1ZZ9A

Crystal structure of feii hppe
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
192
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKEPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
total genus 44
structure length 192
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz9A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz9A02
5KHGA 3S7EA 2Y0OA 1WGPA 2DCTA 4GULA 1O3TA 2KPJA 3JXDL 1J59A 4R8HA 3USSA 1DGRA 4LTAA 5FLHA 1ZZ9A 4I3PA 3EO6A 4Q0VA 1YLLA 1WH8A 3H7YA 2EBYA 1RIOA 1PRVA 3LAGA 3TRBA 1Y9QA 1TQ5A 4QM8A 4L11A 1LLIA 1S7EA 3ACLA 3LOIA 4QMAA 1LR5A 5D1IA 1RZRA 1GT0C 3RYRA 4DINB 5JCTA 1RGSA 1YFWA 4L2NA 4MGZE 5JR7B 1RUOA 4ZU5A 5LRSA 3KXAA 2PQQA 3SMHA 2QJVA 1LB2A 1NERA 2PHLA 2D93A 3OD0A 3H7JA 4MUVA 2Z69A 4I02A 1GQGA 3KZ3A 2R63A 2PUDA 4JTOA 1L3JA 4R52A 4E2SA 3E6CC 3H3UA 1RUNA 5BY5A 2R1JL 4I2OA 3VK0A 1J3PA 1ZZBA 3I59B 1X7NA 1O3RA 4J1WA 5I8YA 2QNKA 5E1RA 4K8FA 1ZRDA 4PU7A 2OFYA 3CROL 1EPZA 2F4PA 4X4GA 4Z5HA 3FMYA 1EP0A 1EY2A 3E97A 3I7DA 4PU4C 1B0NA 1LQCA 2WUSR 2LCVA 2L49A 5I0UA 2Q0AA 4YYOA 4FN3A 1QP4A 2GZWA 1DWKA 2IXJA 3BALA 4O8BA 2BJCA 5T3NA 3R6SA 3S0MA 2OZ6A 5I93A 4X6QB 4JVAA 4LEJA 3GN5A 1ZZ6A 3DN7A 4Q0PA 2OYZA 2CAVA 1WH6A 2LYQA 3OQMA 3IVPA 5C6CA 5CADA 1X82A 2AXUA 2PTMA 4X4IA 5KHKA 2JCGA 1RC6A 3H1YA 1J1LA 3CECA 1ZUGA 3L2HA 5J48A 1Q43A 2Q30A 1PM7A 5FCCA 5FLJA 3U3WA 2EA7A 2ET7A 4MX3A 2QVSB 2BNOA 2FQPA 2PAMA 3FFQA 2H6CA 3E5XA 4IEPA 1ADRA 4HZFA 3C3VA 1O3SA 1I5ZA 4YBAA 2KEJA 2IV1A 3KGZA 1CAWA 3E5UA 1YSEA 5JAXA 2VQAA 3OMTA 4OLLA 5K8SA 1H1IA 2IXHA 3QACA 1NE4A 3ES4A 3UKTA 2HSGA 2WFPA 1DZRA 3MYXA 1ZRRA 4JV4A 2UY9A 1LRHA 2H0VA 3ZKCA 1FT9A 4PU3C 2EAAA 1OI6A 1CAXA 1PMIA 2Q4SA 4XFCA 5HI0A 2LYPA 4XF9A 4YRDA 3ROUA 3QF3A 1WLTA 3KGLA 1WIZA 2CROA 3E5QA 1YWKA 1LCDA 3NW4A 4META 5I0TA 2UY8A 4GQMA 3BPZA 4YNIA 2OA2A 2PFWA 3LISA 3UKNA 2AXZA 3GN5B 3OF1A 4HVRA 1PNRA 2IXIA 4XFHA 2N7GA 1ZZCA 1NXMA 2IXLA 2HINA 1FXZA 4FBFA 2XGXA 1BDIA 1QY4A 1YFXA 4Z59A 4ONUA 3IWZA 3WW1A 3RDIA 2LYJA 3UKVA 4Z5DA 2PPXA 4H7LA 1UD1A 4LA2A 2Q1ZB 2IVBA 2XLAA 4EWEA 4HN1A 4QM9A 2XLFA 1XE8A 1ZZ8A 4YARA 4PIXA 4XF1A 4IVZA 1QQBA 1WA4A 2D5HA 2H6BA 3JZVA 4IEYA 2QDRA 1DGWA 3H8UA 2CGPA 1UXDA 3FWEA 1LKNA 2ETEA 2AW6A 4KU8A 2LYRA 3O14A 3DL3A 3D0JA 4CYDA 1SQ8A 4OB4A 3MZHA 3RYPA 4IERA 1X2LA 2XKPA 4IA8A 3SCHA 2B9UA 3KSCA 1YUDA 3E6DA 4MGYE 3L1PA 3SCFA 1UW8A 1CAXB 1J58A 3BDNA 2PE5A 3FYMA 2PIJA 2GC0A 1R63A 1LCCA 4UBHA 1CGPA 1O5UA 1UIJA 4A2UA 1V70A 5JSOA 3IBMA 4JCXA 2VPVA 2AUWA 1VPWA 3E6BA 5BV6A 1JWLA 4FBIA 5FQ0A 3CEWA 3H9AA 2GAUA 3CO2A 2GH2A 5BPXA 2HKXA 2MHFA 2VECA 1Y3TA 1O4XA 4IWRA 1YFUA 2HJIA 3LZZA 3WW2A 2L8NA 1PRAA 1VP6A 5KBFA 3ETQA 4MZUA 1WETA 4HLTA 2PA7A 3ELNA 2A6CA 3JXCL 1I6XA 3LA2A 1CAUB 1PRUA 1QPZA 1CAWB 4Z07A 4ORFA 4WBBA 3CLCA 4MCXA 1XWRA 3BB6A 1L1MA 3F51A 3FJSA 3ES1A 3IIAA 5J3UA 3JXBC 2XI8A 1U12A 3HT2A 2C0ZA 4I6TA 1NE6A 1JFSA 4KWJA 4PIYA 1UIKA 2IU7A 3ZHIA 3OTFA 3QOPA 3MLFA 4KL1A 5I8SA 4MV2A 2FJRA 4Q0SA 2JVLA 1JFTA 2GRLA 4JTNA 3SHRA 2MEZA 4NDWA 4IEVA 3CF6E 4FAHA 3D1NI 3PLQA 4BYYA 2AWIA 1O4TA 2XL9A 4Q0QA 3EHKA 3U10A 3O9XA 2CAUA 4LUMA 4LA3A 4UXAA 1LMB3 3LFPA 3RZZA 4LLOA 1RPEL 3F52A 4Q0UA 3LA3A 1X57A 3EQEA 4Q29A 5LEJA 4JCYA 3DV8A 3HIFA 2LYSA 1ZNPA 5J7MA 4X4HA 1IPKA 1QXJA 2UYAA 1ZRCA 1RZSA 5LEKA 1JH9A 3LWCA 3NJZA 1YFYA 4YG4A 1E3OC 1SQ4A 1BDHA 4X6RB 1XRUA 2B5HA 2K0GA 4XETA 1PERL 1ZVVA 1CAUA 2PAKA 3WW3A 1VR3A 2O38A 2XIUA 3IDCB 3EJKA 3H50A 4FAGA 2OPKA 1CJGA 1HW5A 1QXRA 1ZAYA 3EBRA 2XJ3A 3BU7A 3CLPA 4ZU4A 2ICPA 3DKWA 1Y7YA 2CSFA 3MPBA 3BS3A 1OMIA 1NEQA 1OD5A 4HVOA 5EFUA 5FLIA 4IEOA 4AVAA 1GQHA 2LYLA 5K98B 3D82A 2UYBA 4PJYA 1O3QA 3M3IA 2OZJA 3KJXA 3MDPA 4P9GA 5FQ0B 4O9EA 4MH0E 3F6WA 3U0ZA 5FPXA 1G6NA 3QYXA 3BCWA 4O9GA 3S7IA 3RNSA 1QP7A 1ZVFA 2GU9A 3H1WA 5KHJA 4QGLA 2IUOA 2FMYA 2PYTA 1CAVB 4BIFA 2Z2SB 4EWDA 2B8MA 2ZKLA 4B29A 2D5FA 3CJXA 1ZPQA 3BD1A 5C8WA 2WC2A 3KMHA 4HSLA 2BNNA 1UXCA 1QWRA 2ET1A 4N9HA 4BHPA 4PU8A 3NKTA 1ZS4A 2XLGA 4X4CA 4D7TA 4X4FA 4XFBA 4I6RA 4I8TA 3WW4A 4PIZA 3G7DA 3PXPA 2H8RA 4YG7B 2XKOA 5F1RA 3FZ3A 1R69A 2PUAA 4XFAA 2EF8A 2OR1L 2QCSB 3OQNA 2ATFA 2BEOA 2IVGA 2MQKA 4HBNA 4XEZA 5BUVA 1RTVA 2I45A 5I0RA 3NSTA 4XFFA 3RPQA 1RL3A 3N4MA 1EFAA 4Z58A 1UCXA 3FX3A 4YSFA 4EWAA 5I91A 4X4EA 1CX4A 4IESA 4KWKA 3LA7A 1QP0A 2XHKA 2O1QA 2ICTA 2KXLA 4MGKE 2O49A 4N9IA 2GZUA 1OSLA 3FE5A 4J1XA 3OQOA 1NZCA 2GC3A 4QGMA 1CQTA 1QQAA 2IC1A 4F8DA 4LULA 4HN0A 1YHFA 1OFNA 2ZCWA 4AVBA 2PUCA 5CU1A 1DZTA 5KHHA 1IC8A 3OP9A 4ZU7A 4IEWA 5E16A 3QWGA 4RD7A 4BH9A 2O8QA 1ZREA 2IXCA 2AXVA 1ZX5A 3PNAA 4KWLA 4Z82A 2WIUB 4I01A 3SXWA 1SEFA 1UTXA 1AU7A 2PAEA 3NL1A 1J3RA 1Q3EA 4YG1A 4AQ2A 3U11A 2KZ8A 1DW9A 1NYWA 1H1MA 5LRRA 2D40A 3QQ6A 1O5LA 4AQ6A 3ZHMA 3FYAA 5A7LA 3H5TA 3HZIB 1IPJA 5AVPA 4UBGA 5KHIA 2MNGA 4HMZA 2V09A 4KU7A 5JSPA 3PVBB 3CL1A 3OCPA 2PUEA 4QX5A 2XSDC 3TNQA 3G5GA 1HF0A 4HSJA 1ZZ7A 2XCJA 4E2QA 3B02A 1UPIA 5EZWA 3S8QA 4IETA 3TNPB 3H3ZA 2BNMA 1FI2A 1XE7A 3UFDA 2E9QA 3OGJA 4LUKA 4Y42A 4AXOA 4F8AA 4EV0A 5FPZA 3DNVB 1X8MA 3FHIB 1X8EA 5FDBA 4XFGA 4IEXA 4GHJA 4F7ZA 3R1FA 2BGCA 2K9ZA 1ZRFA 3KCCA 1J3QA 4Z5CA 3IDBB 4XF3A 2EWTA 4WZCA 3B7HA 4XFIA 4JQDA 1O7FA 2P17A 4OFGA 1CAVA 3RYKA 2D5VA 2PUGA 3I54A 2CV6A 4IEUA 4I6UA 3M70A 2KEIA 5BXXA 1OCTC 1EYBA 3H1MA 4QXKA 2BYVE 2GC2A 2LYKA 4IEZA 1Q5OA 4I0BA 1RZRD 3HT1A 5I0SA 4X4DA 2XL7A 4WVZA 3ZDSA 3HQXA 2B5AA 3VHRA 3GYDA 3NVCA 4IEQA 2GRMA 4TLFA 5I8TA 4I0AA 4FT8A 4XF0A 2PUBA 1POUA 2MPFA 4QGNA 5CVRA 2O4AA 4X4BA 3I59A 2GC1A 2PUFA 2IXKA 2PHDA 3EUSA 4MGIE 3SCGA 4EROA 3GBFA 4AVCA 4D7SA 2EVXA 2KEKA 4XF4A 3D0SA 4HVQA 5JSRA 3ST7A 4NVPA 4MCTA 1SFNA 2IVQA 1JUHA 4I09A 4E2GA 1VJ2A
chains in the Genus database with same CATH superfamily
4M01A 3ZDVA 5KHGA 2Y0OA 2ZOEB 4CDUC 1WGPA 1O3TA 2XVKA 1DQ4A 2KPJA 3NMBA 4GULA 4KGGA 4CDUA 4FFIA 4YFZA 1J59A 3K46A 3WUCA 2Y6JA 2FFHA 1ZBE1 5FLHA 2EAKA 2EIGA 4LBQB 4CP9B 2PXEA 1JOPA 1YLLA 4QX7A 1O8PA 1VBB3 2ZAAA 5JXIA 1PGL1 1R083 3ZYGA 3WF4A 2ZGNA 1PRVA 1QJX3 4V1PA 4NIIA 4M00A 1LLIA 3LOIA 1C1FA 3PL0A 4QMAA 1LR5A 3BN6A 4N90A 4OHYA 1MS4A 4CU6A 5CYYA 3SNMA 5IVFA 1QGLA 1BVVA 3N9MA 4G9SB 1SLIA 4KG8A 4ZU5A 5FAXA 3WG4A 5LRSA 1CESA 2DU1A 3VD9A 3LCPA 2JB8A 2QJVA 2VVFA 2ZHMA 3A0KA 4PF5A 4TSVA 3SMHA 4CDXA 4Z2AA 4ES8A 3KQRA 4I02A 1GQGA 1FX5A 5GLUA 1RUNA 5BY5A 2R1JL 3RWKX 1BBT1 1LOAA 1QDCA 3VL8A 4I2OA 3VK0A 3O12A 5A33A 2VE1A 1W8OA 2ZGUA 2A6ZA 3UK9A 3VZNA 1BBT3 4IGQA 1GFF2 1N3OA 1BEV2 4K8FA 1O59A 1WCSA 4XJWA 5ANNA 1JZ7A 2F4PA 1RHI2 2D6OX 4CDWC 2XJUA 4DRRA 1EP0A 1EY2A 2ARCA 3E97A 5CFDB 4A7ZA 2OQ7A 2V72A 1W8WA 2B39A 2LCVA 4QPYA 2L49A 3SX0A 1DZQA 3U37A 3VBUC 5H9SA 5HV4A 1BK1A 1GZCA 3WCSA 2AUYA 4LE3A 4M4PA 1DWKA 2XXQA 3BALA 3UYJA 5DTQA 3R6SA 5L7OA 3SC7X 2OZ6A 5I93A 4X6QB 4B4QA 1ZZ6A 1W6PB 5FY5A 2VNRA 3T09A 4CSWA 4F83A 4COVA 5EIYB 1PK6C 2VMIA 5E88A 3T2OA 3KV6A 1ALYA 1WCUA 5F2WA 3JBG3 1X82A 2TUNA 2YU2A 4P9LA 3AMQA 5T50A 4X4IA 1F4HA 1FOD3 4JCKA 3H1YA 2VZRA 5FXWA 1FV2A 1G9CA 3ZN6B 2JDAA 3WSOA 5J48A 4XABA 1PM7A 3WNPA 5FCCA 3WNMA 4ZS3A 4FVVA 3U3WA 1GNHA 3DGTA 1HB4A 2QQLA 2XBO1 3FFQA 2PXVA 1U5XA 2PAMA 2H6CA 3NV3A 1YIPA 4M3CA 5DAXA 2XUEA 1RMU1 4ISRA 4IEPA 4V2VA 1ULEA 5BNPB 5D8AC 2GNDA 4HZFA 4QT6A 3ZXDA 5BNPC 4DIQA 5C4WC 1KRIA 1O3SA 2WA3A 2WO1A 4XZPA 4UAPA 2QQVA 2ZGSA 5FMCA 1DQ6A 4LNVA 4XTMA 1CAWA 1MFQC 1LNSA 3CMGA 1YSEA 3KCXA 5K8SA 4OLLA 4OBMA 1R081 5DTMA 1UY3A 1UU6A 4FOVA 4OHXA 2XB6C 4UFIA 1PO12 2HWD2 2EXKA 5FP3A 5CFCC 3LFIA 3A9ZA 2WFPA 2ZX4A 2X05A 3W20A 2AACA 1JZ3A 1AX0A 2UY9A 1POV0 1HB3A 2WWSA 3MF9A 4CEYA 1I5PA 2W47A 2BWCA 1VE0A 3WEZA 1LU1A 4PU3C 2E7AA 3KV4A 5DUXA 2FDGA 1CAXA 2D7FA 1T2XA 4M3CF 4AGRA 2JKXA 3WP6A 4LBQA 4R4ZA 1PIV2 3KGLA 1IOAA 1HB2A 5JLVA 1B35A 3HQRA 3T0AA 1OOPA 2HBUA 1LCDA 2VVDA 2YG0A 1YEWA 3H3LA 4GQMA 1RUH1 1LENA 4LK7A 2OA2A 4LO4B 3ZFGB 4RR3A 2NP0A 3UKNA 2AXZA 3OF1A 2IXIA 4A44A 2C9AA 1NXMA 2IXLA 4Y1XA 2C1FA 5LW9A 2BU9A 1GP6A 1OSGA 5ISLA 1YFXA 4Z59A 2W3JA 5IFTA 2E6VA 3JD72 2Y6KA 1W6NB 2VCMA 1HV1A 2VMHA 2Y38A 2BQPA 4FP2A 4LLFA 5A7WA 4A6OA 2A3YA 4AFBA 2PPXA 2VOXA 4H7LA 3GZDC 3UESA 1EV13 1XOYA 2UURA 3ZYHA 2R061 1W8ZA 2EIDA 1VBD3 3HJRA 4AHXA 4YW1A 4QM9A 2XLFA 3FUQA 4M3CB 4AI0A 2VH9A 4YARA 1HN1A 3WDTA 1QQBA 1MZEA 1B09A 3PHMA 1GWKA 4FOQA 2V5DA 4RHV3 5FTTC 5DABA 3ZYFA 5CFDA 2EXJA 5BNPA 2LUWA 3ZPYA 4XIOA 2SBAA 1W6QB 3KT1A 3OGGA 3H8RA 1CX1A 3FWEA 1JH5A 1RUI3 5LCWL 5FZAA 4AQSA 4ZXKA 5FBJA 4LJHA 4Q2JA 4CU8A 1AYN1 2ZS6B 2GSYA 3HEIA 1PIV3 4I0WB 3D0JA 3U75A 2WZR1 4CYDA 1DYPA 4BOWA 1AR91 2L1PA 5J96B 4Z92B 2RE9A 4IERA 4NAOA 5LK5A 5AC92 2B9VA 5KWRA 3E6DA 3ORJA 2ENRA 4WZFA 4YWAA 3L1PA 3LQCA 1J58A 4YZ3A 1TNFA 3OUHA 4UBHA 1LCCA 1REDA 5JSOA 1LEDA 2YUEA 1ASJ3 1VPWA 4CUAA 3RQ0A 1Y4WA 5C9AB 1JWLA 3TB0A 3ZSLA 3C7EA 3JD73 1OOPB 2GAUA 3ENRA 2HKXA 4GWJA 5FFOC 5BPXA 1YQ2A 2VECA 4RQPB 5FPLA 4OCTA 1QDOA 5EHDA 4YW3A 3LZZA 1F5FA 1SMVA 2D3SA 3J8F2 1BCXA 1PVC2 1QJX2 1W0PA 5IW0A 2NMOA 5F3CA 5KBFA 4MZUA 3I8TA 1YYNA 5LA0A 4K1ZA 4JZRA 2Y0IA 4AL9A 1SPPB 5DDJ2 5F3EA 2WO3A 4ATEA 3TEWA 4QPWA 2JDUA 3LA2A 3MGUA 1CAUB 4O65A 1OF3A 4TN7A 4Z2WA 1LHVA 5DDJ1 3ZXFA 1XNDA 4AI9A 2BJSA 2OUHA 1L1MA 3F51A 1F2NA 4S2HA 2BGPA 4QB2A 1DQ2A 2PHXA 3FHQA 3IIAA 5IK8A 2GP5A 4NWVA 3JXBC 3LDRA 3KF5A 2JDKA 2NLRA 5T54A 1V6MA 4WVLA 3KV5A 1JFSA 4LO6B 4CCOA 5FBZA 3ZHIA 1D4M2 1QOOA 3QOPA 3OBTA 5F6KA 4IGOA 4Q0SA 4YW5A 3N9LA 3KVAA 4TWTA 4BMBA 3N9NA 3OBZA 1KQRA 5LWBA 1LHUA 2HWB3 3OGVA 2VMDA 2ILMA 1RUE3 2Y33A 1UXZA 2YC2A 1JFTA 3FL7A 3VBRA 4JTNA 4BA6A 1WCQA 1Q8PA 2O0OA 2VNGA 4IEVA 3TEZA 2K46A 2YFUA 4BWOA 1UXXX 3PLQA 4WVMA 4BYYA 4LBOA 4QPGA 2JG8A 2WRAA 3WINE 1XPWA 1V9U3 5FUPA 4DUVA 5K9YA 1RVF2 2IFRA 3X29B 4ASKA 5A7WB 5A7QA 1LMB3 3LFPA 1W2NA 2Z4FA 3HBZA 4RFRB 1WLDA 2UU8A 2XBO2 1QKQA 3NV2A 4JHTA 2R0HA 2WNVB 3C7HA 1X57A 1KXGA 3JQXA 1AL23 1YQ6A 3LQXA 4K6BA 1PMHX 3HIFA 1G9BA 5HXVA 1LESA 2EF6A 5FZ0A 4Q4W3 1QXJA 2JIGA 3ZXGA 1DP0A 3I4IA 1LB2A 2FDHA 4JRAA 2DUQA 2E7QA 1YFYA 1HLCA 1SPPA 2ZGPA 4FPYA 1SQ4A 1BDHA 2CHHA 1XRUA 5IATA 3LFMA 3QD6A 2UWBA 1CAUA 2PAKA 2XIUA 2GMPA 1DULA 4FPJA 5JI7A 2A75A 4SBVA 2ERFA 3I2DA 2XJ3A 1D0HA 3BU7A 4ZU4A 1RUJ3 4R9AA 4ASLA 3RI8A 4AQTA 3QOXA 4ASMB 3MPBA 4SLIA 4Y1YA 3BS3A 3BU0A 4NMIA 1RVF3 3T4HB 3IAQA 1E5IA 2JD4A 2VJXA 3PUAA 4LBMA 1JYIA 3ZIWA 1DYOA 4XQ4A 3WG3A 2D3PA 1BXHA 1Y9MA 1XNCA 2G9FA 2D98A 2UYBA 3AM2A 4O7XA 1I3HA 4ZXEA 4OQ9A 2A6WA 4QDSA 1O3QA 3T3YA 4A7YA 5GAGi 4IUGA 1UY1A 3F6WA 5GLVA 5IVVA 3U0ZA 5FPXA 3QYXA 1G6NA 4DUXA 2J1TA 1QP7A 3WV6A 1ZVFA 3ZPXA 3JXSA 3K51A 5KHJA 3GJBA 3WDWA 5CZKA 2IUOA 2FMYA 3D8CA 1CAVB 3MI8A 4IW3A 4FPKA 4UOJA 3ZFGC 4CP0A 1SCSA 2WNOA 1UKGA 4A45A 3I2JA 5CIRA 3B7MA 1MZ5A 3M4FA 1ZPQA 5JPMB 2A5ZA 3KMHA 3AJYA 3DCQA 2ZX2A 1WW6A 1QWRA 2P5BA 4PU8A 5DG1A 2HWC3 4FI9A 2Q5TA 3J9SA 2RMU1 2G9GA 3I49A 2WNVA 3TOJA 4X4FA 4DNYA 3J7MA 3WW4A 4AFAA 4PIZA 4RGKA 4EJRA 3UWPA 1W6OB 4QQHA 4WM8A 2H8RA 3U14A 4K1YA 4CEYC 5F1RA 4Q1PA 3AJZA 1NCRC 1JYXA 2PUAA 1PO23 3I3BA 3K3OA 2ZZJA 4XFAA 3VHOA 4HBNA 4CE8A 2ZHNA 2DYCA 2HWF1 3NSTA 4AVSA 5I0RA 3LEMA 3R4UA 4XFFA 4AWDA 5C33A 4Z58A 3K3NA 3AL5A 5ERLA 4YW2A 2Y26A 4YSFA 3ZOIA 4CCDA 5I91A 3QLQA 3BI3A 1PMJX 2RS52 4X4EA 1CX4A 4IESA 3UJQA 2F17A 3WQ1A 2IZWA 1QP0A 1COV3 1F31A 2O1QA 2WABA 4MGKE 3AP5A 4DEVA 3M2MA 4XAAA 4CCMA 4KGQA 3DM5A 2GC3A 3USUB 2MXDA 2VGDA 1L7QA 4QPGB 2IC1A 4LULA 1MQTC 4HN0A 1HQNA 4PBOA 5FYMA 1OHFA 5A6YA 3AKSA 4OMCA 4BXSV 1EUTA 2B4KA 5KHHA 5L9RA 4A42A 4BZ4A 3I97A 2GNMA 1QNYA 3KVBA 1V6OA 4LBLA 1S2KA 5L9BA 1AX2A 4RD7A 4BH9A 1ZREA 4L97A 2IXCA 3RRDA 4ET7A 3PNAA 4P9WA 2WIUB 3SLIA 2XOMA 3NZLA 1JW6A 4A6SA 3TAYA 2AGSA 4D69A 1UO9A 3AKTA 1U5IA 2LLVA 4DXSA 3PURA 2BBVA 1V00A 4AQ2A 2AEZA 3S5AA 1NYWA 4MXWB 3J8F1 2EXHA 3AMPA 4XJ9A 4JGZC 2D40A 2QUOA 1O5LA 2OX0A 1RXGA 3VD3A 5A7LA 5K7PA 1IPJA 5AVPA 3POSA 2WAAA 2HLEA 1LEMA 2AYHA 1KDMA 3M3QA 4D6RA 1F4AA 1WMXA 4KU7A 5CAZA 4XCAA 2R32A 2XXZA 2WJSA 3ZFFA 3MIDA 2PUEA 1LOCA 2XSDC 5JZGA 3TNQA 3PE5A 3FLRA 4KWUA 1W6OA 4Y4YA 5EZWA 3S8QA 3FFZA 5F3GA 1VAVA 4AG4A 1XE7A 3SH4A 4Y42A 4HANA 1W9TA 3SEPA 4EV0A 5FPZA 2PHTA 1RUJ1 3PUHA 1X8EA 3DYOA 1C57A 5FZLA 2ZGLA 4K20A 3VZOA 1XU1A 2X8KA 4JKKA 1WLWA 5EWSA 4C91A 3R1FA 5FZKA 4Q4X1 3VZJA 2BGCA 4YVSA 2XONA 2RR11 3IT8A 4Q2FA 2RS11 3ZKYA 1AXYA 5GALA 2EWTA 4GWMA 5FWJA 4WZCA 4XFIA 4JQDA 1GLHA 1O7FA 2RG4A 3IMMA 5FYIA 4K3UA 1TME2 3MIGA 5H9PA 2PUGA 1B35C 2YZ4A 4D0QA 3USUA 2FMDA 3O0XA 1RUE2 3T30A 1OH3A 4L92A 4YM2A 2KEIA 4I3GA 5BXXA 5CA6A 2RDNA 3H1MA 3LEGA 3KHCA 2ZTNA 3VBOA 2KM2A 2LYKA 1QJZA 4IEZA 2RS32 5JWPA 3WVJA 1JZ8A 4IV3C 3U78A 3A23A 1ODNA 3LKJA 4IGPA 1JYNA 2YDEA 3VDAA 2KR2A 1V9U2 2ADEA 1MZ6A 2CGOA 4IDZA 2V3CC 4IEQA 2VZQA 4WM8B 4YM3A 1PGW1 4YW7A 2PUBA 2MPFA 4KBBA 5CVRA 5DDJ3 2O4AA 2VMEA 4X4BA 2IXKA 1PGW2 3TEYA 2PHDA 3EUSA 3MLJA 5HCHA 4EROA 4D7SA 4HETA 3VBSA 2EVXA 2KEKA 1TG7A 1FMD3 5KXDA 1PNFA 4HVQA 1RUC1 3NRUA 1IKPA 3FHAA 5AFBA 1XB9A 1FV3A 1S4CA 2YU1A 1QEXA 4NWWA 3VBFC 4L8QA 3MBWA 1AJOA 3O1SA 2IVQA 2J1EA 4KQ7A 2A3XA 2P3IA 1UZYA 1VJ2A 5IVEA 4XACA 5BYNA 3NQHA 5D21A 4B4PA 2DCTA 2JG8C 3KT4A 1NCQC 3VDCA 3JXDL 5C3QA 4R8HA 3USSA 1DGRA 3B9IA 1GP5A 1FATA 1ZZ9A 4GH4C 4I3PA 4LE4A 3O1RA 3B94A 3VBHA 3H0OA 3N9OA 2RS33 3O1UA 1JHNA 1HQLA 1FNZA 1W8HA 2CY6A 2WNUB 1F5JA 1GMMA 3POBA 1RIOA 1S0BA 5C7GA 2C26A 1ND2B 1TQ5A 3WUDA 4L11A 1S7EA 1RZRA 1LECA 3U1XA 1W04A 3KS7A 1IS6A 1ONAA 1Y9GA 1IPSA 2W95A 4V2WA 5JR7B 3VBOB 2PXKA 4JRLA 5DZFA 2PQQA 2BFUL 2OKXA 4YG3A 4MUVA 2Z69A 1H9WA 4QU2A 4UFLA 4JTOA 5FZBA 1W6NA 2XWJB 1L3JA 3AMMA 4R52A 4Y3OA 3NNFA 3WP5A 3ZXLA 3A9XA 2VM9A 4Q4V2 3ZR5A 3T4VA 1R092 1NCQB 5DG2A 3WDXA 3DECA 4Q4V1 1N1YA 3RZMA 3NXHA 2R041 3I59B 1O3RA 1GUIA 3MIFA 5E1RA 2JKBA 4IE7A 5CKNA 2GALA 1F9KA 2YV8A 1CN1A 1EPZA 4X4GA 4Z5HA 4PT6A 3VBFB 1LOBA 2FZ1A 1R64A 2R7EB 4PU4C 1B0NA 4ER7A 1HX6A 2QQMA 3RG0A 3N35A 3VBSB 2W68A 5GZEA 4QKBA 2W0XA 3VZMA 1ZRIA 3ZPOA 2D6PA 5I0UA 1HRI2 2GMMA 2Q0AA 4XUQA 2JDYA 4FN3A 1CZVA 3O1MA 4C0BA 5D8AA 5FUIA 1XYOA 2E53A 1H8VA 2DBIA 2QTWB 5LATA 3S0MA 5IK5A 1HRI1 1XU2A 1O8SA 1AXZA 2SLIA 3GBWA 2Z5WA 3GN5A 4JVAA 1NCRA 1ZBE3 4FFFA 4Q0PA 4RHV1 3NNGA 1A78A 5G05L 1WH6A 1GNYA 1IZ3A 5C6CA 1YIFA 3AYEA 5DMYA 2AXUA 4GMP3 4ZZ5A 4FPEA 4Q8LA 3VBHB 2ID4A 2JCGA 4JHZA 3JBG2 1J1LA 4N53C 3I3MA 1ZUGA 2LNMA 5LB6A 4YPJA 4A41A 2BZDA 1Q43A 2JDZA 4NPRA 2Q30A 4QXBA 3N7JA 4EZHA 1JUIA 1RVF1 2HBTA 5FLJA 4L0PA 5F9TA 2QVSB 2AH2A 2BNOA 5FMOL 1XJAA 2FQPA 1SLCA 4XUNA 1S0DA 5FWEA 4NROA 1OD3A 5APAA 2OPWA 4YVSC 1E5HA 3THTA 4NIGA 1QJY1 2WYSA 1W0NA 3VBUA 1I5ZA 2O14A 5ABJC 1OA4A 1F8VA 3VKNA 4Y22B 2R043 3WY6A 5JAXA 3U4SA 4D94A 1H1IA 1RUG1 1X36A 3ITQA 3ES4A 3UKTA 4UW6A 5A33B 3MYXA 1ZRRA 1W0OA 5LZ6A 1WW5A 2EALA 4NRQA 4R4XA 1JYVA 1NA1B 1EAH3 2WS93 3AX4A 5FMDA 2WQZC 1FPN2 2ZEYA 2M4HA 1YXWA 4K40A 5DPNA 3W5MA 2BERA 4CCNA 2LYPA 1ND3B 2E26A 2TBVA 3O5SA 4AFDA 1TE1B 1KS4A 2ZGMA 4RS5C 1GOHA 2BOIA 1SLAA 2CROA 3GZCA 4IE5A 3NAPC 2C24A 4QDRA 1WMDA 2ZZQA 5I0TA 1LHNA 2VZTA 2VOWA 3QBQA 4W6WA 4DFSA 3CBNA 3GN5B 2WLPA 4LKDA 3T2QA 3GHMA 2NQYA 4R9DA 2VL4A 2QZ3A 2VZOA 3OUIA 2HINA 2E7TA 2R1BA 4FBFA 2XGXA 5JOZA 2VG9A 1BDIA 2P3KA 2JDHA 4BQ2A 2QE3A 3IWZA 3P5BA 5GZFA 3PU3A 3RDIA 5FYTA 1X33A 4Z5DA 4ZPIA 1IS5A 2JWPA 2RDSA 5FYVA 5HXMA 2IVBA 4YZ1A 1N1TA 4RFT0 3O0WA 3Q8AA 4PIXA 2DDUA 3RSJA 5A6QA 1NLQA 2GP3A 4XE9A 1LAJA 2D5HA 4MHUA 2JDNA 5K0UB 3H8UA 3VKOA 2CGPA 2FD8A 1HDKA 4BK5A 4BIOA 1UXDA 5C8CB 3OWQA 2ZHKA 4QX0A 2PLV1 4LO7A 1U5ZA 1I1EA 2ETEA 3KCYA 2HCNA 2YBDA 1X50A 2LYRA 2VOKA 4KU8A 5L9VA 5FZCA 1VMFA 5EJ1B 1SQ8A 2ZEXA 3S30A 3RYPA 1UU5A 2WINB 1VBA2 4D8MA 1XSRA 1NCRB 4M3CE 4KMQA 4IA8A 3T2TA 4CEYB 2B9UA 2AR6A 4IXLA 4JKMA 2OT7A 2Y60A 2CYFA 4YVWB 1OA3A 1CAXB 2PE5A 5F32A 5JR2A 4RYDA 3D6EA 4AFMA 4GMP0 5IK4A 4BDVB 1ULPA 2CSGA 2W08A 3Q9OA 4JCXA 2VPVA 2AUWA 2VW2A 5DUWA 1QJFA 2RHPA 3ZFEA 4Q4Y3 1GNZA 4NHYA 2GN3A 2CDPA 1RUJ2 4OUMA 4PDWC 1S0IA 5A3OA 4DRVA 3AMNA 3ILNA 4WVWA 3HR9A 2HEVF 1OVSA 3KZ4C 4FSJA 2HWE3 4IWRA 2QQIA 5EJ3A 2DVDA 3WNLA 3RZHA 2XJTA 4Q8KA 4CPBA 3ELNA 5F6LB 2A6CA 3GZTB 3T0BA 4CCLA 3R0RA 4AHWA 5EYYA 1QPZA 4Z07A 4WBBA 3SR4A 4MCXA 5FY1A 1XWRA 3BODA 1DFQA 1Z0HA 1GV9A 4YGEA 2BGOA 1SACA 3FJSA 3OPZA 3WDYA 4P08A 1OT5A 2D3RA 1QQP2 4LOTA 1RB8G 3ATGA 4GJZA 1KITA 4ZY9A 1MS8A 5FP9A 5J3UA 3BOPA 5CISA 3OPTA 3HT2A 2C0ZA 1NE6A 4WM7C 2QKDA 3CQOA 4PIYA 3WZ1A 2IU7A 1AJKA 1ND3A 1RHI1 1IS4A 3GF6A 4MV2A 1Q56A 5FY4A 4ATFA 1AR62 3AZZA 4RA0A 3V56A 1SCRA 2RR13 5IAVA 1JI6A 2J1UA 3UV9A 3NJXA 2GRLA 3AC0A 4Q4Y2 2JIJA 3SHRA 2MEZA 4NDWA 3CF6E 4FAHA 4BQXA 3CZJA 4U36A 3VHNA 3D1NI 3EHKA 5CKMA 3CJIA 5FPVA 3GUUA 3LDKA 3O9XA 1IS3A 2WLQA 1C5HA 4LUMA 3VD5A 3O1VA 4FQZA 3WF1A 1J83A 3OYWA 1W2TA 1HJFA 3LE0A 5F5IA 2DUOA 2JICA 2AC1A 2H0BA 4EZIA 4PBPA 4Q0UA 1VB2A 1D2SA 4Q29A 4YZ5A 4RQPA 5LEJA 3UJOA 3N7LA 3V0BB 4LHSA 3ZSEA 4YM1A 2VO5A 5L7OC 4WVVA 1H30A 5IWFA 5L19A 3KQ4B 4LBJA 3KLSA 3BYWA 1C3HA 2D6MA 4BLJA 3LWCA 3NJZA 1AR63 4K8RB 4YG4A 5J1XA 5A7NA 3N7KA 4AGVA 4X6RB 5T5JA 2VCBA 3POIA 2ZX0A 3KL4A 4PQ9A 2DCJA 1MPXA 3C8XA 5A80A 3WF3A 1W3VA 4OMDA 2YGLA 2W91A 5FJHA 1QJU3 2VCAA 2VUAA 2OPKA 2VTFA 1QXRA 1O91A 3ZFFB 1R1ZA 3W5NA 1JOJA 3POEA 4QQ2A 5JZGB 3DKWA 4RGAA 3I2KA 2CSFA 3WDVA 2RM21 1MEC1 4CUCA 1OMIA 4B1MA 2HWC1 4YVWA 1E57A 4EN8B 4XJ8A 5EFUA 5FLIA 5HCBA 4BQ3A 2PN5A 4IEOA 1UWWA 2VR4A 2VTXJ 1JODA 2XG3A 3HQUA 3KM5A 5JIUA 2VY0A 5K98B 5LA1A 4PJYA 4XYXA 2JXAA 3MDPA 1XNAA 1FAYA 2HWF2 4MH0E 2WN2A 5DAVA 1AR83 3BCWA 1I9RA 4O9GA 3RNSA 3S7IA 1RUD1 4DXZA 2A73B 2IVIB 3BIEA 1IQAA 1WA6X 4QGLA 1N1SA 3EB7A 2PXFA 1TMF2 4CZSA 4WVMB 4BIFA 5D2AA 2R30A 2Z2SB 3UGGA 1ZA4A 3Q8BA 4W65A 1LGCA 4RQPC 4B29A 2PLV3 3WX5A 3BD1A 1W06A 1LHWA 3O1OA 1E5RA 1CWPA 4HXCA 5FREA 1OOPC 3PDQA 2R6QA 4HSLA 2BNNA 1UXCA 4N9HA 3THPA 5JI9A 3BPSA 2V4VA 2R0FA 2ZPXA 2D97A 1IGOA 3ZYIB 2XLGA 4XBNA 4QXCA 1PHMA 1UOBA 5FXZA 4E8CA 2WL1A 4UYBA 3WCRA 1W8UA 3LPFA 4URAA 3PXPA 1YJLA 2R16A 2EIEA 3R09A 5AC91 3C7OA 3IKWA 4COWA 1R69A 3VUOA 1SBEA 2OR1L 1XXNA 2QCSB 3OQNA 2DVBA 4XEZA 5BUVA 1W8TA 5BNNA 4Y4RA 1GBGA 2ZGQA 5ANQA 1RUC3 1RL3A 3RPQA 1H6XA 2FCVA 2PHFA 1MR5A 2AENA 2ZMKA 3AZYA 3FX3A 3ZX7A 3AXEA 2W92A 2W1UA 4YGBA 1GQPA 1DQ0A 3WHTA 3CZUA 1HRV2 2ICTA 2KXLA 4N9IA 1BMV1 1RITA 3FE5A 4NIHA 4J1XA 1QMJA 2KD7A 4QGMA 1CQTA 2D6KA 4F8DA 3BKZA 1YHFA 2ZEZA 4GB32 4DXRA 4COUA 2VUJA 4EKGA 1P8JA 3OP9A 2VVEA 1K45A 3QWGA 5E16A 3ZYBA 2O8QA 1XYPA 4KWLA 4AI8A 2MEV1 3SXWA 2WNUA 4AEDC 1SEFA 3ZYPA 1BEV1 2GN7A 1J3RA 4FPOB 2HWB1 5FV3A 3GGLA 5JDBA 1M4WA 1MS1A 4FPGA 4E4DX 3IDEA 5F8PA 4XURA 1XC6A 4Y26A 5LRRA 1HRI3 2VQ0A 1VB4A 3ZHMA 2PQSA 3OJBA 4AQ6A 3U4XA 2OIIA 5FZ3A 2MNGA 5A3UA 5FK8A 2Y8KA 2JB4A 5FZ1A 3LOBA 5T5LA 3LGRA 3RZJA 5FYZA 4HSJA 3I2HA 1OUXA 1KS5A 1WZXA 5C3RA 1V9U1 1WCDJ 3B02A 4YFWA 3ZXEA 4YG0A 2VAUA 1M06G 1RJ7A 3TNPB 1CPNA 4OI1A 3ZLIA 3OBRA 1FI2A 2O8OA 3OGJA 2LLWA 1GANA 4HRAA 1X8MA 4D3WA 5FY9A 5LBEA 3Q8CA 1YQ5A 4C0HA 4QHBA 1H4HA 4IEXA 1VBE3 1O6UA 3GALA 3BVCA 4LBNA 1COV1 4W6XA 5T5PA 4GAZA 4MO3M 3WQ0A 4C1WA 1HB1A 4OI0A 3KCCA 4Z5CA 3M8LA 4XF3A 5FZ6A 2NN8A 2W52A 3N9QA 5D8AB 5A3NA 2AREA 4OFGA 1G9FA 2RR12 4XC9A 1AYN2 3THDA 5C8CC 2XMLA 2VMGA 2OXBA 5C4WA 4AEJA 4I6UA 2PXQA 4B3NA 1OCTC 4ER3A 1IG3A 1PZ9A 2DU0A 2BYVE 1ODMA 1W3XA 2GC2A 1SLLA 3PVNA 2XWBB 4OVEA 4P9YA 5JXHA 1Q5OA 4MADA 2RM23 5I0SA 1VBB2 4XJUA 5ACA3 2XL7A 1QOSA 3KF3A 2P3YA 2WA4A 2XDVA 1LGBA 1PVXA 2XR4A 1UOGA 5FZ7A 2B5AA 4BQ4A 5ACA1 1VBC1 4DE9A 2RMU3 2F6BA 2GRMA 4TLFA 2BFUS 2BVVA 1W9WA 1US2A 5M0TA 5F5CA 2I74A 2YPDA 3BIWE 1AHSA 3THCA 1VBA3 2CL2A 1QZXA 4H14A 5BNNB 1JHJA 1GZWB 3SCGA 4MGIE 2XHNA 3GBFA 1QJY2 3E1F1 4AVCA 3A21A 3Q8EA 3LIGA 3VBUB 3JD71 2W1QA 5FZOA 1A8MA 1V6IA 2UWAA 3DPRB 1ZM1A 5FXXA 4CXXA 1G7YA 2HYXA 4RS5B 4CUBA 1GU3A 4FP3A 4GD4A 5LASA 2Q8OA 4AVVA 3ZYRA 1ND3C 1WLCA 1OC1A 1H2MA 3WP3A 2OW4A 1C8M2 1DG6A 1DCSA 2PAEA 2NM1A 4DS0A 1SFPA 2JE9A 3ZYJB 1ULOA 4LORA 1NA1A 2RM22 4LPLA 1UYYA 1ACCA 1CIWA 1NA1C 1WD3A 1S0CA 3MW4A 4NRPA 4XJAA 4E4ZA 4E4HA 1KJRA 1QQP1 1H4GA 4LTAA 1DBNA 1RUD2 4HKLA 3RI9A 4BJ0A 2V73A 2P2KA 4CEWC 1ULGA 5FZFA 3OD4A 2HFZA 4FPHA 2PXTA 1OPOA 2VW1A 2WWJA 4GXLA 1AUYA 4XDPA 4YZ4A 1SZBA 4MYEA 4Z8BA 1JU3A 3LAGA 1RUH3 1UYZA 1G9DA 2C4XA 1Y9QA 2P37A 4CP2A 2DFCA 5JMCA 1Y7BA 4PLNA 1OF4A 5GZCA 4LKSA 3CDZB 2Y6GA 4AI2A 3AZVA 4DINB 1RGSA 1YFWA 4MGZE 4QX8A 2ZHLA 3K4AA 1OA2A 1AYM1 1YRZA 3BTZA 3KT7A 1RUOA 3DYMA 2R063 3TRSB 1W9FA 1J1TA 2E32A 1NERA 5EJZB 2D93A 5A3WA 3I2OA 3H7JA 4Q4X3 3KZ3A 2PUDA 3AYDA 1AR92 4E2SA 1OQDA 3E6CC 4N53B 3H3UA 4BISA 1US3A 4RN5A 3VBHC 4LIUA 4IV1A 5JIAA 2YHJA 4IV1C 2J1RA 1J3PA 4Y1ZA 1DGWX 4HOOA 5JOXA 1UYXA 1X7NA 4QX2A 5I8YA 2J1SA 5DUVA 4AVTA 4UFKA 2VD7A 4PU7A 3CROL 2CWSA 3MW2A 5K0UA 1GZWA 4GQ7A 1AZDA 3I7DA 1QU0A 1KFXL 3LIHA 2VEOA 2VMCA 2WZEA 2HWE1 2WUSR 2DVFA 5L36A 3I2FA 2RJLA 3GZEA 1AYM3 2WFF1 3C7GA 3LEKA 1HQ1A 5IVYA 4XHXA 2GZWA 3AKQA 2IXJA 1CQ9A 2OVUA 4FFGA 4OUEA 4XCBA 3VD4A 2IVJA 2XVGA 4QB1A 1URXA 3ACHA 3DN7A 1A6CA 2BUKA 5L73A 4WM7A 2CAVA 4LK6A 3IVPA 4OULA 5CADA 2HYKA 2PTMA 5KHKA 2BBAA 2HEWF 4CDQC 1RC6A 3B00A 1JZ2A 3RVHA 2W2IA 3CECA 3UETA 4ISQA 4UFHA 3GCXA 4HK8A 5K4LA 1HXS3 4LT5A 3TELA 4P14A 3PMSA 4Q4X2 3VZKA 3JUUA 2NYYA 3M3CA 4JKLA 1CZTA 4Y5Z0 5FYCA 1PGSA 3ZM8A 1POV3 4HG6B 5F5QA 3PUSA 3E5XA 1JBCA 4W6YA 3Q8FA 4WV8A 4KNCA 4FOYA 3ZIXA 1GOGA 4TXWA 1RUE1 1ZYBA 1MS5A 2Y6HA 1ADRA 4IL7A 3V0AB 3C3VA 1PX4A 2ZA9A 3FC0A 3OGSA 2YY1A 3S6PA 3QFIA 2KEJA 3J4UH 3E5UA 4I30A 2VQAA 2IXHA 3AMHA 1NE4A 2DURA 5FYYA 4PHZA 3ZXJA 2HWF3 3BUCA 1DZRA 1QH6A 1NQJA 4JV4A 2JQEA 2FZ2A 4NR1A 1W28A 1KFUL 5DRTA 1LRHA 2WO2A 2WDBA 1VRH1 1VBD2 1VBC3 1FT9A 4GH4A 3QOWA 3VBFA 4CVUA 4KI5M 5F39A 1OI6A 1EAH2 1TEIA 2WS92 4CCCA 5C3SA 3ROUA 5GAHi 3QF3A 4BK4A 1WLTA 3DF0A 4BPZA 3ZXKA 5F7UA 2R49A 4HONA 4AGGA 3E5QA 1ENRA 1Q8OA 2F4LA 1DU3D 2VTXA 3WR0A 2JENA 4XUTA 2ZACA 3IIIA 3LPGA 3POWA 4CCKA 4E4SA 2EICA 2PFWA 2BPA2 2OS2A 3FLTA 3LISA 4JX0A 3SH5A 1RUI1 5C71A 1HJGA 1VBB1 1PNRA 1NY71 2DCYA 4GALA 2GMEA 3SITA 2BW8A 2VZUA 3CJIB 2VUCA 5LBCA 2W46A 3NJVA 4ONUA 2VOVA 4Q5OA 3AKRA 4EQVA 1N47A 2LYJA 1W2OA 3HN3A 1MEC3 2QQWA 3OYWB 3OGRA 4QPIC 3O1TA 5ACA2 3HNMA 1ZBA1 2ZMNA 3A0NA 4EWEA 4HN1A 4Y20B 3I3EA 3VDDA 3V0BA 1CPMA 4XF1A 1PZ8A 4IVZA 1NAEA 3JZVA 2JDMA 4IEYA 2XJRA 4IV3A 1MQTA 2QDRA 4NRMA 1VMJA 4FQ4A 5DZEA 2R073 3ZR6A 4AW7A 3WF0A 2X5IC 3AYCA 5SV8A 3VWSA 1VRBA 3A7QA 4D6QA 1QJX1 4E8DA 1JS9A 3T1LA 1GSLA 1LKNA 2AW6A 2B42B 1S0EA 4Y22A 4PLMA 4CU7A 4BM8A 4W8JA 5DSXA 3O14A 3DL3A 4JQRA 4OB4A 5DAQA 1HN0A 5KC6A 1QH7A 3HD8B 4INDA 4DMIA 1X2LA 1VBE1 5JUVA 1GOFA 2X53S 1F35A 3P6BA 1RUF2 4HKWA 4LBQD 3KSCA 4LOSA 3AP4A 3W58A 3WOGA 1JZ6A 1YUDA 3HAGA 1U5YA 4MGYE 1LOGA 1UW8A 3BDNA 1LGNA 3GDBA 5BNOC 2ZABA 5IHRA 4TZDA 1R63A 1CGPA 5FKBA 1O5UA 1NG0A 1N3QA 1UIJA 1V70A 1WW4A 4A2UA 2ZAHA 4Z1VA 3IBMA 3E6BA 4LQRA 4QHZA 4FBIA 2LW8A 4JGYC 3H9AA 4LXLA 4C8DA 1AR72 1GZ9A 1UOJA 2JEMA 2YMZA 4GKXA 5T52A 2MHFA 2OQ6A 3AFGA 4P5YA 4EE2A 3FN9A 1S0FA 1SDDB 2VNVA 1Y3TA 2DWRA 2W94A 4HL0A 2HJIA 1QXPA 3WW2A 3P1IA 5IFPA 1YO8A 1OPMA 3ETQA 3RS6A 4NHXA 2JE7A 1WETA 2PA7A 4X8NA 3V0AA 2CTVA 3JXCL 3AP7A 1NUKA 2R072 2XBO3 3CIHA 3P3NA 1I6XA 4NAMA 5F5AA 1PRUA 3R4SA 1BKZA 4BQ1A 4XUOA 1BLZA 1ENXA 2JG9B 4Q4W1 4QDQA 5LBFA 5GKAC 3RMYA 4BQ5A 3LSEA 3BB6A 1RUF3 5JVVA 3HWJA 4Q27A 2WBKA 5AC93 4Y20A 3ES1A 3DKQA 5EYXA 3ME5A 4X8PA 5GZDA 3INAA 5A6ZA 3F2ZA 4MGTA 2BP6A 3SEEA 4B8EA 1MQTB 5DRYA 1W6MA 4QPGC 4UFMA 2W39A 4ZS2A 2JG9C 2XJSA 5C8CA 1UIKA 3ILFA 5A7SA 5I8SA 2X29A 4CXWA 2AZ5A 2VBBA 4MGQA 3NROA 1PZ7A 1MS0A 4A3XA 3ACFA 4ER6A 5FKCA 3APBA 3CNAA 3NNLA 2GNTA 3TN91 5C3PA 4G4FA 4DO0A 3JB4C 4NIAA 5F3IA 4XPVA 1KD7A 3B01A 4RSUA 4N8MA 1H2KA 4B7KA 4H55A 4AYUA 3U10A 1UMZA 4IE0A 2DVAA 2WZPP 4AEMA 4LA3A 4M4RA 4UXAA 4FTBA 4Y5TA 3BGAA 4JGYA 3B93A 1FOD1 4LLOA 5BNOB 3ZFEB 4COYA 2EXIA 2XVLA 4HFSA 4QQPA 5FOJB 3F52A 3PMEA 5AVAA 1PO11 2HWD1 1FOD2 2YPJA 3LA3A 3EQEA 5CG9A 1GKBA 3VDDB 3P3PA 1D4VB 5JPNB 2XXPA 3DV8A 3POGA 2LYSA 1ZNPA 1IPKA 1DQ5A 1ZRCA 1OQ1A 1ENQA 3TN93 1VLNA 3PTRB 5FPAA 1JH9A 2LRPA 4RR3C 5LEKA 5IT6A 1UX6A 2I07B 4K7JA 5IVJA 4XETA 2C6SA 2K0GA 4XBQA 3SKJE 1PERL 3R05A 1ZVVA 2ZBJA 3WW3A 1VR3A 1S2BA 2J22A 3M3OA 4KH9A 4BMEA 5I0DA 2JG9A 2V4AA 1AYN3 2A70A 3EJKA 3H50A 1RUD3 3KD4A 3O7OA 1ZAYA 2B46X 2VXRA 2UWCA 3EBRA 3M1HA 2Z42A 3CLPA 3HNBM 2ICPA 4XQDA 4COZA 4YZ2A 5B4NA 2WR9A 2WS91 5KXEA 4EYUA 1F15A 1UZZA 5B4XA 1MVQA 4ARYA 1NEQA 4HVOA 4DZGA 1VBD1 4JQTA 3IDAA 4AVAA 3PU8A 2WNEA 2LYLA 3D82A 4CDQA 3M3IA 3W59A 3IPVA 3KJXA 1UF2C 1W39A 1UYPA 3CJIC 4O9EA 2WKKA 2K2SA 1XE0A 2RS13 3DEMA 5E8AA 4BXFA 5EPAA 1U2ZA 1QHDA 2GU9A 1QJU1 2P6HA 1NLSA 3GZAA 1W9YA 4IE4A 4EN9B 2QFEA 4IE6A 4NN0A 1DYKA 3DXUA 4XW3A 2WFF2 2TEPA 5GJ6A 2JD9A 4EWDA 1RXFA 2B8MA 1XNTA 2D5FA 1YJKA 1POQA 1STMA 2R1DA 3CJXA 4NUBA 5C8WA 2E33A 3FMGA 1V6LA 2VQUA 4CEWA 5DAWA 2Q8CA 1ZBA2 5FP4A 4FPLA 1OBNA 1RHI3 5DAPA 3ASIA 1ZS4A 4BHPA 1PM4A 5BNOA 1H6YA 2WNVC 2P6CA 3OBAA 1OLME 3WQ7A 1IKQA 4XFBA 4I8TA 3RZGA 2VOTA 2ARXA 1UKRA 4QQOA 5JMOA 4S2GA 4DY3A 1W03A 3I3QA 1GWLA 3OOXA 4YG7B 3FBYA 3FLPA 2P4EA 5G04L 1KJLA 2ORXA 1UQXA 2XKOA 3FZ3A 1W6MB 3JCIA 4EN7B 3URFA 5A6XA 3OSDA 2ADDA 2IVGA 2MQKA 5FYBA 3BTYA 3PIJA 1RTVA 1RIRA 2I45A 4TLGA 1XQNA 5CB7A 5DT2A 4XXAA 3N4MA 1VAMA 3WNXA 1RUH2 4XJZA 5DQ0A 1NQDA 3RZLA 4EN0A 1RUC2 1DHKB 3VL9A 4EWAA 1UZWA 5FZOB 4R9CA 3KV9A 4KWKA 3LA7A 2XHKA 2XH6A 2RDRA 1Z7S2 2O49A 2QQOA 4PDWA 2GZUA 1WUVA 1W8FA 2YGMA 1RMU3 3OQOA 2IFWA 3CKHA 1G86A 1JOBA 2DFBA 2J7UA 2VC9A 1OFNA 3LB9A 2LS6A 4Y1UA 4GMP1 2VZVA 3LD8A 3SKVA 2W87A 3GZUC 5FZMA 4CDQB 1JYTA 3UGHA 2A1XA 4AHYA 1C8NA 3TEPA 4QQLA 1W2UA 3VLBB 1XYNA 4CDXC 2AXVA 1ZX5A 2E31A 2XJQA 5JZGC 4I01A 1IQDC 2WT0A 4CCEA 1GICA 2YYOA 2WSUA 3OY8A 4OQ8A 4LBKA 1UTXA 2J7WA 1AU7A 3WNOA 3NL1A 1Q3EA 4YG1A 4YG6A 4NOTA 1LULA 1LOEA 3U11A 2KZ8A 5FMOS 2YROA 5DXDA 1WBLA 2HH9A 1H0BA 4JGZA 1TME1 4N7IA 3QQ6A 2VUDA 3FYAA 3NKGA 3H5TA 4OYUA 3HZIB 3ZMNA 3AZWA 5KXCA 5FYSA 1BJQA 2WSVA 3PVBB 3VDDC 3CL1A 4BU2A 1R082 4EN6B 3OCPA 2A3WA 2ARAA 2PXBA 2RS31 4CA9A 4FTEA 2P1BA 4GKYA 5C9AC 5FO7B 3NDBB 5LK7B 3G5GA 4Q4Y1 1ZZ7A 4N53A 1E5SA 4Y24A 5FUNA 1H8TB 3NV1A 4E2QA 4IV1B 1YCIA 1UPIA 3H8OA 3H3ZA 4QB6A 3CHXA 2BNMA 5A3TA 1RMU2 2Y34A 1R1A3 3H42B 1REEA 4FCAA 3JU9A 4URTA 3N7MA 3PJQA 4N43C 3SISA 5E89A 1YQ8A 5FYUA 3OEBA 5CBLA 4GHJA 4YW6A 4XZUG 4F7ZA 1JYCA 2YBSA 3K77A 1OLRA 4DEQA 1NZIA 2VU9A 4PI2A 4W50A 5CEHA 1J3QA 2VNOA 1FMD2 2YBPA 3B7HA 4BQWA 4BLIA 2D5VA 1MS9A 3I54A 3MW3A 2CV6A 4IEUA 4HPKA 4XILA 5A7PA 3WNKA 1EYBA 3NWKA 5FZDA 1ASJ2 4P9IA 1S2EA 4WM7B 2W9XA 4CEWB 2TNFA 1VRH3 1WWYA 4M0NA 4P5HA 1RZRD 1BHGA 1WW7A 1PX3A 1PO13 1SLTA 2HWD3 2W5FA 3HT1A 3ZSMA 4FTSA 1NY72 1ULFA 2QQJA 3PVOA 4WVZA 4Y5SA 2RMU2 3ZO0B 3ZDSA 5JXJA 4GWNA 1ZA7A 3HQXA 1R1A1 1YI9A 3QH7A 5FK7A 3WHUA 3NVCA 3OY8B 1UU4A 4ITCA 1DIWA 1KGYA 4KBZA 5FP8A 3ZN4A 5I8TA 1IG0A 4LKFA 3ILRA 1D4M1 4ES9A 2G1MA 1WCKA 2ZKNA 1DGRN 4C1XA 2HEYF 3EXUA 1K42A 1NT0A 3DPRC 3MO4A 1H2LA 5FZGA 4DUWA 2LALA 1JTZX 1LODA 2AEYA 1SFYA 1CVNA 4XF4A 4FPFA 4P9XA 5JSRA 5BNNC 3A9YA 4PQQA 2Q8EA 4NVPA 4J6GA 2X5IA 1J84A 4PDWB 1S0GA 1SFNA 4NPMA 1JUHA 4I09A 4E2GA 4DXTA 2XQXA 4AI1A 4HT1T 3NJYA 3S7EA 3AVSA 1VRH2 1W6PA 3R4DB 3VB9A 1UN1A 3MIHA 4LHKA 1FPN1 5E6HA 1DGLA 4YVWC 1V6NA 5GM0A 2PXPA 5FP7A 5A32A 2J1AA 5GLWA 1RUF1 2GH8A 3EO6A 3NNMA 3ME2A 5CFCB 4Q0VA 1NXD1 1DF0A 3FBMA 3HMYA 2PELA 1WH8A 1JN2P 1YI7A 3H7YA 3ZN6A 2ZGKA 2EBYA 1RUG3 3TRBA 2VZ1A 1GWMA 2G4IA 4AAXA 4FOWA 4QM8A 1O4ZA 5SV5A 1HRV1 2YBKA 3ACLA 3ON7A 5D1IA 5C4WB 1GT0C 3RYRA 1LOFA 1V6JA 3SH3A 5HCAA 5JXGA 1W8NA 5JCTA 1NOVA 5HPOA 4L2NA 1NW3A 5HCFA 5F37A 1HV0A 2XUMA 4CU9A 1CD3G 3KXAA 3IAPA 3A4UA 1AR82 2PHLA 3MIEA 3OD0A 4NO4A 3VKFC 3GZDA 3JB8A 1G9AA 4GB33 2R63A 1QQP3 4JDOA 4AZZA 1WBFA 5LA9A 1WKYA 2WQ4A 3J7LA 5FZ4A 1C1LA 4GZ9A 2VCCA 1U0AA 1H8TA 1ZBA3 4XVHA 5T5OA 4E9KA 4QKDA 5JUWA 1QB2A 3WXPA 4FXKB 4DQAA 1Z78A 3TFLA 1ZZBA 3WF2A 4MG2A 1PK6B 4J1WA 3M7AA 2QNKA 3MF6A 4UW4A 5FZIA 2E63A 1ZRDA 3RGBA 2OFYA 3NO8A 3PUIA 1EUUA 3FMYA 2DTWA 3UGFA 3PVEA 3BOWA 1CR7A 4PCRA 1LQCA 3VKMA 3A22A 5J09A 3PIGA 3DXTA 4B7EA 4AOCA 2VBDA 3DPRA 4UF0B 4YYOA 3HOBA 4RS5A 1QP4A 3HVDA 3HN1A 2PXDA 1ULCA 4U2AA 2WN3A 1W2AX 4O8BA 2BJCA 1OLQA 1SBFA 5T3NA 3ZFGA 4KG0A 3OUJA 4AEDB 4HPKB 4LEJA 5CFDC 2ZXQA 2DTYA 4CDWB 2YFZA 4UT5A 2OYZA 2LYQA 3OQMA 1XSQA 5FZEA 3UT0A 4TTGA 2A6VA 4MOAA 5CFCA 4Q4V3 4OI2A 1OVPA 1VIWB 1R093 4MSVA 2IUWA 3L2HA 1WMEA 2VW0A 4OUSA 3VD7A 3IM0A 3ZSKA 1OH4A 4LO5B 5JOYA 2ZGRA 1CJDA 3AFKA 1JU4A 2EA7A 2ZGTA 2ET7A 4H7MA 2WQ8A 4MX3A 5IJRA 1LOFC 5C5UA 5BNQA 3C7FA 5GLZA 4DY5A 2G19A 3LF7A 4Q1RA 5IYYA 2A71A 2QQNA 4C90A 2RS51 1QJU2 4AR2A 1XNKA 2CWMA 3DUIA 1UZVA 4YBAA 1BK0A 5T55A 2IV1A 3KGZA 2DBNA 2CDOA 1PO21 3O0VA 2J7MA 4UWDA 3OB8A 5FZ9A 1A34A 3OMTA 4K21A 4UFJA 4CRQA 4N43B 3QACA 2Z79A 1K12A 3IMNA 3GXUA 1PO22 2HSGA 4MHRA 5A3PA 3O1PA 1OXCA 1VBC2 1HXS1 5FZ8A 1GR3A 1PK6A 3AP6A 1UMHA 2H0VA 3ZKCA 4CDUB 1H8TC 2EAAA 5H9QA 5A32B 2FDFA 4BE3A 1TNRA 2FBEA 2Q1FA 1PMIA 2Q4SA 4XFCA 4QWNA 5HI0A 4XF9A 1CJPA 2WZ8A 4YRDA 1WIZA 1Z7S3 3KWVA 3HNYM 5A3MA 5C3OA 4HKOA 1VMHA 3DYPA 5C9AA 1K3IA 3F95A 5FY7A 1YWKA 3NW4A 4META 3IN9A 1D0GA 5EXOA 3TN92 2JE8A 2RVAA 2UY8A 4P00B 3BPZA 4GA9A 1FMD1 4YNIA 1JYWA 4CDWA 3AL6A 4ZZ8A 4PF1A 3VBSC 4HVRA 4XFHA 5J36A 1T6BX 4QKNA 1C8M1 1ZZCA 2N7GA 1VBE2 1S55A 2YB7A 1FXZA 1UL9A 1BMV2 2WYFA 4CDXB 2P3JA 1QY4A 5HBAA 1AXKA 3AB0A 4OZXA 3WW1A 3UKVA 4GB31 1WMFA 4RGGA 1UD1A 4LA2A 3MICA 5FY0A 2OUJA 1IHMA 4AE2A 2D6NA 3T2PA 2Q1ZB 1MEC2 2XLAA 4P9JA 3L2YA 4AK3A 4QXHA 1X9TA 1XE8A 1ZZ8A 4YGCA 2Q1MA 4XHBA 1WA4A 2H6BA 3RMXA 1QF3A 1BQPA 3WP4A 3ZFFC 3B5LB 1SG3A 1DGWA 2PHWA 2BVBA 3VBOC 4NHKA 2RS12 1CZSA 1YNAA 2LROA 4EZ4A 4ZONA 3VKLA 1UZ0A 3WG1A 4LR4A 2VQTA 2I2SA 3I3DA 1UY4A 5LY2A 2QZ2A 1D2QA 4XTPA 3GCWA 4QHOA 5J98B 3MZHA 1NLRA 4XBLA 3WLUA 1C5IA 3ZXAC 5L7OB 4XMIA 1AL21 2WT1A 4MGSA 3VBRB 1HQWA 4AEDA 4Q4W2 3MIBA 4YM0A 2XKPA 1YC61 3SCHA 4GH4B 3LSDA 3AP9A 3T08A 2HWC2 2D44A 3B3QE 3SCFA 1ULDA 2PHUA 2D43A 2JG8B 3FYMA 3K2OA 4FO9A 2PIJA 1VALA 2GC0A 2A7AA 1SHWB 1BZWA 4ER5A 2DCKA 4A3ZA 5EV7A 2PXJA 5BV6A 5FQ0A 4ARXA 5J37A 5DUUA 1QJEA 3CEWA 2GDFA 4IQPA 3CO2A 2GH2A 1C8M3 4H2AA 5TSWA 3S57A 3IZOA 3MUY1 3POJA 4E27A 3ACIA 4LITA 4GWIA 1O4XA 1JZ5A 1YFUA 1VAKA 2QQUA 2L8NA 1PRAA 1VP6A 5IAXA 4AAPA 4XDQA 4XUPA 3ZKUA 4JDNA 4HLTA 3RJ2X 3J8F3 3ABZA 2XJVA 1PVC3 4XDOA 3QCWA 3T1MA 1H2NA 1SLBA 3ZN5A 5C5TA 1CAWB 1UPSA 4LMFA 1VBA1 3UL2A 4ORFA 3CLCA 3HBKA 5IUQA 1ASJ1 1SDWA 4N43A 1AX1A 3MEJA 1A3KA 2R071 4WM8C 2FHRA 4A7KA 4EKIA 2VZSA 1DLCA 3MEPA 1DDLA 2ORZA 1KDKA 5A1FA 3D3AA 2XJPA 5LA2A 1JXNA 4IV3B 1LHOA 1MVEA 4YW4A 2XI8A 1U12A 1WD4A 5CKQA 5F2SA 2J42A 2VBPA 4I6TA 4MLOA 4KWJA 3OTFA 4A4AA 1AR93 3MLFA 2XXAA 4KL1A 3TYJA 1PIV1 2FJRA 1B35B 3WT3A 1XBFA 4JDMA 4QXKA 4RL7A 4Y1VA 4EQZA 2BOJA 2DVGA 3B9CA 3ECQA 5IVCA 2QBXA 4OHWA 3NV4A 2JVLA 1PVC1 1O4YA 2HWB2 4RR3B 3MHZA 3MUZ1 4XIKA 2ZX3A 1AL0G 1S1AA 4CTEA 1W99A 4PLOA 5DZGA 4BB3A 4NIDA 2AWIA 1O4TA 2XL9A 4FPCA 4Q0QA 2CAUA 1Q8SA 2CNAA 2C9KA 1K5MB 4OZOA 4ZHNA 4QPIA 2WAOA 3AK0A 3ZFEC 1KEXA 5FIXA 3RZZA 1K5JA 2Y64A 1RPEL 1COV2 1OKOA 3I2GA 4CPBD 4LHNA 3K4DA 1W90A 3I2IA 4JCYA 4FXGB 2PXUA 1ST8A 5EP9A 5J7MA 4X4HA 1XNBA 2FCTA 4R9BA 4D7YA 1SBDA 2UYAA 2J1VA 2P34A 1LJ7A 4L99A 4QU1A 1RZSA 1C4RA 1W6QA 3LDBA 1TMF3 2LTNA 4JGZB 1E3OC 2BWAA 3QH6A 2B5HA 2ZGOA 4LO8A 1UY2A 3JQWA 3MFCA 1C28A 4JC1A 4NHMA 2PLV2 2V5YA 5GLTA 2D6LX 1REFA 2WUHA 1FYUA 5FMBA 4LHLA 1L7RA 2JJ6A 2O38A 3IDCB 4FAGA 4UW5A 3MPPG 1CJGA 1HW5A 3VHPA 4ER0A 1L7LA 2NMNA 5K0UC 4K9SA 4DPNA 4S2DA 3WD5A 4GJYA 2MEV3 4Q26A 3B69A 1Y7YA 1POV1 2A6YA 5AFEA 3GHNA 1G8WA 1OFSA 1UMIA 2RJKA 1S0JA 2W1WA 1JMUB 3ACGA 3NNJA 2WO7A 1OLMA 3MV11 5FPBA 2VXJA 4NE9A 1OD5A 3G6JB 1JZ4A 2VULA 3RWNA 4B1LA 4CP1A 1GQHA 3POYA 1T6GC 3GBGA 2ZX1A 3RJRA 3ZVXA 4UI9L 4GIQA 4BCUA 3BTXA 3PJYA 1RJ8A 5DN2A 1VPHA 2OZJA 4NJ4A 4P9GA 5FQ0B 4D6SA 1PGL2 2FCUA 4CXYA 3OPWA 4NHLA 3WDUA 3RZKA 1ZBE2 3D4KA 3MLLA 3H1WA 1H1AA 5LY1A 4AHZA 1LTEA 3VZLA 2PYTA 2DUPA 1HRV3 2C5DA 5GZGA 2WWUA 3NAPB 4N7UA 1H9PA 2ZKLA 3U07A 3VDBA 4MXWA 1TVGA 1Q8VA 2WFF3 1A8DA 2CU5A 3TEXA 1K5MA 2WC2A 3H8XA 4JGYB 2XPJA 2ET1A 2LM3A 5IVBA 1D4M3 2ZMLA 1LU2A 1OKQA 3MFAA 3NKTA 1AVBA 5FXVA 5KC5A 2B45X 4X4CA 4D7TA 1BBT2 2CGNA 3GM8A 2PMWB 4I6RA 3W9AA 3G7DA 5FZHA 4W4ZA 1K5MC 3EYPA 4AFCA 4LIVA 4MVTA 1MS3A 3GNEA 2MEV2 2PHRA 1D7PM 5DTRA 3D5OA 3LEIA 2EF8A 1QNWA 3WG2A 2ATFA 2BEOA 3AXDA 5CNAA 5B2GB 5FYHA 2ARBA 1AYM2 1QOTA 3OEAA 2IWGB 1NKGA 4BQYA 2WZR2 5ABJB 1EFAA 1UY0A 1UCXA 1OUSA 1DQ1A 1HIXA 1OQEA 5FO8B 1UAIA 1N3PA 4YVSB 3T0DA 2RDQA 3PTYA 2RV9A 2JDPA 3AKPA 3FUOA 3TWIA 3VGIA 3WNNA 5A1AA 2X5IB 5FOBB 4NPLA 3PUQA 1MZFA 2RS53 3KB5A 4RHV2 1OSLA 1AL22 4QAWA 1NZCA 4XOGA 4MXVA 1QQAA 1Z7S1 1UOFA 2A6XA 2VMFA 4DB5A 5FRAA 1LCLA 2YC4A 2ZCWA 4XXPA 2PUCA 5CU1A 4AVBA 1QIQA 4QPIB 1DZTA 1HXS2 1IC8A 3JBG1 2YXSA 3OG2A 3IB3A 3EMRA 4S2FA 4ZU7A 1BVP1 3IPVB 4IEWA 2VZPA 1R091 3N3HA 4CP9A 1NX9A 1MACA 1Y43B 2GNBA 4Z82A 1UX7A 5C70A 2HCSA 4J25A 3MV01 1V0AA 2R042 3N9PA 4EK9A 4XMAA 2JECA 2Y6FA 2NPIA 2DV9A 4XAEA 1APNA 1DW9A 2WZR3 4UW3A 1YQCA 3UNPA 1H1MA 5EQUA 4PI0A 3C2UA 3N36A 3TBDA 2HWE2 5FR3A 2XQRA 2RJ2A 4YLZA 3V64A 1AR61 3MLKA 4UBGA 5KHIA 5KXBA 1AR81 4HMZA 2V09A 1GYKA 1W9SA 5JSPA 3G0TA 1RUG2 5FJKA 4Y33A 3ZSJA 2QQKA 3J7NA 3K4ZA 4QX5A 1HF0A 4AEKA 2BRTA 2ZEWA 2XCJA 2JX9A 2WIIB 5A3LA 1OURA 3AYAA 1R1A2 4IETA 1GP4A 2ZJCA 4QX3A 3UFDA 2DCZA 2E9QA 4LUKA 2B7YA 4AXOA 4DOUA 4F8AA 5KR7A 3DNVB 3FHIB 3M9LA 3V65A 4AF9A 1AF9A 4OI4A 5ABJA 3K48A 3VBRC 5FDBA 2YC0A 4XFGA 3WQBA 3K75B 2Q8DA 1QJY3 2K9ZA 4UF0A 1TME3 1ZRFA 5FPUA 2FDKA 3IDBB 3J26N 3BTAA 2P17A 3J7HA 2W1SA 1CAVA 1ND2A 1ENSA 4QKFA 4QX1A 1ND2C 1Q8QA 2DF7A 3RYKA 4B4RA 1AR73 3GJAA 5JOWA 3AVRA 3NAPA 4FFHA 2ODRD 2PXLA 2WNUC 3M70A 4XQWA 3AZXA 5IK7A 1TZOA 2QQPA 2L9LA 2G9ZA 4LKEA 1RYYA 1EAH1 2X09A 3CU7A 4I0BA 5LBBA 1N1VA 1EV12 1RINA 4X4DA 3RFRA 5CG8A 4ZKTB 4H3WA 4JAAA 3ZMOA 4CCJA 2FDIA 1W05A 5FY8A 1DLLA 1EV11 4HK9A 5A70A 3VHRA 2KA3A 3GYDA 4M0HA 3L9JT 2BV4A 2ES3A 1HKDA 1FPN3 1CONA 1NCQA 4FT8A 4I0AA 4QD2A 4XF0A 3S5QA 4F3JA 1POUA 5A1LA 1V6KA 3OKZA 1PNGA 2FDJA 2NZ9A 1EPWA 1RUI2 4OHVA 4QGNA 4OHZA 4CUGA 3I59A 2GC1A 2QDNA 1AR71 2PUFA 3POFA 3W21A 1TMF1 2E51A 2R062 3ALQA 4YGDA 1BYHA 1UNBA 3SQOA 1GZTA 2WT2A 1FNYA 3HPNA 2EIBA 3M3EA 4P02B 4L9BA 5H9RA 4AI3A 5A7OA 3D0SA 5FO9B 2X10A 2BTVC 1CIYA 3ST7A 2BDRA 3KHBA 4G3YC 2VZ3A 4MCTA 1X9PA 3ETPA 4DE8A 2Y6LA 3VV1A 5HV0A 1BEV3 3VN4A 4O61A 4TYSA
chains in the Genus database with same CATH topology
4M01A 5KHGA 2Y0OA 2ZOEB 4CDUC 1WGPA 1O3TA 2XVKA 1DQ4A 2KPJA 4GULA 4KGGA 4CDUA 4YFZA 1J59A 3WUCA 1ZBE1 5FLHA 2EAKA 2EIGA 4LBQB 1YLLA 1VBB3 2ZAAA 1PGL1 1R083 3ZYGA 2ZGNA 1PRVA 1QJX3 4V1PA 4M00A 1LLIA 3LOIA 1C1FA 4QMAA 1LR5A 4N90A 4OHYA 1MS4A 3SNMA 1QGLA 1BVVA 4G9SB 4ZU5A 1SLIA 4KG8A 5FAXA 3WG4A 5LRSA 1CESA 2DU1A 3LCPA 2VVFA 2QJVA 2ZHMA 3A0KA 4PF5A 4TSVA 3SMHA 4CDXA 1LB2A 4ES8A 3KQRA 4I02A 1GQGA 1FX5A 5GLUA 1RUNA 5BY5A 2R1JL 3VL8A 1BBT1 1LOAA 1QDCA 4I2OA 3VK0A 3O12A 5A33A 2ZGUA 2A6ZA 3UK9A 3VZNA 1BBT3 1GFF2 1N3OA 1BEV2 4K8FA 1WCSA 4XJWA 2F4PA 1RHI2 2D6OX 4CDWC 2XJUA 4DRRA 1EP0A 1EY2A 3E97A 5CFDB 4A7ZA 2B39A 2LCVA 4QPYA 2L49A 1DZQA 3VBUC 5H9SA 1BK1A 1GZCA 3WCSA 2AUYA 4LE3A 1DWKA 3BALA 3R6SA 5L7OA 2OZ6A 5I93A 4X6QB 4B4QA 1ZZ6A 1W6PB 2VNRA 4F83A 4COVA 1PK6C 2VMIA 5E88A 1ALYA 3JBG3 1X82A 2TUNA 4P9LA 5T50A 3AMQA 4X4IA 1FOD3 4JCKA 3H1YA 1FV2A 3ZN6B 5J48A 1PM7A 5FCCA 4FVVA 3U3WA 1GNHA 3DGTA 2XBO1 3FFQA 2PAMA 1U5XA 2H6CA 3NV3A 1YIPA 4M3CA 1RMU1 4ISRA 4IEPA 1ULEA 5BNPB 5D8AC 2GNDA 4HZFA 4QT6A 3ZXDA 5BNPC 5C4WC 1KRIA 1O3SA 2WA3A 4XZPA 2ZGSA 1DQ6A 4XTMA 1CAWA 1YSEA 3KCXA 5K8SA 4OLLA 1R081 4OHXA 1UU6A 4FOVA 2XB6C 1PO12 2HWD2 2EXKA 5CFCC 2WFPA 2ZX4A 1AX0A 2UY9A 1POV0 2WWSA 3MF9A 4CEYA 2BWCA 1LU1A 4PU3C 2E7AA 5DUXA 1CAXA 2D7FA 4M3CF 4AGRA 3WP6A 4LBQA 4R4ZA 1PIV2 3KGLA 1IOAA 5JLVA 1B35A 1OOPA 2VVDA 1LCDA 4GQMA 1RUH1 1LENA 4LO4B 2OA2A 3ZFGB 2NP0A 4RR3A 3UKNA 2AXZA 3OF1A 2IXIA 2C9AA 1NXMA 2IXLA 4Y1XA 2C1FA 1OSGA 1YFXA 4Z59A 2E6VA 3JD72 4FP2A 1W6NB 2VMHA 1HV1A 2Y38A 4LLFA 2BQPA 1G9CA 2A3YA 4AFBA 2PPXA 2VOXA 4H7LA 1EV13 2UURA 2R061 1VBD3 4AHXA 4YW1A 4QM9A 2XLFA 3FUQA 4M3CB 4AI0A 2VH9A 4YARA 3WDTA 1QQBA 1MZEA 1B09A 3PHMA 4FOQA 4RHV3 5FTTC 5BNPA 5CFDA 2EXJA 2LUWA 3ZPYA 4XIOA 2SBAA 1W6QB 3KT1A 3OGGA 3FWEA 1JH5A 1RUI3 4AQSA 4ZXKA 1AYN1 2ZS6B 2GSYA 1PIV3 4I0WB 3D0JA 4CYDA 2WZR1 1DYPA 4BOWA 1AR91 5J96B 4Z92B 2RE9A 4IERA 5LK5A 5AC92 5KWRA 3E6DA 2ENRA 4WZFA 3L1PA 1J58A 4YZ3A 1TNFA 4UBHA 1LCCA 1REDA 5JSOA 1LEDA 2YUEA 1ASJ3 1VPWA 3RQ0A 5C9AB 1JWLA 3TB0A 3ZSLA 3JD73 1OOPB 2GAUA 3ENRA 2HKXA 5FFOC 5BPXA 2VECA 4RQPB 1QDOA 4YW3A 3LZZA 1F5FA 1SMVA 2D3SA 3J8F2 1BCXA 1PVC2 1QJX2 1W0PA 5KBFA 2NMOA 4MZUA 3I8TA 1YYNA 4K1ZA 2Y0IA 5DDJ2 4ATEA 3LA2A 3MGUA 1CAUB 4Z2WA 1LHVA 5DDJ1 3ZXFA 1XNDA 2OUHA 1L1MA 3F51A 1F2NA 4S2HA 1DQ2A 2PHXA 5IK8A 3IIAA 4NWVA 3JXBC 2NLRA 5T54A 1V6MA 4LO6B 1JFSA 5FBZA 3ZHIA 1D4M2 1QOOA 3QOPA 3OBTA 5F6KA 4Q0SA 4YW5A 4TWTA 4BMBA 1KQRA 1LHUA 2HWB3 2ILMA 1RUE3 1JFTA 3VBRA 4JTNA 4BA6A 4IEVA 1Q8PA 2O0OA 2VNGA 4BWOA 3PLQA 4WVMA 4BYYA 4LBOA 4QPGA 2JG8A 3WINE 1V9U3 5K9YA 1RVF2 2IFRA 3X29B 1LMB3 3LFPA 3HBZA 1WLDA 2UU8A 2XBO2 1QKQA 3NV2A 2R0HA 2WNVB 1X57A 1KXGA 3JQXA 1AL23 4K6BA 3HIFA 1G9BA 5HXVA 1LESA 2EF6A 4Q4W3 1QXJA 3ZXGA 3I4IA 4JRAA 2DUQA 2E7QA 1YFYA 1HLCA 2ZGPA 4FPYA 1SQ4A 1BDHA 1XRUA 3QD6A 2UWBA 1CAUA 2PAKA 2XIUA 2GMPA 4FPJA 5JI7A 2A75A 4SBVA 2ERFA 3I2DA 2XJ3A 1D0HA 3BU7A 4ZU4A 1RUJ3 4R9AA 4ASLA 3RI8A 4AQTA 4ASMB 3MPBA 4SLIA 4Y1YA 3BS3A 1RVF3 1JYIA 2JD4A 4LBMA 3ZIWA 4XQ4A 3WG3A 2D3PA 1BXHA 1XNCA 2G9FA 2D98A 2UYBA 3AM2A 1I3HA 1O3QA 2A6WA 4A7YA 5GLVA 3F6WA 3U0ZA 5FPXA 3QYXA 1G6NA 1QP7A 3WV6A 1ZVFA 3K51A 5KHJA 3WDWA 2IUOA 2FMYA 3D8CA 1CAVB 3MI8A 3ZFGC 4FPKA 4CP0A 1SCSA 1UKGA 5CIRA 3B7MA 1MZ5A 3M4FA 1ZPQA 5JPMB 2A5ZA 3KMHA 3AJYA 2ZX2A 1WW6A 1QWRA 4PU8A 5DG1A 2HWC3 2Q5TA 3J9SA 2RMU1 2G9GA 2WNVA 3TOJA 4X4FA 4DNYA 3WW4A 4AFAA 4PIZA 4EJRA 4QQHA 1W6OB 4WM8A 2H8RA 4K1YA 4CEYC 5F1RA 4Q1PA 3AJZA 1NCRC 2PUAA 1PO23 4XFAA 2ZZJA 3VHOA 4HBNA 2ZHNA 2DYCA 2HWF1 3NSTA 4AVSA 5I0RA 3R4UA 4XFFA 4AWDA 5C33A 4Z58A 4YW2A 2Y26A 4YSFA 5I91A 3QLQA 2RS52 4X4EA 1CX4A 4IESA 3UJQA 3WQ1A 2IZWA 1QP0A 1COV3 1F31A 2O1QA 4MGKE 3AP5A 3M2MA 4KGQA 2GC3A 3USUB 2VGDA 4QPGB 2IC1A 4LULA 1MQTC 4HN0A 1HQNA 4PBOA 1OHFA 3AKSA 5KHHA 4BZ4A 2GNMA 1QNYA 1V6OA 4LBLA 1S2KA 1AX2A 4RD7A 4BH9A 1ZREA 4L97A 2IXCA 3RRDA 3PNAA 4P9WA 2WIUB 3SLIA 1JW6A 4D69A 3TAYA 2AGSA 3AKTA 1U5IA 2BBVA 1V00A 4AQ2A 1NYWA 4MXWB 3J8F1 2EXHA 3AMPA 4XJ9A 4JGZC 2QUOA 2D40A 1O5LA 5A7LA 5K7PA 1IPJA 5AVPA 3POSA 3M3QA 1LEMA 2AYHA 1KDMA 5CAZA 4KU7A 2R32A 2WJSA 3ZFFA 3MIDA 2PUEA 1LOCA 2XSDC 5JZGA 3TNQA 3FLRA 1W6OA 4Y4YA 5EZWA 3S8QA 3FFZA 1VAVA 4AG4A 1XE7A 3SH4A 4Y42A 4HANA 4EV0A 5FPZA 2PHTA 1RUJ1 1X8EA 1C57A 2ZGLA 4K20A 3VZOA 1XU1A 2X8KA 5EWSA 1WLWA 4C91A 3R1FA 4Q4X1 3VZJA 2BGCA 4YVSA 2RR11 3IT8A 4Q2FA 2RS11 1AXYA 5GALA 2EWTA 4GWMA 4WZCA 4XFIA 4JQDA 1GLHA 1O7FA 5H9PA 4K3UA 1TME2 3MIGA 1B35C 2PUGA 2YZ4A 3USUA 2FMDA 3O0XA 1RUE2 4L92A 4YM2A 2KEIA 4I3GA 5BXXA 5CA6A 3H1MA 2ZTNA 3VBOA 2KM2A 2LYKA 1QJZA 4IEZA 2RS32 5JWPA 3WVJA 4IV3C 3LKJA 2YDEA 1V9U2 2CGOA 1MZ6A 4IEQA 4WM8B 4YM3A 1PGW1 2PUBA 2MPFA 4KBBA 5CVRA 5DDJ3 2O4AA 4X4BA 2IXKA 1PGW2 2PHDA 3EUSA 3MLJA 4EROA 4D7SA 4HETA 3VBSA 2EVXA 2KEKA 1FMD3 5KXDA 1PNFA 4HVQA 1RUC1 1IKPA 5AFBA 1FV3A 4NWWA 3VBFC 4L8QA 1AJOA 2IVQA 4KQ7A 2P3IA 2A3XA 1UZYA 1VJ2A 5BYNA 4B4PA 2DCTA 2JG8C 3KT4A 1NCQC 3JXDL 4R8HA 3USSA 1DGRA 3B9IA 1FATA 1ZZ9A 4GH4C 4I3PA 4LE4A 3B94A 3VBHA 3H0OA 2RS33 1JHNA 1HQLA 1FNZA 2CY6A 2WNUB 1F5JA 1RIOA 1S0BA 1ND2B 1TQ5A 3WUDA 4L11A 1S7EA 1RZRA 1LECA 3KS7A 1IS6A 1ONAA 5JR7B 3VBOB 4JRLA 5DZFA 2PQQA 2BFUL 4YG3A 4MUVA 2Z69A 1H9WA 4QU2A 4JTOA 1W6NA 2XWJB 1L3JA 3AMMA 4R52A 3ZXLA 3WP5A 4Q4V2 1R092 1NCQB 5DG2A 3WDXA 4Q4V1 1N1YA 2R041 3I59B 1O3RA 3MIFA 5E1RA 2JKBA 2GALA 1F9KA 2YV8A 1CN1A 1EPZA 4X4GA 4Z5HA 3VBFB 1LOBA 2FZ1A 4PU4C 1B0NA 1HX6A 3VBSB 3RG0A 3N35A 2W68A 5GZEA 2W0XA 3VZMA 2D6PA 5I0UA 1HRI2 2GMMA 2Q0AA 4FN3A 4C0BA 5D8AA 1XYOA 2E53A 1H8VA 5IK5A 3S0MA 1HRI1 1XU2A 1AXZA 2SLIA 3GBWA 2Z5WA 3GN5A 4JVAA 1NCRA 1ZBE3 4Q0PA 4RHV1 1A78A 1WH6A 1IZ3A 5C6CA 1YIFA 3AYEA 2AXUA 4GMP3 4FPEA 4Q8LA 3VBHB 2JCGA 3JBG2 1J1LA 4N53C 1ZUGA 1Q43A 2JDZA 4NPRA 2Q30A 3N7JA 1JUIA 1RVF1 5FLJA 5F9TA 2QVSB 2AH2A 2BNOA 5FMOL 2FQPA 1SLCA 1S0DA 4YVSC 3THTA 1QJY1 3VBUA 1I5ZA 5ABJC 1OA4A 1F8VA 3VKNA 4Y22B 2R043 3WY6A 5JAXA 4D94A 1H1IA 1RUG1 1X36A 3ES4A 3UKTA 4UW6A 5A33B 3MYXA 1ZRRA 1W0OA 1WW5A 2EALA 4R4XA 1NA1B 1EAH3 2WS93 3AX4A 2WQZC 1FPN2 1YXWA 4K40A 2LYPA 1ND3B 2TBVA 3O5SA 4AFDA 1TE1B 1KS4A 2ZGMA 4RS5C 1SLAA 2CROA 3NAPC 1WMDA 2ZZQA 5I0TA 1LHNA 2VOWA 3QBQA 4W6WA 4DFSA 3GN5B 2WLPA 3GHMA 2NQYA 4R9DA 2QZ3A 2HINA 2E7TA 2R1BA 4FBFA 2XGXA 5JOZA 2VG9A 1BDIA 2P3KA 2QE3A 3IWZA 5GZFA 3RDIA 1X33A 4Z5DA 1IS5A 2IVBA 4YZ1A 1N1TA 4RFT0 3O0WA 4PIXA 3RSJA 4XE9A 2D5HA 5K0UB 3H8UA 3VKOA 2CGPA 1HDKA 5C8CB 4BIOA 1UXDA 2ZHKA