJA 2ZGMA 3SEPA 1JFTA 1BEV1 1S2BA 1NXMA 3JQWA 4FPOB 4YW2A 1AYM3 2Q0AA 3HJRA 3KT1A 3U4XA 3ZSKA 1E5SA 4A7KA 4TYSA 1CPMA 5EHDA 1VBC1 3HWJA 4FFHA 2J22A 3ZSMA 5KXBA 1OOPB 5JVVA 3D1NI 5LY1A 1QJEA 4HBNA 3OQMA 2M4HA 1OC1A 2FZ1A 4LIVA 1KS5A 1W6NA 2P6CA 2WLPA 3WSOA 4LJHA 5DRTA 2IZWA 1CAXB 5LB6A 5IVEA 2PQSA 1W6NB 1VPHA 2ET1A 3SR4A 5FBJA 3WW1A 2QQNA 4EWDA 5D21A 3A9XA 4BISA 3O1TA 3PMEA 2IVJA 5K0UC 1APNA 2A6VA 5J48A 1OQEA 2HWF1 2R071 3NW4A 3O1MA 1W6OB 4QT6A 4AI8A 4W6XA 4XOGA 2IUWA 2XONA 1BDIA 4QKNA 1B35B 2CTVA 5G05L 5K8SA 5KXEA 1PGL1 3ZN6A 4FFGA 4QPIB 1EV11 1HN0A 1ZA7A 1O4ZA 3VD3A 2I74A 1PMHX 1KFXL 2C0ZA 4NWVA 2RJLA 3V0AB 3MYXA 4I2OA 5ACA3 4XBNA 1LTEA 3VD9A 1ONAA 2ET7A 4P9XA 1REFA 4DEQA 2VTXA 3N35A 2HWE3 4YZ4A 3VBOA 4ISQA 3BI3A 4NPLA 1H6XA 4Q0QA 1S0GA 3URFA 2VZ1A 3WF1A 3OPTA 4COYA 4UFMA 2ID4A 4A4AA 4PJYA 4GA9A 1MACA 1O5LA 1WH6A 2R061 3SH5A 2B46X 1JZ2A 3M4FA 3RI8A 4NHKA 5FYUA 3ZXDA 1VB2A 4XC9A 3O1OA 1QNYA 3FBMA 3NO8A 3OGRA 2ZXQA 5IJRA 3BCWA 3SCFA 5FY1A 4L11A 4UW4A 5GJ6A 4Y26A 3VHNA 4DS0A 3PJYA 3GGLA 2IU7A 5D8AB 4A45A 3A9ZA 1JXNA 5L9BA 3FBYA 2VOKA 4QX0A 1EAH3 3OY8A 4GQMA 5A3TA 2D98A 4IEZA 3S57A 3JXDL 1DCSA 2AREA 3MUZ1 4QU2A 3LDRA 4PF5A 4CCCA 3ATGA 1UD1A 1W06A 1BXHA 3VHPA 1B0NA 4GWIA 2ETEA 2RMU3 1JZ3A 3NKGA 3R05A 4HSJA 4RQPC 1J59A 4QX3A 1R082 1UAIA 2GMEA 4LORA 2OVUA 1AR82 1ASJ1 1X8MA 4RQPA 2WZPP 3USUA 3TEYA 1TZOA 3BTXA 4P02B 3ACLA 3ZN5A 1DU3D 4YG0A 4I0WB 2V09A 1Y3TA 2ZZJA 2DCTA 1NA1A 3WDUA 5M0TA 1V6LA 1RJ7A 1ULGA 5AC93 5C9AB 1UZ0A 4XURA 4YW6A 2ICPA 3PURA 2OZJA 2YGLA 3LOBA 4DXRA 1NYWA 4GULA 4LBJA 3RSJA 5IATA 5EP9A 2YG0A 4IVZA 2N7GA 2WFF1 3ZFFB 4BJ0A 4Z8BA 1A8DA 2DVGA 1GZWB 3K75B 3N36A 3CHXA 4EROA 2CGOA 3CLPA 4QPIC 1WZXA 3RQ0A 4LKEA 5A6ZA 3KHBA 4R9AA 3B94A 1JYTA 5FK8A 4Y42A 1Q5OA 5GLWA 2LYPA 3N7KA 2A70A 3VHRA 3AB0A 2EIBA 4AHZA 2WN3A 2A3WA 2PYTA 3ZFEA 4IUGA 1DYOA 3IDEA 1C3HA 2Y6HA 3KGZA 4AWDA 1X2LA 3IT8A 5FCCA 3B9IA 5BNPB 1NCQA 4YVWB 2VW1A 1A3KA 1IC8A 1ASJ2 3IAQA 4ITCA 3ZYHA 1VPWA 2E32A 2HJIA 1ZRIA 4YVWA 2HKXA 5DQ0A 3KVBA 1GZ9A 1J3RA 1O8PA 4NR1A 4Q4W1 4XHBA 5FAXA 3SQOA 3P5BA 3QOWA 5T5OA 1IKQA 3MIFA 2QNKA 2LYRA 2DURA 5F7UA 1ZNPA 2KEIA 3AVSA 2F4PA 4Q8LA 4H55A 4XUTA 3ZHIA 1VBD2 3R4DB 5EZWA 1D4M1 1AYN1 2ZX2A 1UYXA 2EAAA 3OPZA 3HQRA 1ULPA 2GP5A 4LKDA 4WM8B 5DZFA 3T2PA 4AVCA 5AFBA 4XE9A 5A32B 3MIBA 1K5JA 1NW3A 5SV8A 4AZZA 1NCQC 3ZXJA 1GKBA 1BDHA 4QGMA 4IV1C 1WCKA 4CUAA 3LSEA 4OBMA 2GP3A 3CJIC 3PUSA 4IA8A 1W05A 1J58A 2Q1MA 4UF0A 2YC4A 3VBSB 5E6HA 1POUA 1CJPA 1I9RA 3DV8A 1OH3A 2IXHA 4JGZC 4UOJA 5J09A 2RG4A 2JD9A 2K9ZA 3BGAA 3EQEA 3O9XA 2VTFA 4FQZA 2WZ8A 3F2ZA 5F3GA 5HV4A 4EKGA 3AMMA 4XILA 3PUQA 2QQPA 2OYZA 3RMXA 2D44A 2OT7A 5C6CA 4JQRA 5ISLA 2VZTA 3NMBA 1C8M3 3LCPA 5A33B 3DPRB 4P14A 1CONA 4AQSA 3OUJA 2A3XA 4LBMA 1RUJ3 3U1XA 2VULA 2EWTA 1X36A 3E6BA 2B4KA 5A7OA 2R7EB 3WDTA 4CCJA 1S0BA 4PQQA 2WWJA 1F5FA 1EP0A 2FJRA 5LBFA 1PVC3 1RXGA 2WNVC 1G86A 2WO3A 4QAWA 3N4MA 3WQ7A 2BNOA 1P8JA 2WABA 2UYBA 4FOWA 3SNMA 4MX3A 1W6QB 2CSGA 3WQ1A 3EJKA 1ENSA 3CNAA 3K3NA 4YG6A 2RDNA 1CN1A 5FKCA 3U10A 4N43C 4Q4Y3 5IUQA 3QBQA 4IEPA 5DG1A 2D6KA 3V56A 3WP6A 1DFQA 2RM22 3FFQA 4EV0A 2JB4A 3M3EA 1Z7S2 3FX3A 1K5MC 4M01A 3PMSA 3WQBA 2QBXA 3H8OA 1FPN3 1FI2A 3EYPA 3WNKA 4LO7A 3NNFA 4EN7B 2V4VA 1CIWA 5EV7A 1COV2 1D7PM 1O8SA 1RUH2 5LASA 4PT6A 1A8MA 4S2GA 1Y9GA 2B5AA 1WETA 2D3SA 1AYM2 2CROA 5G04L 2ZJCA 1SLIA 1FPN1 3GZAA 4O9GA 4XJZA 1J3QA 5FY0A 5BV6A 2CYFA 1ZREA 2D6PA 2XLGA 3D8CA 3AXDA 5T5JA 3U78A 3LEIA 3VUOA 5JWPA 3GN5B 3BYWA 2BBVA 2DVDA 3JCIA 4FPEA 4MGIE 1F5JA 5IVJA 3Q8AA 4JKLA 2HWD2 3SITA 2FDGA 4AFCA 1ULDA 3HT1A 4ZXKA 4MCTA 3ME5A 2ARAA 2YUEA 3VBFA 4DY3A 5FYBA 3PVOA 1ND2C 4LNVA 4R9BA 1XNTA 5FZAA 1HV1A 1UZZA 2ZEWA 1O7FA 2BPA2 3RZGA 2KEJA 3P3PA 4L8QA 3KT4A 1PVC1 1U5ZA 1W0OA 3IAPA 3OY8B 5DDJ2 4CEYB 3EXUA 5CADA 3DF0A 3VZOA 5FOJB 4MSVA 1WCSA 2C6SA 1ODMA 4LPLA 1PGSA 2XXAA 2RS13 1C8M1 1VBB1 4BMBA 1SEFA 2JDZA 1WW4A 1LOCA 4NHXA 3Q8FA 4XZUG 4K40A 2CAVA 3T2TA 4QPGB 1OI6A 2EXJA 3P3NA 4KWJA 2AW6A 2O14A 4ZHNA 2AZ5A 2HWE2 4MZUA 4OB4A 4QHBA 4AF9A 3TEZA 4CDXC 1LNSA 5J7MA 4H3WA 1RUC3 3IN9A 3B5LB 4NRMA 3VZMA 2ES3A 3A23A 3N9LA 2XG3A 2XSDC 5CEHA 2Y6JA 5LRSA 5KHIA 2HBUA 2O1QA 1OF4A 4X4HA 1CZSA 2JKBA 4MVTA 4CXYA 1OH4A 3WY6A 2JVLA 4GWMA 2AH2A 5LW9A 1AYN3 5FZ0A 4XHXA 1WMXA 1AX0A 2A6YA 4CCNA 1NCRC 1JS9A 4UFJA 2XHKA 3VWSA 1MS8A 3H7JA 2DTWA 4LXLA 3TRSB 5C3RA 1W8ZA 5H9SA 2BP6A 2R1JL 4IEOA 1BMV1 4IEXA 4PBOA 1YC61 4I6RA 5EWSA 4W6WA 1QMJA 3IMNA 3WOGA 1O3TA 1OCTC 1OPMA 3CO2A 4XJ9A 1JUIA 1BCXA 3NV2A 3MUY1 4HN0A 4XJWA 4Y5Z0 3WDXA 4KQ7A 4KMQA 4Q4W3 3O1RA 4CCDA 5SV5A 3ZYFA 3A22A 1TMF3 1QHDA 1C57A 3I7DA 4K1YA 1JU4A 4JQDA 3BN6A 5FZLA 1Y4WA 4TTGA 2KR2A 4S2HA 2LUWA 4GJYA 4KL1A 4CUCA 4OQ8A 1Q43A 4COUA 2WQ4A 4WVMB 1VAKA 3HR9A 2VZUA 4QDSA 2HBTA 2HEVF 4B4PA 3BPSA 1OMIA 5FZ7A 1DHKB 3R6SA 5IVYA 1VMFA 1JZ4A 2PUFA 4D0QA 5A7LA 2EALA 2VZSA 1HKDA 1FMD1 1PO11 4XCAA 2GNBA 4AQ2A 2XB6C 5I0TA 5FZEA 4CP1A 4CXXA 1IHMA 2WS93 1GWMA 4ET7A 1F31A 5FTTC 1HQLA 4JKKA 3R09A 3I3QA 2WFF3 1SPPB 3QD6A 3I2KA 4OMCA 1SFPA 4QGLA 5FZ8A 5FREA 3VBFC 2DFCA 4HOOA 4QX1A 1VE0A 2ZHNA 4RR3C 1IPJA 1AU7A 4IE7A 5APAA 5FUIA 1JU3A 3AKTA 1O91A 1JMUB 3RZHA 3QYXA 3LEGA 1D2SA 4AGGA 3S5AA 1CPNA 1BQPA 1W8HA 5FYYA 2VY0A 5FZFA 1W8TA 4E4ZA 4EN6B 4A6SA 4MCXA 5E1RA 3J4UH 4EZHA 2B9UA 1QJX2 3UWPA 3O5SA 3RJ2X 2O8QA 2WWSA 5C8CA 3KB5A 1YNAA 3DXUA 2P17A 3H1WA 5LA2A 1WLWA 1ASJ3 2ZGKA 4AEKA 1MQTB 1V6JA 3GF6A 3TAYA 1US3A 1YWKA 2V5DA 2PQQA 1L1MA 4XZPA 4QKFA 2E31A 4TWTA 5FMOL 1WCDJ 4FTSA 2WIUB 3ILNA 5KHKA 5FKBA 3THCA 2Q8DA 4CRQA 4Z92B 2VAUA 4AEDC 3VBOC 1EAH1 2YHJA 1PK6B 1LENA 4GKXA 5FY8A 2ZGQA 3N9PA 4YNIA 4BK4A 3I2HA 5DZGA 3OQOA 1UMHA 2VTXJ 2H6CA 2WIIB 4G3YC 3RZKA 4YM0A 2Z4FA 4B3NA 4LE4A 2ZABA 5JSRA 3KV4A 4IE0A 3UV9A 2GRLA 3ETQA 1AR93 2R063 4LUKA 5DUWA 2WNVA 1J83A 3TEXA 3ES1A 4JGYC 4FSJA 2OQ6A 1QIQA 2GMPA 1NZIA 5CFDA 2BZDA 1V9U3 4ZONA 4UI9L 3S8QA 2HWE1 2DF7A 3VL8A 3LGRA 3RVHA 2UY8A 1H4GA 4JGYB 1TNRA 3S0MA 4AG4A 1R083 3HBZA 1CJDA 3AYDA 3LZZA 4R8HA 4KU7A 4B8EA 2VECA 5L9VA 2WZR1 1GV9A 2GRMA 1XU2A 4B7EA 5GLTA 4XDOA 3ZM8A 1DZRA 1X7NA 3C7EA 4Y1ZA 4CU9A 4PQ9A 1KXGA 1XWRA 2JD4A 3WP3A 3HNBM 3KZ3A 5IHRA 3N3HA 1NXD1 2TUNA 5AC92 3LIGA 1AJOA 2A3YA 2WINB 5FZOB 3EMRA 1DYKA 2PHUA 1V70A 1BYHA 3ZXKA 3V0BB 1ZZCA 2X8KA 3T3YA 4RGGA 3JB4C 3ZSLA 3ZXFA 5BNNA 1VR3A 4Y20A 1RUOA 3WHTA 4AI3A 4B1LA 1YQ6A 3T09A 3VKLA
chains in the Genus database with same CATH topology
3OTFA 2ZGLA 1G7YA 3VBUC 4N9IA 2VH9A 5CIRA 1U5IA 5CG9A 1EFAA 1YHFA 2VVFA 4IV3A 5GLUA 1R63A 4FAGA 2DCZA 2HWB3 1QJZA 1HQNA 1VBC3 4P9LA 1V6NA 3A0NA 5T5PA 1AYM1 3WG2A 4OHWA 3RNSA 4C0HA 3ZSJA 1BEV3 3A4UA 4WVWA 2ZCWA 1CAXA 1YYNA 4CDWB 1LHNA 3UK9A 1QQP3 3H3UA 3NL1A 5HCFA 1B09A 5FRAA 4EWEA 1PERL 4AEDB 2NQYA 4C0BA 5JPNB 4B7KA 3WDWA 5JMCA 5EYYA 1N3OA 2NLRA 5J98B 2Z42A 2XBO2 3AYEA 3MIEA 3VZJA 2NP0A 1OQ1A 5T3NA 3R4UA 4P9GA 2QKDA 3DGTA 2XLFA 1AJKA 2P34A 2TEPA 1RL3A 1TQ5A 1XNDA 3MIGA 3ZXGA 3RI9A 2CWSA 4DMIA 5C33A 1U5XA 5CAZA 4BM8A 4D69A 1XE8A 2I07B 3K51A 1AL23 1HDKA 4N53C 4AQTA 3ZFEB 3USSA 1F8VA 1PNRA 2B7YA 4QM8A 5LEJA 1YO8A 3KT7A 1ZBE1 2CAUA 4RS5B 3AKQA 1RUF1 3J9SA 3UFDA 2B42B 1UTXA 2VNRA 3K48A 3ZFFC 1S7EA 4RA0A 2PUAA 3GNEA 5KXCA 2XL7A 2YYOA 2QFEA 1C8M2 4OI1A 3KCYA 3VZLA 4FAHA 2W08A 3B9CA 1RUJ2 2D6OX 2IXKA 2ZACA 5KC5A 3MLJA 1RIRA 1D2QA 4HSLA 4ES8A 5GALA 1GLHA 2WNUB 3N7LA 1H2MA 3EBRA 4PBPA 5I93A 2QDRA 1GT0C 2X53S 2JCGA 4HK8A 4N53A 1AVBA 5BNPC 3O12A 4Q4Y2 3TN93 1NY72 3R1FA 1QJX1 4AI2A 3ROUA 3L2YA 2G9GA 5EJ3A 4ATFA 3VBSA 2VVDA 3H7YA 3ZFGC 1ULEA 1VAMA 1JN2P 2RS33 5KC6A 1O3RA 4CP2A 4HZFA 1COV1 4HETA 4GH4B 2RE9A 2G4IA 1MS4A 3I59A 2HINA 2WNEA 2IV1A 4OI4A 4XQDA 3SH3A 1HRI1 4EJRA 3NAPC 4Y1YA 1WIZA 1TME1 1ULFA 5D8AC 1IKPA 3PVEA 1HLCA 1RUF2 2QVSB 4LE3A 1PNFA 4LR4A 3VKMA 4D7TA 4QPYA 2NMOA 2IVQA 1N1VA 2ENRA 2ZHMA 2XCJA 1PIV2 2H0VA 1ZRDA 1O3SA 2RMU2 1FOD2 4I3PA 2ZMKA 1YFXA 2DCYA 3ZDSA 4JGZB 1JFSA 1DQ2A 5GLZA 3B7MA 1BZWA 2ZKNA 3HN1A 2Q4SA 1BK1A 1OA2A 5DDJ3 2Z79A 4QQPA 2D97A 3THPA 1V6MA 2A6ZA 4YW4A 3OD0A 5JSPA 1RUE3 4FPLA 4Q0SA 2WKKA 4MGKE 5GM0A 1R1A2 5BPXA 4XF1A 2FHRA 4E2SA 3AFKA 4XMIA 3CLCA 1X50A 2PIJA 1AR81 3EHKA 1JHNA 3PLQA 1O4YA 1U0AA 4MXWA 3RYRA 1QQAA 3DPRC 5L7OA 3MZHA 3ZVXA 4C91A 2AYHA 3JD73 1QOOA 2OA2A 1BJQA 1QXJA 1Q8SA 3MDPA 4W6YA 4Y20B 1QWRA 4PDWC 4GB31 5FLHA 1AZDA 3FWEA 1GQGA 4HVRA 1RZRA 1ADRA 1UXDA 5CNAA 5GZDA 1QP7A 2JE7A 1NA1C 2D93A 2QUOA 3M70A 1RINA 4D7SA 5JOWA 4TZDA 4P5HA 3F6WA 1HX6A 5F6KA 3ZYJB 4AEDA 3VDDA 3HAGA 2R0FA 4G9SB 5JPMB 2QE3A 1SCRA 3RJRA 3PHMA 1FNZA 2GALA 2WSVA 1W6OA 4UW6A 2BFUS 2BGCA 3APBA 2EXHA 4ZKTB 4I02A 5KWRA 3VZNA 2VOVA 4XF0A 3UJQA 1H1MA 2VGDA 2X5IB 4GIQA 4H14A 3VV1A 5C8CC 1LOFA 1ZVFA 1S0DA 1V6IA 4FP3A 1O5UA 1S0FA 1MEC3 2V73A 4L9BA 4RHV3 1RHI1 2ILMA 2YMZA 4XFFA 4YVSC 1RUD1 4D3WA 3AMQA 1VBE1 3FLRA 1GBGA 1HIXA 3LAGA 5D1IA 1PRUA 2JXAA 2GSYA 1VAVA 1CJGA 1SLCA 1KRIA 4YVSB 4BH9A 1SBDA 1OQDA 3SCGA 1S55A 3B7HA 4AE2A 1URXA 2HWB2 3ES4A 3E5QA 1RZSA 1RITA 2BQPA 1LHUA 2ERFA 1DGRA 2JG9C 3ZIWA 1IS6A 5JIAA 1CAWA 1EY2A 1BEV2 4CDUC 4FBFA 5J96B 3HD8B 1DDLA 4TLFA 2R6QA 2A7AA 1LRHA 5JZGA 3AK0A 1QDCA 2ZZQA 5ABJA 1NERA 2IFRA 4PDWA 2BEOA 2QZ3A 4LLOA 4XEZA 4AHYA 1LESA 3V65A 3JZVA 3ZIXA 4N43B 1WLCA 1WW7A 4PDWB 4Z1VA 2XBO3 1SCSA 1C28A 1RVF3 3G7DA 4EN0A 2IWGB 2MEV3 2KM2A 2XKOA 4RSUA 3VHOA 3O0XA 1VBA2 5L7OC 1FPN2 2PFWA 4CYDA 3B00A 2HWC2 3DUIA 3OCPA 4AHXA 4XBLA 1GZCA 1W0PA 2XJTA 5GZEA 1AR92 1DF0A 1AL22 2OIIA 1C1LA 4P9JA 4Y1VA 3WG3A 2KA3A 4LLFA 1CAUA 3AZWA 1CQ9A 2FQPA 1RUI3 1Z7S1 5KHJA 2PELA 4YM1A 1ZZ7A 1QP0A 2RM21 5LK5A 1UL9A 3J26N 2Y0IA 4RR3A 1HV0A 3H50A 3PXPA 3L1PA 2HWD3 4FO9A 1ZM1A 4IQPA 2QZ2A 2UWAA 3UKVA 2ZHLA 1ZBA1 3AZVA 1H2NA 1AR71 3VBHA 3WVJA 2IXLA 3ZXEA 2R63A 1HXS1 4YGCA 4LULA 5L36A 4NPRA 2QJVA 5T50A 2IVGA 4Q1RA 1JBCA 3VBRB 3HMYA 2WNVB 5AVAA 1X57A 5J3UA 3JU9A 3JBG2 2EA7A 3U3WA 2JX9A 1OA3A 4CDUB 2UWCA 4CDXB 5FLJA 1ZRFA 1DZQA 3M3OA 2BTVC 5GZCA 2C9AA 2NZ9A 5FBZA 1QJU1 4AVAA 4URTA 4H7MA 1LHWA 3KXAA 1AL0G 2PAMA 1X82A 3TRBA 5H9QA 2Q1ZB 3H0OA 4XETA 4PU4C 3TB0A 4MUVA 1PK6C 4XJUA 4I01A 2HWC1 3WCRA 5T54A 3KD4A 1VBD1 3J8F1 3FFZA 5KBFA 4LHLA 1RJ8A 3L2HA 5L7OB 2UWBA 1Q8VA 2EVXA 3NWKA 5C8WA 1S2KA 4HKLA 1XYOA 2D6LX 1N1SA 1QJY3 4YM2A 3VBOB 1QDOA 1N1YA 2EF8A 4Q4W2 1W6MA 2D5VA 4J1XA 1LECA 2GDFA 1TMF2 5C4WC 4META 1UKRA 3MPPG 3WDYA 4PU3C 4E27A 4MXVA 4Q4V2 1CAVB 3VBFB 4Z5CA 3A0KA 4BZ4A 1R1A3 2LYQA 1BVVA 4OHZA 4FPHA 1AR61 2CL2A 1S0CA 3ZYPA 1UF2C 3USUB 1PO21 1RUD2 3MFCA 4YGDA 1YRZA 3NV3A 1B35A 4COZA 1YFUA 3WZ1A 1XNBA 2X5IA 4NWWA 3QH7A 2PTMA 1Y7YA 1B35C 3PJQA 2XJUA 1ND3C 2F6BA 2O8OA 3JUUA 4K9SA 1POV3 4Q0VA 3BODA 5FQ0A 2HEYF 2TBVA 5H9PA 3JQXA 4JDNA 2VOWA 2VW0A 4RD7A 5GKAC 4YRDA 2DUPA 2GNTA 1EYBA 4QX5A 3OF1A 2DWRA 1LCDA 3WDVA 4COVA 4IV1A 1SFNA 1PHMA 1H0BA 3FHIB 5CFCC 2UU8A 1LEMA 2IXCA 2RR11 2XVGA 4QQOA 2XL9A 3E5UA 4IXLA 2R042 4Q0UA 5C4WA 3TN92 1ZA4A 2BW8A 1XNCA 1OPOA 4Q26A 2YROA 4QXKA 1PGL2 4R4ZA 1LCLA 1MS5A 1GNHA 1N1TA 3H1MA 3MFAA 3ZFGB 3QLQA 4YW1A 1X8EA 2R072 2HWF2 5JAXA 1ZBA2 3O7OA 1TNFA 2WUSR 5JZGB 4BWOA 3CECA 4XXAA 1J1LA 4AVBA 2DFBA 4YG4A 3NAPB 3O0VA 3VZKA 4JTNA 5A3MA 4WM7A 4DOUA 2VW2A 3MICA 4D94A 3AMPA 4ORFA 1YSEA 1V00A 3MF6A 3GBGA 4LBQA 2FZ2A 4A7ZA 2GC3A 3NSTA 2D43A 1DWKA 4S2DA 4WBBA 1C8NA 2ZMNA 1VRH2 4J6GA 5FO7B 3ZFEC 1WD3A 1V9U2 2PUGA 3S7IA 2P3JA 3THTA 3WD5A 1PGW2 4HVOA 3RYPA 3ZMOA 1FOD3 1QY4A 3B93A 1DLLA 5GLVA 4AEMA 4IESA 2D7FA 1D4VB 1DIWA 3QCWA 2GNMA 3WNXA 4P9YA 3SISA 4AI0A 4JVAA 1LLIA 3CJIA 4F7ZA 3RMYA 1WGPA 1ZRCA 5LK7B 1RUE2 2PLV3 4OHVA 4Z07A 3LSDA 2GNDA 1LU2A 2IFWA 2A6WA 3VBHC 1PNGA 1D0GA 4K20A 1YJLA 1IPKA 1SQ8A 3HZIB 4HKOA 1FX5A 5CFCB 1NE4A 2LCVA 1DGWA 2RS53 4TSVA 3VBHB 1RMU1 4MYEA 3RG0A 4JAAA 4AFBA 3VBUB 2YXSA 4F83A 1UXCA 1AXZA 1LGNA 4I6TA 1MVQA 4AK3A 4Q29A 3VBUA 3D4KA 2AWIA 4X4FA 4JCYA 3BB6A 1RVF2 1LGBA 4JRLA 2MEV2 1TEIA 1VBA3 1W39A 4YVWC 5F9TA 4IWRA 1VBC2 5EXOA 4R9CA 5JZGC 2OR1L 3AZZA 1UU4A 1V6OA 2VPVA 1DGRN 1VB4A 4CDUA 1MS9A 1A6CA 4F8DA 5EFUA 3T1MA 4GMP1 2DUOA 1RUG1 1ZX5A 2B45X 2G9FA 2O0OA 3QQ6A 2NM1A 1O4XA 2ZX3A 3UJOA 1WBLA 1HRV1 4GHJA 3DL3A 5JDBA 3DN7A 1AR72 4LTAA 4GXLA 2VNOA 4QPIA 3X29B 4LBOA 2WNUA 3IPVB 2A6XA 4X4EA 3V0AA 1H30A 3U07A 4WV8A 3ZKCA 4YW3A 5LRRA 1SFYA 2NPIA 4RS5C 1PZ7A 1VALA 4JGYA 1OLQA 2R32A 1GR3A 1JOJA 4N7UA 2PE5A 4HK9A 3NVCA 1ULCA 2MQKA 1C4RA 5C8CB 5FO8B 2VXRA 3E5XA 2JEMA 1NLSA 4RHV2 3FMYA 4GMP3 1MR5A 1VJ2A 3UL2A 1G9DA 1BBT1 4FN3A 1I1EA 3D6EA 3KCXA 1FV3A 3M2MA 4R9DA 4CEYA 3JBG3 1VIWB 2WNUC 4AYUA 2YPJA 4HANA 2PHXA 3LA2A 3OQNA 2XPJA 3MF9A 3AKPA 2AXZA 2VMHA 4JTOA 1NEQA 1UW8A 1CESA 2VG9A 4QMAA 3WV6A 1RMU3 2B8MA 4CDWA 4LO6B 4Q2FA 2VQAA 2RS51 4HVQA 5CA6A 4M0NA 1L3JA 4I3GA 4XTMA 4KWKA 1QOSA 4Z2WA 4LEJA 2PLV1 4YFWA 2D3RA 1BMV2 1H4HA 3WUCA 3IBMA 4M3CE 2EBYA 3AM2A 1MZ5A 3ILRA 5CG8A 2LYJA 1WH8A 1HF0A 2WZR2 5K7PA 1RTVA 3F51A 4IEQA 3OYWB 5L19A 1RZRD 1GICA 1FT9A 2LALA 2H0BA 3B02A 1RUI2 1ALYA 4YG1A 4MH0E 1F2NA 1R091 2Z69A