1ZZ9A

Crystal structure of feii hppe
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
192
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKEPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
molecule tags Oxidoreductase
source organism Streptomyces wedmorensis
total genus 44
structure length 192
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz9A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz9A02
4HSJA 3E6CC 2IVBA 3ES4A 1WH6A 5FPZA 1YLLA 1VP6A 3HT2A 4YG4A 2GZUA 3OGJA 2BYVE 2Q30A 2OA2A 2IVQA 2D5HA 3H9AA 5K8SA 3L2HA 4QM9A 4BH9A 1CJGA 3GYDA 3UFDA 1ZVFA 1SFNA 1Y3TA 2OZJA 2Z2SB 2GU9A 4D7SA 1J58A 1I5ZA 2KEIA 3S7IA 2LYRA 4KU8A 2OFYA 4ONUA 3RYKA 2OZ6A 1PRVA 2XI8A 4X4FA 4XFIA 4YRDA 4X4DA 1U12A 3M70A 3MLFA 3NSTA 2FQPA 2UY9A 4IEUA 1FI2A 2KEJA 2FMYA 2VQAA 2GZWA 1BDHA 1DGRA 4HN1A 3JXCL 1JH9A 2LYJA 2AXVA 3EJKA 4J1XA 1ZRFA 5J7MA 1ZZ6A 4MV2A 3SMHA 1ZAYA 2XJ3A 4E2GA 4PU3C 3F51A 5KHIA 4JV4A 1QP0A 2EWTA 3EBRA 3HQXA 4MGIE 1NE6A 4IEQA 4Q29A 5C8WA 3H50A 2Q0AA 3F6WA 3VK0A 3D82A 4XFCA 5EFUA 4HVOA 1DGWA 4KWKA 3VHRA 1ZVVA 1OFNA 2ZKLA 4J1WA 4P9GA 3H7YA 3O9XA 1CAUB 4BIFA 2PPXA 3S0MA 1ZS4A 3FFQA 3PNAA 4XFGA 4BYYA 1O3TA 2MQKA 4EWAA 2N7GA 4JTNA 3MPBA 1OI6A 1OMIA 5BY5A 2CGPA 2GRMA 3SHRA 1VPWA 4LULA 5FQ0B 4Z82A 4YG7B 2XL9A 1CAVA 3RYPA 3BDNA 2AW6A 3NL1A 3RYRA 5I0RA 1UCXA 5CU1A 1Q43A 1LB2A 1LMB3 3OTFA 4FT8A 4UBGA 3QWGA 4CYDA 4Z07A 4LLOA 1O4XA 1PERL 3RDIA 1RUNA 1OCTC 1YFUA 1GQHA 1O5UA 4IETA 4WBBA 2GC1A 3ZHMA 3ACLA 3F52A 2EAAA 3QACA 3D1NI 3IWZA 3QOPA 4HMZA 4AVBA 3UKNA 4KU7A 3FZ3A 4RD7A 4LTAA 3U11A 1QP7A 2EBYA 4AXOA 5I93A 2B5AA 4PIZA 2XKPA 3H1WA 3I54A 1IPKA 2V09A 3JXBC 5A7LA 1X82A 1IC8A 2O49A 2C0ZA 3I59B 2AXZA 2PE5A 4XETA 2WFPA 4I2OA 1XRUA 2VECA 2Y0OA 2BNOA 2D40A 1RL3A 3RPQA 2HJIA 3OF1A 4N9HA 1EP0A 4AVCA 4QGNA 4NDWA 2WIUB 2H8RA 4X4EA 4IERA 4O9EA 4PIXA 2PAKA 4IEXA 5F1RA 4HVQA 4FN3A 1YFWA 3SXWA 5FPXA 5I8YA 2PAEA 3ST7A 5FDBA 3KSCA 2PUGA 2LYSA 2K0GA 2BGCA 3NKTA 2PA7A 1CAVB 3NJZA 5J48A 1HW5A 2JVLA 1QP4A 3LZZA 5JSRA 2IXJA 1UPIA 4HSLA 3PXPA 5FCCA 3WW3A 2AUWA 1ZZ9A 1O3QA 1H1IA 1X57A 4Z5CA 3WW4A 1WH8A 1X8EA 5I91A 1JFTA 4XEZA 3FMYA 2IXKA 1OD5A 4JTOA 1ZUGA 4Z59A 1FXZA 1TQ5A 2PTMA 3OQOA 4FBFA 3UKTA 4YG1A 5FQ0A 4LA2A 5JAXA 1LR5A 4X4GA 1DZRA 4FAGA 1ZRRA 5JSOA 3WW2A 3ROUA 1EPZA 1RZRD 2CAUA 1HF0A 1DW9A 1LCDA 3E5QA 1RGSA 1R63A 1AU7A 3U3WA 1V70A 4IVZA 1NXMA 4Z5HA 1XWRA 2UYBA 5HI0A 3SCHA 2IC1A 4PIYA 3EUSA 3OQMA 2R63A 3DL3A 5KHJA 2H6CA 2UY8A 3CF6E 3LOIA 2PUDA 4X4BA 3KJXA 1ZZCA 2I45A 1Y7YA 4MGZE 4JQDA 4JVAA 2PHDA 2LCVA 1EFAA 2ET7A 4ORFA 2HKXA 5BPXA 3G5GA 1XE7A 4R8HA 2VPVA 2IV1A 4LUMA 4I3PA 1ZREA 4MGKE 3H3UA 3H3ZA 4IEOA 3CJXA 2B9UA 3I59A 4HLTA 4N9IA 1E3OC 2BEOA 3I7DA 4MGYE 4XF3A 5KHGA 4YYOA 4Q0SA 3ZHIA 1YHFA 1SEFA 5K98B 3SCFA 2PUCA 1IPJA 4WVZA 2LYKA 1LLIA 1RC6A 3KMHA 4QGMA 1ZPQA 3BD1A 3JZVA 3BPZA 2QVSB 4XF1A 3MDPA 2GH2A 1PM7A 4I8TA 1YWKA 5I8TA 2QJVA 2PUFA 1ZZ8A 4I6TA 3LA7A 1YUDA 3DKWA 1CAXB 2GAUA 5LRRA 1CQTA 1PNRA 2BNNA 4PU4C 2JCGA 1DZTA 2CAVA 1LCCA 3EO6A 3PVBB 3RZZA 4EWEA 1CAWB 1RIOA 1RTVA 3CLPA 4AQ2A 2LYQA 2IXIA 2K9ZA 1B0NA 3NW4A 4ZU5A 3FJSA 3R6SA 5JR7B 4EWDA 3ES1A 3IDCB 2HSGA 1ZRDA 3TNQA 3NVCA 4O8BA 1O4TA 2PHLA 4H7LA 4QM8A 4WZCA 2XSDC 3SCGA 1UIKA 5KHHA 5I8SA 2HINA 1WETA 2KXLA 3BCWA 4ZU4A 2GC3A 3EQEA 4HN0A 3S8QA 5JSPA 3U0ZA 1FT9A 1NEQA 2IXLA 1L1MA 3HT1A 2XLGA 2PUBA 4OB4A 2XHKA 3S7EA 4K8FA 5FLHA 4I02A 2IXHA 3B7HA 2D5VA 3WW1A 3CO2A 4LUKA 3UKVA 1L3JA 3IDBB 4IEWA 1ZZBA 2ICPA 3OMTA 4E2QA 2H6BA 2E9QA 2ZCWA 4E2SA 1CGPA 4NVPA 3MYXA 4YBAA 4IA8A 2DCTA 3H5TA 2OYZA 3IVPA 3QF3A 3ZKCA 3FE5A 5BXXA 4PU8A 2UYAA 1O3RA 3USSA 4IEZA 4GULA 3LA2A 1J3PA 1QQBA 2LYPA 2GC0A 1BDIA 4I0BA 4OFGA 4ZU7A 1X8MA 5LEKA 3RNSA 2IU7A 3CECA 1RUOA 1QPZA 1J1LA 5LRSA 4IWRA 2FJRA 1QXJA 3QQ6A 1WA4A 2MHFA 2ICTA 3EHKA 1YFXA 1EYBA 4OLLA 1NZCA 5D1IA 5BV6A 4MH0E 4DINB 1CAXA 2MNGA 2F4PA 4F7ZA 3HIFA 4UBHA 4XFFA 3HZIB 1WGPA 2BJCA 3DV8A 4FAHA 4XFHA 1CAWA 4GHJA 4R52A 3OD0A 1O3SA 4F8DA 3CROL 1WLTA 2L8NA 2Z69A 3LISA 3CLCA 3MZHA 5EZWA 3LAGA 3ETQA 2O38A 4MCXA 3QYXA 4JCXA 4X6RB 4PJYA 3FYAA 1JFSA 4QX5A 4Z5DA 1XE8A 4MCTA 4IEPA 3H1MA 2B5HA 4FBIA 2BNMA 4I6RA 1J3QA 4GQMA 4EROA 1YSEA 3IBMA 2XLAA 1O7FA 3KXAA 3E97A 1QQAA 3GN5B 2Q1ZB 3LWCA 4MUVA 4I01A 4YARA 3JXDL 2D5FA 4I09A 5AVPA 1QY4A 2CROA 1H1MA 2A6CA 3BB6A 4Q0QA 4Q0PA 3E5UA 3CL1A 4X4HA 4LEJA 2L49A 1PRAA 4F8AA 4MZUA 1SQ4A 2EVXA 2CSFA 2D93A 1UTXA 4Q0VA 2Q4SA 5FLJA 2ETEA 3H1YA 1J59A 2PAMA 4QXKA 4L2NA 3R1FA 2WC2A 4L11A 4JCYA 5BUVA 1VR3A 3E6DA 1PMIA 3CEWA 2PYTA 2R1JL 3KCCA 3L1PA 3FWEA 4BHPA 3FYMA 4AVAA 4X4IA 1UXDA 3U10A 2XLFA 2KEKA 4IEYA 2AWIA 3H7JA 5CVRA 5E1RA 3FX3A 2EA7A 5I0UA 4IEVA 3LFPA 4XF9A 2KPJA 2LYLA 1R69A 1LKNA 5KBFA 2GC2A 2O4AA 2B8MA 3BS3A 1NE4A 4AQ6A 4KWLA 4I0AA 2WUSR 3ELNA 1SQ8A 1UD1A 4KL1A 1G6NA 2KZ8A 4EV0A 1RZRA 2O8QA 1VJ2A 3TRBA 1X2LA 1EY2A 4X4CA 3DN7A 2QCSB 2XGXA 1CX4A 5I0TA 2XKOA 2AXUA 1LRHA 2H0VA 1ZZ7A 4HZFA 3PLQA 1X7NA 1O5LA 4I6UA 3OCPA 2ET1A 4QGLA 4D7TA 5FLIA 1I6XA 4O9GA 2QNKA 1S7EA 4Q0UA 4YNIA 2XL7A 4TLFA 2IVGA 5C6CA 2O1QA 5T3NA 3BU7A 5J3UA 3TNPB 2PUAA 1DWKA 3E5XA 1UXCA 3KGLA 3OQNA 3GN5A 1GQGA 1ZNPA 4LA3A 4XFBA 3M3IA 4A2UA 1Y9QA 1ZX5A 2MPFA 2IUOA 3O14A 5CADA 2P17A 2PUEA 1ADRA 3ZDSA 1ZRCA 3LA3A 4KWJA 1J3RA 4IESA 2PFWA 3KZ3A 1GT0C 3BALA 3OP9A 4XF4A 4B29A 3B02A 4Z58A 2QDRA 4HVRA 4XF0A 1UW8A 2XIUA 5LEJA 4YSFA 5KHKA 4QMAA 1QXRA 2ATFA 4XFAA 3DNVB 1RPEL 2OR1L 2OPKA 3D0SA 1QWRA 1JUHA 2IXCA 1POUA 3E6BA 5I0SA 2EF8A 3H8UA 3IIAA 3N4MA 4META 2CV6A 4Y42A 5E16A 1PRUA 1CAUA 2XCJA 1OSLA 2GRLA 3G7DA 1LQCA 2MEZA 1UIJA 4PU7A 1WIZA 2PIJA 1NYWA 3KGZA 4UXAA 5JCTA 1YFYA 1JWLA 4MX3A 4HBNA 3C3VA 1NERA 3D0JA 1Q5OA 1RZSA 3FHIB 3GBFA 2PQQA 4X6QB 1Q3EA
chains in the Genus database with same CATH superfamily
1YEWA 3ES4A 3U10A 1BEV1 2DVDA 4A41A 1DQ5A 1ZBE3 3DYOA 1PZ8A 3VZMA 2GZUA 1QXPA 2OA2A 1W6PB 1GYKA 3KV9A 4JGZA 1UYXA 4LO4B 3T4VA 3H8OA 1C4RA 2VU9A 5ERLA 4ER0A 1SFNA 1Y3TA 2OZJA 3HJRA 4D7SA 2H0BA 3K75B 5FY8A 2OFYA 1MEC1 3PU8A 3HMYA 1IKPA 4M3CA 3NAPC 4OMDA 3NNJA 1U12A 3M70A 3ACFA 5DDJ1 4IEUA 2UY9A 1SHWB 2I74A 1FI2A 2HWF2 2KEJA 2FMYA 2VNVA 2GZWA 1DGRA 1JH9A 3ZVXA 4CCDA 4RR3C 1Y9MA 3WNOA 3VD4A 5EHDA 1DGLA 4YGEA 2ZEZA 1ZRFA 1W9SA 5J7MA 4MV2A 4Q4X1 5A3NA 3HPNA 2XJ3A 3LFIA 4K1YA 3F51A 5KHIA 3FL7A 5H9RA 2EWTA 1KGYA 3HQXA 4QX0A 5ABJA 2AGSA 2JB4A 3VDCA 3DPRB 2GMEA 1RUF2 1W6NB 2FDHA 5ANNA 5IYYA 4NE9A 4RGAA 1PK6A 3Q8AA 4WM8A 2W1WA 5FBJA 5FO8B 4J1WA 4P9GA 4NIHA 3H7YA 1CAUB 5A3UA 3S0MA 1PZ7A 3FFQA 3PNAA 4BQXA 4XUPA 5LBFA 1QOSA 3WXPA 2PXKA 3D6EA 1POV1 5FYMA 3ME5A 4ISRA 1APNA 2QQPA 2D6PA 4N8MA 4JTNA 1W6MB 5BY5A 4Q4V1 5BNNA 3BU0A 2CGPA 3SHRA 3UK9A 2W95A 4LULA 2L9LA 2YUEA 3S6PA 2P5BA 3HN1A 3R09A 1TMF1 5K7PA 5FZ1A 1GQPA 2BQPA 4AGGA 1XC6A 5DAQA 4YFZA 4YVWA 2AW6A 1QZXA 1NKGA 2HWB2 2VG9A 3FLPA 3LKJA 2GN7A 3WZ1A 1LMB3 1HB2A 5T5JA 4IV1C 4K20A 1PO11 2VJXA 3QWGA 3LEIA 3DXTA 1AR61 1AR83 4LKSA 2YMZA 4LLOA 3VBOA 4IE0A 3USUB 1PERL 3RDIA 3BVCA 1OCTC 2BBVA 4CDQC 1Y4WA 3OPZA 2PHRA 1HV1A 4IETA 1YNAA 1ULDA 4M3CB 2WABA 4XUOA 1ONAA 1RUI3 2JKXA 1MS5A 3A7QA 3GZDC 3EXUA 4K9SA 3D1NI 1WZXA 2QQOA 4FPYA 3UKNA 3S57A 1OT5A 2XXZA 4LTAA 1VMFA 1AR72 1R081 1UYPA 4AI1A 5I93A 2WNUC 2B5AA 3PUAA 2WFF1 2XKPA 4PIZA 3I54A 1HDKA 1T2XA 1X82A 2O49A 4P08A 4TN7A 3T4HB 2VW2A 2W47A 4XETA 2WFPA 5D8AC 1XRUA 2Y0OA 1COV3 2B39A 2J1TA 4XXPA 4YZ5A 1MQTA 1RL3A 3FFZA 1VMHA 1UYZA 3M3OA 4WM8B 1QQP3 4B4QA 1OVPA 4JRLA 3RPQA 4NUBA 1ODMA 2HJIA 5CB7A 1CN1A 5KC5A 1W0PA 3C8XA 2X09A 4NDWA 2VZSA 5DAXA 4RGKA 4AF9A 3OPTA 3PUSA 1S0GA 2AC1A 1PX4A 2PAKA 4IEXA 4LMFA 3DUIA 3SXWA 4YGBA 1V9U3 1AYM3 4OHXA 1UY1A 5I8YA 3BPSA 3RMXA 5IK7A 1MR5A 2PUGA 1F5FA 4QWNA 5LY2A 2BGCA 5FP3A 3OKZA 4ASLA 3RGBA 2YZ4A 3VHPA 1S2BA 1RJ8A 2VCBA 4QT6A 4LOTA 1PO23 1HKDA 2JVLA 4OHYA 1FPN3 4DPNA 3MW4A 4XJ8A 2DVGA 3GGLA 2VMGA 2Q1MA 1OLMA 4PBOA 3RZGA 1E5HA 1RVF3 1O3QA 2HEWF 2OUJA 2Y6JA 4H3WA 1X57A 5FZOA 2ADDA 3KT7A 3O1VA 3VBOB 1X8EA 2VQTA 1JFTA 1C1LA 1N47A 4LORA 1BVVA 4DY3A 1OD5A 2FDJA 2P3YA 4CU7A 1FMD1 3SH5A 1DYOA 1FXZA 5F2WA 2PTMA 1J83A 2WS92 1HJFA 1AL23 3UKTA 1DBNA 2L1PA 4YG1A 4RYDA 4Y4YA 1W3VA 1WCUA 1IKQA 1LR5A 4X4GA 1XYOA 3HNMA 4ZXEA 2JENA 4MGTA 2PHTA 3U1XA 5JSOA 2VNRA 4GH4B 1EPWA 3VBHA 4Z1VA 5JDBA 1EPZA 1RZRD 2CAUA 2YPJA 1NZIA 2M4HA 3DF0A 2WNEA 1VBC2 2KR2A 1X50A 4FFHA 5FYCA 1OQDA 2HWE1 4IVZA 1ZM1A 5K0UB 3I3DA 5JVVA 2YV8A 1XWRA 2VZTA 4AYUA 4QXCA 3NNMA 5HI0A 2QE3A 4H2AA 5K9YA 3EUSA 1GR3A 5FREA 2BFUS 3DPRC 1X9TA 5GLTA 4EQZA 3KJXA 1C5IA 2AUYA 2CSGA 2WT1A 3N7KA 4XIOA 5FTTC 3WF2A 2DTWA 3HD8B 2HWD1 3T30A 1CPMA 2JDHA 1QJX1 3RVHA 4ORFA 3QCWA 3CJIB 3J26N 3MEPA 5IK8A 3RS6A 2YGLA 2R071 1BKZA 4RN5A 2BUKA 1AX2A 4XDPA 5FP7A 5CKNA 4ER7A 4I3PA 3MIHA 5FPBA 1R093 3WY6A 1ULOA 4CCNA 3WP6A 4AHZA 4Q4Y1 4CP9B 4IEOA 4DUWA 4MLOA 3O0VA 5LBBA 2B9UA 2GSYA 3N9LA 1YJLA 2E63A 4MGYE 4FOYA 1BZWA 4KG8A 2C9AA 2VUCA 2YY1A 4ZXKA 1YHFA 5A32B 1GP5A 2WZR2 5K98B 2Y0IA 4AVTA 1IPJA 1UOBA 2X53S 1RC6A 2Z79A 2QQLA 4I0WB 1ZPQA 2GP3A 1I9RA 2JE8A 3MDPA 1YWKA 3AYAA 5FO9B 5CBLA 1V6JA 4FI9A 4AGVA 2V5YA 4XZPA 4ZZ8A 2EIGA 3DKWA 5JIAA 4NPLA 4AFMA 1H4HA 3ZM8A 2GAUA 3ZR5A 1UX6A 2JCGA 2V4VA 4IE4A 4HANA 4XQDA 4FQ4A 3EO6A 1RUD2 3X29B 4GKXA 5IVBA 3VBHB 3JBG1 2OW4A 3O0XA 3QH7A 4LHSA 2XMLA 2RDNA 3CDZB 3PMSA 1OA4A 3K3NA 3PVEA 1RTVA 1BLZA 2K9ZA 1LULA 2VCMA 3ILNA 4O7XA 3NW4A 3FJSA 3GZAA 3POWA 4CEYB 1B35A 1A8MA 3ME2A 2HSGA 1RUC1 3ZMNA 3MW3A 4Y5TA 1HB3A 2PHFA 4CUCA 2DYCA 2WYSA 3SKVA 1O4TA 4H7LA 4WM8C 4WZCA 4IDZA 3O1UA 1ND2A 4EKIA 1MZ5A 4RQPA 1UIKA 2PXLA 2R042 5EJZB 5I8SA 1GU3A 4R4ZA 1A8DA 1WETA 2R32A 2QQWA 3B93A 3ZYBA 3MI8A 1NOVA 2VBBA 1GZWB 2JDZA 2JJ6A 5FKBA 1JW6A 1ULCA 2NYYA 2NPIA 3S8QA 4CA9A 5JXGA 4QAWA 4Y22A 4YM1A 2UURA 1KXGA 3ZIWA 1NEQA 2VY0A 1XOYA 4DXTA 2FBEA 3HNBM 3ZFGA 4SBVA 2PUBA 4XQWA 4OB4A 5CNAA 3S7EA 3ZR6A 2X29A 4K8FA 1RUH2 3B7HA 1HXS2 4LBQA 1HRI1 5L9BA 1PIV2 4OI4A 4PDWC 3WINE 4XXAA 4XJUA 5F2SA 4IEWA 2ICPA 3NNFA 4UW4A 1AYN3 3ACIA 5C9AA 5J09A 2E9QA 2ZCWA 1C8NA 4E2SA 1VBD2 3TWIA 1O6UA 1RJ7A 3POGA 3MYXA 2LLVA 1CZSA 3SISA 4L92A 3ZLIA 4EYUA 4XQ4A 3ZN6A 1JYNA 3PURA 1LOFA 2CY6A 5FKCA 1ZBE2 1OD3A 4TTGA 3PIJA 3K77A 5FPLA 3H5TA 1A78A 5F3EA 2OYZA 3VBFA 1HQWA 5FPUA 3BTAA 3GJBA 4GH4C 5C7GA 5LZ6A 4IEZA 2RS13 5FFOC 3VKNA 1QQBA 4UFIA 1NXD1 1BDIA 1REFA 3L9JT 4I0BA 1B35B 1H8VA 2EALA 3M3CA 3ZYRA 1ENXA 1H6YA 4AHYA 2X8KA 1FX5A 2OXBA 5K0UC 5LRSA 3VDDA 1IG0A 3A0NA 2VH9A 4XAAA 1UMIA 1ASJ3 1YFXA 2HYXA 3EHKA 4LIUA 4QPYA 4INDA 5IK5A 4MH0E 4DE8A 2CYFA 2NMOA 2F4PA 1LENA 4F7ZA 4UBHA 1SCRA 4FPGA 3POFA 1NLSA 2BJCA 3CJIC 3WV6A 1UMZA 4Y22B 5ANQA 5FP8A 2FMDA 3MF6A 1SDDB 3VBUC 1TE1B 1X36A 2ORXA 3MZHA 2L8NA 4YZ3A 3LISA 1KDMA 3WF3A 5EZWA 5A80A 5FAXA 1WLDA 1OKOA 3ETQA 3QYXA 4F3JA 4X6RB 1LAJA 2A7AA 2W0XA 1JFSA 3WNMA 2XHNA 3TYJA 4Z5DA 5A33B 1TME2 3AXDA 4C8DA 4FBIA 2YBDA 2X10A 3IAPA 3U07A 1J1TA 5FOJB 1KEXA 5JXIA 1WW4A 1XQNA 5C9AB 5L9VA 1YSEA 2RS33 1QMJA 1NAEA 1SLCA 2XB6C 3E97A 4LPLA 1DLCA 2HWB1 2K46A 2VC9A 5DRTA 2VW1A 1QKQA 3KT1A 4Y4RA 3VL9A 1FATA 2J7UA 2W46A 4QPGC 5FXXA 4YARA 3JXDL 5LBCA 3ZN6B 4HPKA 1JOPA 3KS7A 4COVA 1QY4A 1H2MA 4OI2A 1H1MA 2JE7A 4OHWA 5A3MA 4XCAA 1JTZX 1VBA1 5JOXA 3VBHC 1UKRA 1HN0A 3BTYA 4X4HA 2IVIB 1PVXA 2BP6A 4LEJA 4YVSA 5LCWL 5C4WB 1PRAA 4Q27A 4F8AA 2WRAA 4NWVA 4S2GA 1LGCA 1AR82 2D93A 4FOQA 2JG8A 3AFGA 3P5BA 3LPGA 2Q4SA 4CEYC 3RI8A 3LCPA 4N7UA 3VDDB 5FZMA 4L2NA 1AR93 1VRH1 2ZGQA 2PXEA 4MSVA 1AUYA 3RG0A 4L11A 1AR71 1JHNA 3IMNA 2FHRA 5ISLA 3E6DA 3FLTA 4D0QA 4P9WA 3R0RA 2ZGMA 4M0HA 1QJY2 3FYMA 4X4IA 1UXDA 2GNBA 1D4M3 2LW8A 2VZRA 2XLFA 3MIEA 2UWBA 4IV3B 4Y5Z0 3RJRA 5LWBA 4W6WA 2G9ZA 4GB33 4IEYA 1VALA 4WVMA 4BOWA 1LU2A 3KD4A 4QPIA 3TAYA 3ZPOA 2X5IB 1DU3D 2EA7A 1QJEA 5FY0A 5I0UA 1US3A 3THDA 3LFPA 1F35A 1QQP2 4XF9A 2CWMA 1RINA 2LALA 1PMHX 1R69A 2CNAA 5KBFA 2ARXA 4E4DX 1NE4A 4W50A 4KWLA 1BHGA 4I0AA 3VV1A 5F39A 4KL1A 2KZ8A 1AYM2 1BBT3 1GZCA 4QB2A 1NCQA 1U5IA 1RZRA 2O8QA 5SV8A 1X2LA 1D7PM 2HCSA 3MLJA 2HEYF 2ZGOA 3DN7A 3T2PA 4CXWA 1FV3A 4JKLA 2XKOA 2XXAA 5A7OA 1ULGA 2BU9A 3LB9A 5FO7B 5AFBA 1PO22 1JZ6A 3RZMA 3V65A 3T3YA 2VZ1A 4AEKA 3VKOA 1ZZ7A 3AP6A 3PLQA 5A1FA 4JZRA 1DHKB 2JIJA 2DU0A 1OOPA 2EIDA 4J25A 5L7OA 4YVSB 5A6ZA 5FLIA 3D5OA 1I6XA 5C8CC 1G9CA 2QNKA 1S7EA 2YHJA 3N7JA 4YNIA 4PHZA 2PHXA 5C6CA 1C8M2 2A3WA 3PUQA 3TNPB 5HBAA 2YBKA 1DWKA 1WMEA 1GOHA 1OHFA 1AL22 3GN5A 1BYHA 4LA3A 1V6MA 4XILA 3JB4C 4A2UA 2IUOA 1XXNA 2E33A 2XJTA 2LTNA 3OSDA 1JZ2A 1OURA 3SEPA 2P34A 5FYZA 3ZDSA 1UF2C 4KWJA 4ZS3A 5E89A 4AK3A 2ARAA 4K7JA 4EN7B 3OGSA 2WQ8A 2XXPA 2RDRA 4Z58A 1S0DA 2GN3A 2A3XA 3CBNA 2ZHLA 2WO1A 4XF0A 2XIUA 3DCQA 4YSFA 1VBE3 2VNGA 2AZ5A 5KWRA 1UZ0A 2ZGUA 1W05A 1QXRA 2D6LX 5DQ0A 1ALYA 1QF3A 4XFAA 3ZYHA 1NUKA 4H14A 3DNVB 4LBMA 4XHXA 3LDKA 1REEA 3NV2A 1A34A 1AJOA 3D0SA 1AZDA 1QWRA 4HKWA 4Y1XA 3IT8A 1W2AX 3ENRA 1Q56A 2HBUA 3HWJA 3POSA 4A6OA 1R092 3ZN4A 1YJKA 4ZZ5A 5DUVA 4ARYA 4META 3QOWA 2WSVA 3AJZA 3NAPA 3ORJA 3TOJA 2FCTA 2XCJA 1WUVA 3S5AA 5EYYA 2XH6A 4PU7A 1NYWA 3BN6A 5JCTA 4RR3A 1N1SA 1UQXA 1ZBA3 2Q1FA 4MX3A 5FXVA 2VOVA 1W6OA 2DCJA 2DUOA 5C4WC 2Y38A 4XOGA 5FUPA 3FHIB 3THPA 1V6IA 3W5NA 3V0BA 1CR7A 2DCKA 2QQNA 1RUD1 5IATA 2R063 3E6CC 4HL0A 1WH6A 2JE9A 4AWDA 1BJQA 1KITA 1VP6A 2XBO2 2ZGKA 3OGJA 2A6YA 4HONA 4LKEA 1OKQA 4GMP3 2D98A 2VQ0A 3N35A 4CXXA 4Q1RA 4QM9A 3FUOA 3U75A 4Y1UA 4BH9A 5IVCA 3UNPA 3UFDA 1PVC2 1ZVFA 4CRQA 3ECQA 4QXHA 4NRQA 1J58A 3IIIA 1I5ZA 3IDAA 2KEIA 5FXZA 3AP9A 2LYRA 4IV3C 4KU8A 5DZEA 4ONUA 3B94A 2NLRA 5IFTA 3RYKA 1E5SA 3W20A 2WLQA 3WG2A 4X4FA 1VPHA 4QPWA 2R041 4TYSA 2J22A 4XFIA 2X5IC 1CVNA 3NSTA 4JAAA 4OCTA 5DSXA 1TZOA 1XSRA 4CCMA 5FIXA 1HV0A 5FZCA 4UFKA 2LYJA 2AXVA 4BCUA 4J1XA 3FC0A 1CESA 1WCQA 3K4AA 4YZ4A 1D2QA 1AXZA 5A7WA 1GANA 3PVNA 1D2SA 3LEGA 4JV4A 1QP0A 1S0JA 1E57A 3B69A 3ZSLA 4IEQA 3LE0A 1RUH1 4O65A 4BQWA 1HXS1 1O91A 2ZACA 3D82A 4CDQA 4M0NA 1FOD3 1QNYA 2VZOA 5FZHA 4AEJA 5FJKA 1CJDA 4KWKA 2ZKLA 1DQ4A 4W6YA 5FZ3A 4WVLA 3TN92 4BM8A 4CUGA 1JXNA 1ZS4A 1GBGA 3BYWA 3GZDA 1XNKA 3PTRB 1VBD1 1D0HA 1O3TA 2XWBB 2C4XA 2VVDA 1XSQA 2MQKA 2WZ8A 4Y20A 3Q8BA 2RMU3 4YVSC 1W03A 4UI9L 2Y33A 3U78A 1AYN2 2GRMA 2WNUA 1WKYA 3P1IA 4YLZA 5DABA 1Y43B 2ZBJA 4Z82A 5FQ0B 4AAXA 2XL9A 1RUG2 1NG0A 3DEMA 2XQRA 1CAVA 3TEXA 3RYPA 3BDNA 3NL1A 3PUIA 5D8AA 5EXOA 1LHUA 5I0RA 1EAH1 5IVJA 3CZJA 1PHMA 5FZ8A 1W99A 5DMYA 1XNTA 2W68A 4FT8A 5C3OA 4OBMA 2JQEA 2Y60A 3U14A 3ZSEA 2RS12 1DULA 3M8LA 4LITA 1RUNA 2XVKA 4M00A 1YFUA 2RDQA 1KS4A 5HCHA 1JI6A 2JDPA 2R0HA 3C7EA 4Y3OA 1SPPA 3ZSKA 2R7EB 1WCSA 4HK9A 1H2NA 2GC1A 3TBDA 3WG1A 1N3PA 1RUJ1 1WCDJ 4LBLA 1N3QA 2P2KA 3ACLA 3LPFA 3F52A 2Z4FA 1FNYA 1C28A 4MO3M 1IPSA 3KQ4B 1OLQA 4RD7A 3OOXA 1QP7A 2EBYA 1BK1A 1W8FA 4QX3A 5FY9A 4MHRA 4DNYA 1GMMA 1W6PA 4OUSA 3H1WA 5DXDA 4PLOA 2FDFA 3G0TA 3VD7A 2C0ZA 3I59B 2AXZA 4OYUA 2PE5A 4EZHA 1UZVA 2OX0A 5CG8A 1TME1 4HKOA 2BNOA 3I2JA 3J7HA 5C70A 3A9ZA 3K51A 4QDQA 3OF1A 1EP0A 2PLV3 3U4XA 3I2KA 4DE9A 2IZWA 5EIYB 4AI0A 3AK0A 5F1RA 4DXRA 1YFWA 5GAGi 3AZZA 5FPXA 4R9BA 3ST7A 3WX5A 1NQJA 3KSCA 2ERFA 3UYJA 2WNUB 1AX0A 3UETA 2RS32 3B5LB 3GCXA 1DGRN 3NKTA 2BBAA 4QB1A 1L7QA 3UV9A 5CFDB 2Y6LA 3CMGA 1CAVB 4AZZA 5J48A 1QP4A 1NQDA 3AYCA 3M3QA 3RWNA 5JSRA 1UPIA 3DPRA 2ZGLA 1W06A 1AXYA 3MGUA 3ZSJA 2AUWA 1VB4A 1SBFA 1DQ0A 1ZA7A 1ZZ9A 1UPSA 3C7GA 4V2WA 1H1IA 3HQUA 3CZUA 1AR81 2WNVC 1YC61 3AKSA 5GALA 3OB8A 4XVHA 4XEZA 3N7MA 3FMYA 3LSEA 4B1MA 5CKMA 3UESA 1ZUGA 4Z59A 3KB5A 1SPPB 4A4AA 5G05L 4M4PA 2XXQA 4WM7C 3KHCA 4OVEA 1NY72 4LA2A 3DKQA 1AR92 2WYFA 3OYWB 1QJY1 2VL4A 4B1LA 4SLIA 4C0HA 1H9WA 1Q8VA 4Y1ZA 5ACA3 3M4FA 2HWC3 1LCDA 4XPVA 2AEZA 4W8JA 1UYYA 3IZOA 3PVOA 1SFYA 1RGSA 1R63A 3QBQA 4KH9A 3U3WA 5FMOL 1NXMA 2E7AA 2Z42A 2J7MA 1H1AA 4PIYA 1JYWA 3OQMA 1GLHA 3USUA 4GB32 1QQP1 3CF6E 3MICA 3UJQA 1Y7BA 2J1UA 3LD8A 1QDCA 3HN3A 2VVFA 1F4AA 1UOFA 4JQDA 1ENRA 1GICA 1NA1A 1TNRA 2ZTNA 1LECA 4LK7A 1KJLA 4CEWB 2ARBA 1SCSA 2HKXA 1LEDA 2ZHMA 1QH7A 4LNVA 4A44A 1WW6A 2A1XA 3GXUA 1K12A 4LUMA 4RHV3 3AKQA 1W0NA 4QHZA 1BBT2 1CIYA 3H3UA 4P9YA 4XCBA 3B7MA 2VD7A 5LK5A 2BPA2 2DF7A 1HB4A 3N9OA 2E31A 4N9IA 2JB8A 4FSJA 2BEOA 3NRUA 5FMBA 4XF3A 5KHGA 1DQ6A 3O12A 3SR4A 3RJ2X 4AI3A 3ZHIA 4CP2A 4DEVA 1LOCA 1JS9A 3SCFA 1RYYA 1N3OA 5L36A 2LYKA 1LLIA 4BA6A 1RMU2 3P3NA 1L7LA 3S5QA 4L8QA 1BCXA 4XBQA 4XF1A 3V56A 2V3CC 1O4YA 3KV4A 1C8M1 2QJVA 1YUDA 2QQIA 4C1XA 1OQEA 1CAXB 5AC92 1CQTA 2BNNA 4TZDA 4ZHNA 4ER3A 1LCCA 1W0OA 3PVBB 3RZZA 3J7MA 5JUVA 3KCYA 3MUY1 2QZ2A 5J96B 3NDBB 4JDOA 3N7LA 2WR9A 5JI7A 3APBA 3LFMA 4JCKA 5DAWA 2IXIA 4NN0A 4PDWA 1PNFA 1QDOA 1YXWA 5A7NA 3AYDA 4S2HA 3ZFFC 5F5CA 4L97A 3AMQA 3ES1A 2ZMLA 3LGRA 3ILRA 1W8UA 4DQAA 3GBWA 3RRDA 3TNQA 3NV1A 4GD4A 4O8BA 2PHLA 5A6QA 1OUXA 1NA1B 3OGRA 1VBE2 3AVSA 2KXLA 3IAQA 4LQRA 1HIXA 1QB2A 4AHWA 2GC3A 4CXYA 1DDLA 4GH4A 4COWA 2HYKA 1R1A1 2R6QA 2GMPA 4UFJA 1XYPA 3U0ZA 4XMIA 3I2OA 1V6KA 2VOWA 2XLGA 5CFDC 1OSGA 4UFHA 5K0UA 3DYPA 3BGAA 4XW3A 4CDUC 3PL0A 4LUKA 2ZGRA 2CDPA 1AX1A 3R4SA 1W2UA 4UW5A 3UKVA 5A6XA 4FTSA 1UY4A 1GOGA 3C7OA 2V73A 1JZ3A 3VD9A 3SC7X 5FYYA 1E5IA 4GWNA 3VBSB 3C7HA 3CJIA 1ZBA2 4NVPA 4H55A 1UU6A 1YQ5A 2DV9A 4K3UA 2XBO1 1BEV3 4NOTA 4QD2A 4QX1A 2CL2A 1GFF2 3VBUA 4FTEA 2OIIA 3NV4A 2BVBA 2WO2A 5LATA 4LT5A 2R062 1FNZA 3I3EA 4IA8A 4AVSA 4CP9A 2DCTA 1PVC1 2FDIA 2VW0A 3ZKCA 4ASMB 3P6BA 2C5DA 2DUQA 1RB8G 3USSA 3AL5A 4CTEA 5A32A 4PDWB 1ULEA 1J3PA 2GC0A 3AKRA 1W8TA 1JYIA 5FZ0A 3O5SA 2KD7A 3WF1A 1QJU1 5DZFA 4XJWA 3RNSA 3WP4A 2IU7A 1H2KA 4FFGA 1U5YA 4GA9A 4Y33A 2PXBA 1KDKA 5FZEA 3WD5A 4IWRA 4M3CE 4ASKA 3T08A 5DDJ3 2UWCA 1EUUA 2MHFA 2ICTA 4YFWA 1NZCA 1MS0A 4QPGA 5D1IA 5A7QA 2OKXA 4CU8A 2JDYA 4CEWC 2ZHNA 3HZIB 1P8JA 4Q4X3 2DBNA 3I2HA 4FAHA 1RIRA 2G9FA 4OHVA 5FOBB 5J36A 2AH2A 3OD0A 5F3IA 2V72A 2MEV3 2VBDA 3ITQA 2FCUA 3NQHA 4I3GA 1O3SA 3I2FA 2VMEA 3CROL 1WLTA 3ETPA 4LOSA 2W52A 3TN91 2AYHA 4ES8A 4MCXA 4JCXA 4CEYA 4AFDA 4LK6A 3MIDA 1Q8QA 3KZ4C 1FOD2 1XB9A 5CEHA 5JMOA 3M1HA 4B3NA 2V4AA 1K3IA 2JIGA 2OQ7A 4PQ9A 4B7KA 3F95A 1IS5A 2XJSA 5FYSA 2GMMA 2IVJA 4I6RA 2WQZC 4GQMA 1UKGA 4EROA 3TFLA 2A6WA 1RUG1 1W9TA 3KF5A 3OGGA 1RUE1 4N53B 5JXJA 4UWDA 1TMF3 2RMU2 4NPMA 4W6XA 4AHXA 1SG3A 1QQAA 3PJQA 1GZWA 4P00B 2BOIA 4MOAA 5EPAA 3MUZ1 3VBUB 3MF9A 1H8TC 5HV4A 1BXHA 2G19A 1GV9A 3B9IA 3OY8B 4I09A 4MXWB 5AVPA 5C33A 1OUSA 2TEPA 4YW2A 1PO13 1GUIA 2VNOA 2XJVA 3BB6A 2HEVF 4PI0A 4PQQA 2RS11 3Q8EA 2DDUA 4Q0PA 3WDUA 4DXZA 5HXVA 4PI2A 1UU5A 4AFBA 1LOEA 3T0BA 3FBYA 1QJZA 2EVXA 2CSFA 1JUIA 4WVVA 2Q8DA 4U2AA 4EKGA 2ETEA 2WJSA 3H1YA 4HKLA 4COUA 5FZ6A 3J4UH 2XJUA 2YYOA 3JXSA 3HEIA 1IGOA 4QPGB 1GWKA 5JPMB 1V00A 1JYXA 1QU0A 1NA1C 1R083 4N90A 4QU1A 2PYTA 5A3TA 3H3LA 2WFF3 3WNPA 4LHNA 3FWEA 2VOXA 2A70A 4IQPA 5FBZA 5F6LB 5FYTA 1RHI1 4BHPA 3BOWA 1O8SA 2OVUA 3AFKA 3PU3A 2LRPA 5C8CA 4JGYC 2AR6A 2WKKA 3RZJA 3OUJA 3WQBA 2FDKA 2RJLA 4FCAA 2VZQA 2CHHA 1SDWA 1YI7A 3NO8A 5CIRA 2B8MA 2XJQA 3ASIA 5F5IA 1F15A 5FJHA 3LIGA 4CCOA 1SQ8A 1EV13 4G3YC 4EV0A 5GLZA 3VBSC 1LU1A 2FDGA 4XUQA 1DYKA 1EY2A 2XVLA 5EJ3A 4X4CA 4JQRA 5A3WA 2D3RA 1CX4A 2AACA 2RM23 2AXUA 1H6XA 3MEJA 1GSLA 1GWLA 1LRHA 3HVDA 1S55A 1TEIA 4M01A 1HRV3 3IDEA 5JXHA 2H0VA 1OLME 5GLVA 4NHLA 5H9QA 4NHKA 1X7NA 1M4WA 3J8F1 4AI2A 3ZN5A 3KHBA 4OMCA 4I6UA 5A33A 2P6HA 1QJFA 1W3XA 2BWCA 1W04A 1FMD3 4YZ2A 1S0CA 3POJA 1W2TA 3MPPG 3K48A 3OBAA 3JD72 2J1RA 3POIA 1AR91 2O1QA 4HXCA 3POYA 5T3NA 4AI8A 3ZXJA 1OPMA 1S0BA 3BKZA 2VZ3A 3KGLA 1OA3A 1GQGA 1OQ1A 4Q4W3 4QX8A 3O14A 3WDYA 1HQNA 1ACCA 5BNOB 4A6SA 3JUUA 3UGFA 2WINB 3ZIXA 2HWE3 1YCIA 2EXJA 5ACA2 4L0PA 1HQLA 5H9PA 4IESA 3KM5A 3KZ3A 4WVWA 1GT0C 1G9FA 3ZPYA 3B02A 5C8CB 2QDRA 1V6OA 4HVRA 4QDSA 3ON7A 5C4WA 2W91A 1UW8A 1K42A 3GHMA 1GNHA 2HWD3 2GNMA 4XHBA 1QJX3 2HBTA 2PMWB 3BUCA 3AMPA 3N3HA 2HWF1 4QMAA 2ATFA 3ZXEA 2PXPA 4C90A 4GAZA 3OEAA 4OZXA 1UL9A 1DFQA 5FYVA 3RSJA 2ES3A 1RPEL 2R073 2OR1L 1GP6A 2ZJCA 1EUTA 1BBT1 1JMUB 2P6CA 4AW7A 5FY4A 1XE0A 5DZGA 5F5QA 1G9DA 1W2OA 1SLLA 1XU1A 2BDRA 3CHXA 2EXKA 3OGVA 4N53C 2IXCA 1POUA 4Q4Y3 4RHV2 2F6BA 3SITA 1RUF1 2P3JA 3MBWA 5DT2A 2EIEA 2VAUA 3D4KA 3H8UA 3IIAA 4IV3A 4TSVA 5GJ6A 3T1MA 3VGIA 4FXKB 3K4DA 1RMU1 5FZLA 5DPNA 5AFEA 2RV9A 4Y42A 2BWAA 3FHQA 5BYNA 3THCA 4UFLA 2ZGPA 1QIQA 5E16A 2X5IA 4DIQA 3AJYA 3SKJE 1CPNA 3G7DA 1LQCA 1UIJA 3RMYA 4ZKTB 1WIZA 2PIJA 1VRBA 2YB7A 4FOVA 4DFSA 1YFYA 5IVFA 4QQHA 1SLIA 4K1ZA 1MZFA 1U0AA 3C3VA 2BV4A 2W08A 3ATGA 3D0JA 5AC91 3RQ0A 4BWOA 1JYVA 4V1PA 5JWPA 1G8WA 2PQQA 3LEMA 1Q8PA 2DCZA 5T50A 1K5MB 4HSJA 1W8OA 4QKFA 2IVBA 4UT5A 5FPZA 1XNAA 5CAZA 4YG4A 2I2SA 2JDAA 4MG2A 3SH4A 3AP5A 2D5HA 2PXFA 2KA3A 1SBEA 4GWMA 3H9AA 5FYIA 5K8SA 3PE5A 5FPVA 3T0DA 3GYDA 3PUHA 4BQ3A 3D8CA 5JOWA 1SFPA 1ND3C 5DUWA 5BNPC 2Z2SB 1QOOA 1RUC3 2WBKA 3S7IA 5CG9A 3O1SA 3V64A 3NJVA 2DVBA 1JZ8A 2OZ6A 5CZKA 4LHKA 4CPBD 4D6RA 3ZYPA 4YRDA 5GZDA 3MLFA 5FZ9A 4FPOB 1DLLA 4XBLA 1F31A 2VQAA 1BDHA 3JXCL 4OQ9A 1A6CA 1LHOA 2WO7A 4AEDB 1RUI2 1KQRA 3WOGA 2PHUA 2RVAA 4XBNA 2C24A 1ZAYA 5LA0A 5IHRA 4PU3C 1UOGA 1S2EA 5C5UA 3EB7A 3WQ7A 4MGIE 1NE6A 4Q29A 3B9CA 2R1DA 1GWMA 3H50A 2Q0AA 3F6WA 3GZCA 3VK0A 4XFCA 4XZUG 4LLFA 5EFUA 2TUNA 4HVOA 3HNYM 5B2GB 2VM9A 1HRI3 4XTMA 1ZVVA 1OFNA 5TSWA 3ZOIA 3H0OA 4BIFA 1COV2 2PPXA 1LJ7A 1UOJA 5EQUA 5C3RA 4KBBA 1M06G 1ZBA1 2XQXA 4QB6A 1S0IA 3TELA 4EWAA 2ZGTA 2N7GA 3MPBA 3R05A 4K8RB 1XBFA 1VPWA 5E6HA 4E4HA 1RXGA 4YG7B 1V9U2 2Z5WA 4CP1A 4PF5A 5C71A 3A9YA 3WG4A 5CISA 1BEV2 3R4UA 2JKBA 3O1RA 4LKFA 1UXXX 2WWUA 4G9SB 2EXHA 4P5HA 5FZBA 5BNOC 4UBGA 4CDXB 1GNZA 4FPFA 3GDBA 4XDQA 1FPN2 4MHUA 4O61A 4LE4A 4CCCA 2ENRA 3M2MA 1A3KA 3GHNA 4KMQA 2Y6GA 1RVF2 4P5YA 3VD3A 5JR2A 3LOBA 4LJHA 3NMBA 4BISA 2VZVA 3ABZA 2PXJA 2WS91 2Y34A 4S2DA 2ILMA 3WDWA 3OJBA 5DDJ2 1KJRA 4DZGA 3QACA 2D3PA 2EAAA 4FPEA 2JD9A 2VUJA 3QOPA 4XAEA 3N36A 4GXLA 4AVBA 2C6SA 4KU7A 2W1QA 4QX2A 4E8DA 3K2OA 4GMP0 5FZIA 2RJKA 4CU6A 1VBC1 1WD4A 4LO6B 4Q4X2 4OI1A 5JI9A 3JXBC 5A7LA 2WNVA 5IAXA 3ZSMA 2MEV2 4NRMA 2VTXA 1AL0G 2VO5A 2ZXQA 1IQDC 4G4FA 4IGQA 4LR4A 4NJ4A 4LO5B 1XPWA 1IG3A 3VDBA 4WM7A 3AYEA 4K21A 4KNCA 4AVCA 1QGLA 2WIUB 5KXDA 4O9EA 4Q2FA 4FN3A 1R1ZA 1W9YA 2QQMA 2PAEA 4Q26A 1JN2P 4YG6A 4LE3A 2LYSA 2HWB3 4FOWA 4Y5SA 3ZO0B 4XC9A 4EN0A 3PHMA 2ODRD 3QD6A 4TLGA 2PA7A 2PXVA 5FWEA 4OHZA 3RFRA 4URAA 3NJZA 1K5MC 5DTRA 1I5PA 5DAPA 2WZPP 2Y64A 4N43A 1WMFA 1Q8OA 1JYCA 1VBA3 4HSLA 2WZR1 2P1BA 3WW3A 4CDWB 2FZ2A 3N9PA 3K4ZA 4A42A 1I3HA 1PO12 4D94A 4AL9A 3WW4A 1WH8A 1WMXA 2JWPA 3KL4A 2ZX0A 2IXKA 3IN9A 3AM2A 1STMA 2A75A 3OBZA 4KI5M 1Y9GA 1TQ5A 1VRH3 3OQOA 5L19A 1IS3A 1IOAA 2VXJA 3HAGA 4JX0A 4JKMA 1JZ5A 2Q8OA 4OI0A 1UY2A 5FQ0A 4C91A 2DFBA 1MS4A 5IK4A 1SZBA 1DZRA 1UMHA 2DVAA 4FAGA 3KWVA 1GZTA 2RS53 3ROUA 5FK8A 4BU2A 1HF0A 1R082 1DW9A 3CIHA 3PJYA 4M3CF 2J1AA 3I2IA 4AEDC 2VULA 2YU1A 1AU7A 1V70A 2WNVB 4Z5HA 5G04L 4DUVA 5DN2A 2UYBA 3KT4A 4BDVB 1OF3A 3DL3A 3W9AA 2H6CA 2UY8A 4QU2A 2PUDA 1ZZCA 1G9AA 2I45A 4WM7B 1DP0A 3MLLA 4YWAA 1Y7YA 1VBB3 1LOBA 4UAPA 4JVAA 5FY7A 3BOPA 4BLIA 1EFAA 3ZXLA 4NO4A 1FV2A 4AEMA 5BPXA 3G5GA 2IFRA 4D3WA 1XE7A 2A6VA 1SMVA 2Y6FA 4PLMA 3DECA 5IW0A 4BQ2A 1EV12 4MGKE 4RSUA 4XIKA 4R9DA 2BOJA 1TVGA 3E1F1 1C3HA 3H3ZA 3ZFFA 5IVYA 3CJXA 3I59A 4HLTA 5IFPA 1AXKA 1E3OC 3I7DA 4N43B 2RM22 5A7SA 4YYOA 3ZKYA 1SEFA 3LDBA 1JYTA 1PIV1 1HRV2 4WVZA 4EE2A 4QGMA 3KMHA 2CU5A 4NIDA 1PGW2 3JZVA 3BPZA 5FP9A 3JD71 1PNGA 4CDXC 2LUWA 2GH2A 2B46X 4I8TA 4AFAA 4BMBA 2YGMA 2PUFA 1ZZ8A 2WWJA 4JHZA 1FMD2 4QKDA 4EK9A 4AQSA 1W8WA 4UYBA 5LA2A 4XTPA 3WCRA 2O14A 2BTVC 2UU8A 3P3PA 4RS5B 1US2A 1V6LA 1DZTA 1SBDA 4PU4C 1ENQA 2A3YA 3WNNA 2B4KA 4Q8LA 5CFDA 3WP3A 1ZBE1 2ZKNA 5ACA1 1VMJA 1CAWB 4Q4W2 3DYMA 4RGGA 1RIOA 4CDUA 3URFA 2D43A 1VIWB 2E32A 4ZU5A 3I3MA 1NLQA 2HWE2 4URTA 4EN8B 3IDCB 1ZRDA 1H4GA 4YW1A 4Y1VA 5FYHA 4A45A 4LXLA 4QM8A 5EJ1B 1UX7A 2HWD2 1S1AA 4P9IA 2Y26A 3ZXFA 3I3BA 1T6BX 4QHBA 5KHHA 3ZYIB 1B09A 2HINA 1CJPA 2B9VA 1IZ3A 3KVAA 4ZU4A 4XABA 5HXMA 1ASJ2 2R072 4XMAA 4B8EA 3EQEA 3VWSA 3OYWA 4HN0A 3PMEA 4DEQA 4X8PA 4E9KA 5JSPA 2JDMA 1UZWA 1PZ9A 2WA4A 2YC4A 3ZFFB 1TG7A 4HETA 5J1XA 4GWIA 4Q4Y2 1L1MA 3K46A 1JOJA 3A21A 1YIPA 5T52A 3A4UA 2XHKA 4Y26A 2E51A 5FLHA 4I02A 3VUOA 2D5VA 5FR3A 2ZX4A 1MVEA 2XONA 3CO2A 4AGRA 4BQ4A 4CPBA 1O4ZA 4CDWC 1IQAA 1T6GC 1L3JA 3B3QE 3DXUA 4QQOA 3WNXA 5KXBA 5K4LA 1ZZBA 3WF4A 4CEWA 4KG0A 2H6BA 2ZAAA 2Y6HA 1CGPA 2ID4A 3AP7A 4ATEA 1RUD3 4D7YA 5CFCB 1URXA 5KXEA 1X33A 1XYNA 1UU4A 3ALQA 4FPHA 5AVAA 4LKDA 2JDKA 5DG2A 3WEZA 2ZMKA 5C3PA 1GKBA 5FV3A 4XURA 4UF0B 4P9XA 1WLWA 3A23A 4EJRA 3IVPA 1W8NA 3FE5A 3GALA 3VBRB 4PU8A 2UYAA 3KLSA 4JDNA 4CDUB 1JU3A 3HBKA 2LYPA 4XJAA 1BK0A 2NP0A 4OFGA 4AE2A 5LEKA 2RDSA 3VD5A 3WF0A 4DRVA 1RUC2 2VBPA 1QPZA 1J1LA 1NCRB 1QXJA 2FJRA 2EICA 2R043 1WA4A 2RG4A 3WNKA 5B4XA 3ZYFA 1EYBA 1RUI1 4OLLA 1UNBA 5BV6A 1H8TA 1OXCA 1JHJA 1ULPA 1CAXA 1D0GA 1WMDA 2JG9B 4K6BA 4NMIA 5JIUA 2B42B 3HIFA 4XFFA 1F2NA 2WNOA 3HR9A 4FPKA 2J1EA 2CGOA 3DV8A 3OUHA 4DY5A 3GZUC 3MIBA 4B4PA 3J7NA 4GHJA 2YFZA 4NWWA 4D8MA 5FUNA 5T5LA 3BTZA 3O1PA 4YW4A 2Z69A 3NKGA 4HK8A 5FZAA 1COV1 1D4M2 5CYYA 2O0OA 1PX3A 1XE8A 1MS1A 4N43C 4MCTA 3MV11 1VBD3 1HRI2 5HCAA 2B5HA 2ZGNA 4XDOA 3IPVB 2WIIB 5E8AA 3VZNA 2J1SA 3IBMA 2XLAA 1V9U1 1AYM1 3V0AB 3UGGA 4OUMA 2PXDA 3KXAA 5FWJA 1W2NA 2D44A 2Q1ZB 3LWCA 4MUVA 4UW3A 1S0FA 5DRYA 2PN5A 1EAH3 3AKPA 3NV3A 4JGYA 4RS5C 1PO21 3KQRA 2PXUA 4DS0A 1IHMA 3DM5A 5T54A 1FPN1 1IS4A 3QLQA 4Q0QA 4NIAA 5IT6A 3CL1A 4IGPA 4Q1PA 1RVF1 3FHAA 5FZFA 4AI9A 4A7ZA 4LBQD 4C1WA 3TB0A 1DIWA 4MZUA 1UTXA 2CDOA 2D97A 4Q0VA 1JZ7A 1YQ8A 4FPJA 1OBNA 5FLJA 4BK5A 2ZZJA 1RUJ3 2BVVA 3VBSA 4KGQA 1J59A 2CGNA 2NMNA 2WC2A 1AL21 2UWAA 3ZFEB 3NXHA 1H8TB 3FN9A 3I2DA 1ST8A 3I3QA 4JCYA 5DUXA 1VR3A 4ISQA 4MADA 1PMIA 3CEWA 5IJRA 2R1JL 4GZ9A 2PXQA 4OUEA 2VZPA 3WCSA 2MEV1 3VZLA 4QXBA 2D6KA 1UY3A 2KEKA 2XUMA 5GM0A 5KXCA 1TME3 2AWIA 1OH3A 3H7JA 2ZOEB 3AKTA 2WL1A 1MVQA 1V6NA 5E1RA 3S30A 5DTQA 1BMV2 3FX3A 4XUNA 4FO9A 3I49A 4IEVA 3VB9A 2LYLA 1LKNA 2NN8A 3O1OA 2O4AA 1YI9A 2W5FA 4IW3A 4AQ6A 4EQVA 3BODA 4L9BA 1C1FA 2C26A 2WUSR 3ELNA 1UD1A 2NZ9A 3OBRA 1G6NA 3SH3A 5JZGB 3L2YA 3NNLA 5LW9A 3INAA 1VJ2A 3TRBA 5FZ4A 2HLEA 5CFCC 1R091 4GKYA 1Z7S3 2QCSB 4NRPA 4F83A 4H7MA 5I0TA 1OLRA 3F2ZA 4JGZB 4EN9B 4JGYB 3PDQA 3BI3A 3GZEA 1VBA2 4YGCA 3VBRC 2AENA 2BGPA 3NROA 1O5LA 2RR13 4BE3A 1WWYA 5J98B 4NAMA 3B01A 5FY5A 1POV0 4O9GA 4WV8A 2ZEYA 4YW6A 3M3EA 3AMMA 2XL7A 2IVGA 2IWGB 1LODA 2ZAHA 3O1TA 3OPWA 4N53A 1NCRC 1VRH2 3POBA 1UXCA 3OQNA 5JOZA 1QJY3 2XVGA 1ZNPA 3M3IA 1Y9QA 2MPFA 5CADA 5CKQA 1LGBA 2VTFA 2JG9C 2PUEA 3OY8A 3LDRA 4MGQA 4MXWA 4Z2AA 4R9AA 5ABJB 3LA3A 2RS52 1ZRCA 2W1UA 4DOUA 2PFWA 3BALA 3OP9A 4TWTA 4XF4A 1PK6B 5JOYA 2A6ZA 4PT6A 4GWJA 5FMCA 1WW5A 5KR7A 2A71A 3ZXAC 4YZ1A 2VGDA 1MEC3 4IL7A 4FFFA 4R9CA 5KHKA 2QQUA 3O7OA 3ZX7A 2WAOA 1VBB2 5BNNB 2OPKA 1EV11 2B45X 2E7QA 1SACA 4ER5A 5A3LA 2ZX3A 3EYPA 3AP4A 2VE1A 4YVWB 4ITCA 1W8HA 1YQ6A 1ND3A 5BNPA 1H2LA 1GP4A 2G4IA 3GZTB 2RM21 5I0SA 2D3SA 4XYXA 1HRV1 1HX6A 2R49A 2CV6A 1PGW1 2VUDA 2QZ3A 1U5ZA 4M4RA 4CSWA 1OSLA 1S4CA 2MEZA 1MZ6A 4UXAA 2E53A 2LNMA 4AAPA 1C8M3 2VXRA 4E8CA 1POV3 1AYN1 1HB1A 1HJGA 1Q5OA 2VMIA 1SLTA 1GZ9A 1JOBA 4Q4V3 4X6QB 2J1VA 3IM0A 2YBSA 1UWWA 2YBPA 2QQKA 3ACGA 5C5TA 1YLLA 3ZPXA 1XNDA 2E6VA 4Q4W1 2Q8CA 3HT2A 2ZS6B 4QQPA 4D6QA 2BYVE 2Q30A 5T5PA 3ZFEC 2IVQA 2GNTA 1F8VA 2PELA 3L2HA 1CJGA 4LO7A 3JB8A 3CNAA 1MPXA 1I1EA 1YRZA 5APAA 1AR63 1MQTB 2GU9A 5LBEA 3Q9OA 3HBZA 3A22A 4P9LA 1K5JA 1PRVA 5C3SA 4XE9A 2XI8A 4YW5A 5GZFA 3W21A 1ULFA 1UN1A 1QEXA 4X4DA 3WSOA 4A7YA 1C5HA 2YC2A 2FQPA 2W39A 5GZCA 3AMHA 5LK7B 2Y6KA 1ASJ1 4HN1A 3EJKA 2OQ6A 3OEBA 4Z8BA 3WLUA 5DTMA 2JEMA 1R1A3 5A1AA 5BNOA 1ZZ6A 1DGWX 3GBGA 2WT2A 5GLUA 3SMHA 4E2GA 3C7FA 1LHWA 5JZGC 1ND3B 3EBRA 5BNPB 2FD8A 1XU2A 5C8WA 1L7RA 3VKLA 1W28A 1VAMA 2F17A 2I07B 3NJXA 2VR4A 4FVVA 4JGZC 1DGWA 3VHRA 5FZOB 3HOBA 4CVUA 3O9XA 1PM4A 3SQOA 4XFGA 4BYYA 4CCLA 4IXLA 3SNMA 5FZGA 2PLV2 1OI6A 1OMIA 2XBO3 2MXDA 5FPAA 2RS31 4PLNA 4QHOA 2AEYA 1LNSA 3T2OA 2ZGSA 5A7PA 3H8RA 3RYRA 1CZTA 1PVC3 4K40A 1UCXA 2GDFA 2VMFA 4KWUA 5CU1A 3ZMOA 4HOOA 1Q43A 1LB2A 3JQWA 3OTFA 2BERA 4CYDA 4COYA 5F3CA 3MFAA 3N9NA 4Z07A 2O8OA 5FY1A 5ABJC 1QJU3 3OWQA 1O4XA 2W92A 3LF7A 4DUXA 3R4DB 4N7IA 2SLIA 3W5MA 3I8TA 1GQHA 1QH6A 4LHLA 1O5UA 4MGSA 4MXVA 4BPZA 1PK6C 3MLKA 4S2FA 1LOAA 4WBBA 4CCEA 4NPRA 3KCXA 4CUBA 1NY71 2P4EA 3ZHMA 2JDNA 1MZEA 1W9FA 1GOFA 2IUWA 5D21A 2DVFA 2XR4A 1K5MA 3IWZA 2WZEA 3J7LA 3J9SA 4HMZA 3IB3A 1G9BA 3O0WA 5FK7A 2FFHA 3FZ3A 1OVSA 4PF1A 3U11A 3VHNA 2VTXJ 2W87A 3PIGA 3H42B 3RWKX 4AXOA 5BNNC 1CWPA 5A3OA 5EYXA 1IPKA 2OT7A 2V09A 1UY0A 4FPCA 1QOTA 1IC8A 2BJSA 4KQ7A 1N1TA 2D6OX 4BB3A 3WT3A 5F6KA 5I0DA 1D4M1 3JCIA 3JQXA 4IE6A 4YW7A 4YVWC 2HWC2 3MV01 3TN93 2VECA 4CCKA 4GB31 4QQLA 2ARCA 2D40A 5LA1A 4DB5A 2YDEA 2W94A 5J37A 2P3IA 4N9HA 3ZXKA 4QGNA 4L99A 2YFUA 2H8RA 4X4EA 2VZUA 1WD3A 4IERA 4PIXA 2V5DA 4YM0A 2WUHA 4ZS2A 2YG0A 3VBOC 1RUG3 3VKFC 4A3XA 4JDMA 1RUE3 4HVQA 1JH5A 5FDBA 1ZA4A 3LIHA 1AVBA 3MIGA 4AEDA 2K0GA 4IE5A 4YM2A 1WBFA 1OF4A 1Z0HA 2BFUL 3D3AA 4BQYA 5EWSA 4P14A 1LHNA 1HW5A 2BZDA 3LZZA 2IXJA 4I2OA 1ENSA 3UL2A 1EAH2 1X9PA 3PXPA 2GP5A 2TBVA 5FCCA 3CU7A 3GJAA 2ZPXA 4D6SA 3VHOA 1REDA 1AF9A 3ACHA 4NR1A 3ZYGA 4Z5CA 4AFCA 2QUOA 5A70A 1OH4A 5I91A 1F5JA 1XNCA 4JTOA 2R16A 1MQTC 5FZKA 2DWRA 2W3JA 4B7EA 1ND2B 1ODNA 4RQPB 4FPLA 4FBFA 1OFSA 1RUJ2 5DAVA 4AR2A 4A7KA 5JAXA 4JQTA 3THTA 1LGNA 4JRAA 3WG3A 2E26A 1ZRRA 3H8XA 4NHMA 4PBPA 2QQVA 3WW2A 3QFIA 3JBG3 1JZ4A 1RHI3 2WQ4A 3C2UA 5IWFA 4YM3A 3E5QA 4Y24A 4I30A 3SX0A 1PGL2 1WCKA 1DYPA 4HT1T 3ZFGB 4CDXA 1BMV1 3OBTA 1TNFA 3SCHA 4LBJA 2IC1A 5T55A 4LBQB 2DUPA 5FYBA 2R63A 2ZX1A 5KHJA 5F32A 3LOIA 3TEPA 3KV6A 4X4BA 2PQSA 3N9QA 1Z78A 3POEA 3T1LA 3W59A 1N1VA 2VMCA 5FZ7A 1CQ9A 1VBE1 1YQ2A 3CQOA 4MGZE 5LY1A 2PHDA 2LCVA 2ET7A 2YPDA 2ZZQA 3ZKUA 2NM1A 5IAVA 2QDNA 3GF6A 4R8HA 2VPVA 2IV1A 5F9TA 3KVBA 2A6XA 3ZXGA 3T2QA 1ZREA 3U37A 5GKAC 2YU2A 1MS3A 4JC1A 4COZA 2X05A 5GAHi 1WA6X 4IUGA 4DMIA 4ET7A 3VBFB 2YC0A 2VOTA 1Z7S2 3G6JB 3ZYJB 3VKMA 3TEYA 2JX9A 2G9GA 3TEZA 4Q0SA 5DUUA 2ZEXA 4NROA 3M7AA 3J8F3 4R4XA 2PUCA 4UOJA 3T2TA 1S2KA 3OD4A 3QH6A 1NX9A 2ZA9A 3BD1A 4XJ9A 3KF3A 2QVSB 4AVVA 1PM7A 4BXSV 2RR12 4PCRA 5I8TA 2B7YA 5D2AA 4I6TA 3LA7A 5FZDA 4LBOA 1N1YA 5LRRA 4TXWA 1WLCA 1PNRA 2TNFA 2R061 1U2ZA 2CAVA 3GM8A 5HV0A 1YYNA 2OS2A 5GLWA 4EWEA 2XJRA 1CONA 2RE9A 2RS51 5LA9A 1W90A 1MS8A 3VN4A 5HPOA 1W9WA 4GMP1 4HFSA 2J7WA 4XACA 3MO4A 3KV5A 4V2VA 3CLPA 1E5RA 2P37A 4Y1YA 2LYQA 1KFXL 4AQ2A 1B0NA 2XDVA 4CDWA 2ZX2A 3FUQA 4XJZA 2ZABA 3LEKA 1W6QA 5JMCA 3R6SA 5JR7B 3WNLA 4EWDA 2G1MA 2IFWA 3DGTA 4U36A 2EF6A 2VMDA 4JKKA 4GJZA 1UZYA 5FYUA 3MW2A 2FCVA 1LTEA 4ZY9A 4AOCA 4OZOA 2QTWB 3NVCA 1VBB1 2HWF3 5BNQA 4RL7A 1MEC2 3VZJA 2ZHKA 2XSDC 5L9RA 3SCGA 1C57A 3VZKA 1IS6A 4GALA 1LHVA 3BCWA 3LQCA 5FP4A 3N9MA 5FMDA 2SBAA 4Q2JA 3T0AA 1KS5A 1W39A 2HH9A 4QX7A 1KRIA 4FP2A 3WDXA 3AB0A 5M0TA 1FT9A 4E4ZA 2ADEA 1RUF3 1O59A 2LS6A 1QHDA 4HPKB 3AC0A 2IXLA 1VE0A 2QKDA 3HT1A 4BK4A 2WWSA 3NNGA 1NW3A 1RMU3 5CA6A 2PHWA 3I97A 1FOD1 2IXHA 2LROA 3WW1A 1PMJX 2QFEA 2QQJA 1YO8A 3MIFA 3OUIA 4ATFA 3UJOA 5FXWA 3IDBB 2JG8B 2WAAA 2WN3A 1MACA 1DCSA 1B35C 3OMTA 3TRSB 3WP5A 1D4VB 4E2QA 5AC93 4NHYA 3WVJA 2D7FA 1MFQC 3AZWA 2LLWA 4YPJA 2RMU1 4ER6A 3NWKA 3OG2A 5B4NA 3LQXA 3UT0A 2ZEWA 4Q4V2 1ND2C 4FTBA 4YBAA 3I4IA 4QKNA 4RQPC 3GNEA 5EP9A 1BVP1 1SLAA 1TMF2 2EXIA 2GALA 5FUIA 4BXFA 3A0KA 3SLIA 2XWJB 3CKHA 3QF3A 2C1FA 2VQUA 5BXXA 4AQTA 1VAKA 1JODA 3A9XA 1NLRA 1FAYA 1O3RA 4NHXA 5A3PA 2DURA 4GULA 3LA2A 4WVMB 3UWPA 1W6QB 2WO3A 1K45A 1NT0A 4QPIB 3VLBB 3WUCA 4EZ4A 4ZU7A 1X8MA 1AR62 3ZFGC 2EIBA 1HQ1A 2NQYA 3CECA 5C3QA 1RUOA 3W58A 3QQ6A 3B00A 3WQ1A 1LESA 3JU9A 1AJKA 3PTYA 1LCLA 4RS5A 4DINB 1AR73 2MNGA 5C9AC 1R64A 1GNYA 2J42A 1NCQB 5FRAA 2JXAA 2WSUA 1WGPA 2WT0A 1H0BA 4Q5OA 1VAVA 4XFHA 4XUTA 1CAWA 3IMMA 3Q8FA 3QOXA 4R52A 1R1A2 1VB2A 3AZYA 2W9XA 2LM3A 1BQPA 4QKBA 3UGHA 4F8DA 2WFF2 3CLCA 1CD3G 1FYUA 1ZYBA 1LOFC 3LAGA 1VLNA 2O38A 1MS9A 2CTVA 5HCFA 5IUQA 1RXFA 1J84A 2P3KA 5JPNB 4PJYA 3FYAA 3VBFC 4YW3A 1OOPB 4QX5A 5L7OB 3TEWA 5F37A 4IEPA 3H1MA 2DU1A 4NAOA 2WLPA 4OQ8A 2A5ZA 2BNMA 1LOGA 2PLV1 4OULA 3AL6A 3MFCA 1J3QA 4UW6A 3GUUA 1Q8SA 3FBMA 1HN1A 2VCCA 4MYEA 3VDDC 1O7FA 3GN5B 2FZ1A 2Q5TA 4P9JA 4YGDA 5L73A 2YROA 1V0AA 4I01A 2OUHA 3SEEA 4BLJA 2D5FA 5T5OA 5F7UA 2CROA 2A6CA 5HCBA 5SV5A 3AMNA 4DRRA 3E5UA 5IVVA 3Q8CA 4EZIA 2W2IA 2L49A 4NIIA 3RZKA 1CZVA 1SQ4A 5JUWA 1S0EA 1QJU2 1JU4A 3K3OA 3AVRA 2WS93 4RFRB 4ZONA 1UAIA 4CP0A 4BJ0A 1JBCA 2PAMA 4KBZA 1O8PA 2RJ2A 4QXKA 1G86A 3WUDA 5A6YA 2WA3A 3R1FA 2GNDA 5FMOS 4BIOA 5CFCA 1SLBA 2D6MA 4BMEA 3RZLA 2W1SA 4EN6B 4Z2WA 4KGGA 5BUVA 4A3ZA 4E27A 4IV1A 2HFZA 3I2GA 4YG3A 4C0BA 3KCCA 1RITA 1VBC3 3L1PA 4UF0A 1ZRIA 3AZVA 5GZGA 2K2SA 4Z92B 4LIVA 3BIEA 2HWC1 1F9KA 4AVAA 3VBRA 2HCNA 4NIGA 4P02B 3LSDA 1CX1A 2JD4A 4ES9A 2QBXA 3WQ0A 4Q8KA 5CVRA 2JECA 3NAPB 4IE7A 1PGSA 3NJYA 2DTYA 4UFMA 2DCYA 2E7TA 5LB6A 1NCRA 3MHZA 2KPJA 4RR3B 4GIQA 3ZXDA 4W65A 5KC6A 2R0FA 2Y8KA 1W6OB 2GC2A 4FP3A 4QDRA 1H9PA 3BS3A 2JICA 2VCAA 1UO9A 4FFIA 3V0BB 2JG9A 1QJX2 2JG8C 1W8ZA 4BQ5A 2XOMA 1RUE2 1LEMA 5IVEA 1KD7A 4RHV1 1F4HA 2AREA 2XGXA 2BW8A 1KFUL 1U5XA 4RFT0 1YQCA 2WZR3 4WZFA 5F8PA 4GJYA 4HG6B 3AXEA 4J6GA 5JLVA 2JDUA 2VVEA 4HZFA 3M9LA 3AX4A 3BIWE 5E88A 4DXSA 1POQA 1DQ2A 5H9SA 3OCPA 4QGLA 2ET1A 4D7TA 4CZSA 4GQ7A 2PXTA 2KM2A 4YG0A 4QPIC 4Q0UA 1UZZA 5F5AA 3IPVA 4RA0A 3RI9A 5F3GA 4TLFA 2XG3A 3BU7A 3WHTA 5J3UA 3V0AA 3O1MA 2PUAA 3E5XA 5LASA 3BTXA 3VDAA 3ZDVA 4LBNA 1HLCA 4XFBA 2YXSA 5A7WB 1ZX5A 1QNWA 4IV1B 2C9KA 2P17A 4W4ZA 1PGL1 3WDVA 1ADRA 1NCQC 2ZMNA 2CWSA 4FXGB 4CUAA 2BGOA 1J3RA 3JBG2 4CCJA 1RHI2 5GZEA 4CDQB 4E4SA 3RZHA 3EMRA 4B29A 1CIWA 2RHPA 2F4LA 2XUEA 2WDBA 4CE8A 4LO8A 1WW7A 2DBIA 5LEJA 4X8NA 3NZLA 4HRAA 3IKWA 2A73B 2XPJA 1OPOA 1AHSA 1YIFA 1OA2A 1OOPC 4Y20B 5L7OC 2DFCA 4AG4A 4QQ2A 3WR0A 4JHTA 3ZFEA 2OPWA 5DG1A 3U4SA 2ORZA 4D69A 1JUHA 5A1LA 5D8AB 1Z7S1 2D6NA 4CU9A 3FLRA 5EV7A 2R1BA 2VUAA 3E6BA 3VL8A 2EF8A 1OC1A 2VEOA 1WBLA 2GH8A 3ILFA 2R30A 1RUH3 4BQ1A 3AZXA 1W6NA 4FQZA 1HXS3 3N4MA 1DQ1A 1DZQA 3WDTA 1PIV3 2EAKA 4MVTA 2BRTA 4IGOA 3HQRA 2Q8EA 3T09A 4LBKA 1PRUA 1CAUA 1G7YA 1H30A 4DO0A 2GRLA 2RR11 3GCWA 3JD73 3J8F2 2VOKA 3WHUA 3FMGA 1DF0A 3KGZA 1DG6A 1XNBA 4ZPIA 1JWLA 1UXZA 2VMHA 2WN2A 2XJPA 3VZOA 4HBNA 1W6MA 4BZ4A 1XJAA 1NERA 4B4RA 4ARXA 1RZSA 3GBFA 5JZGA 1Q3EA
chains in the Genus database with same CATH topology
3ES4A 1BEV1 2DVDA 1DQ5A 1ZBE3 3VZMA 1PZ8A 2GZUA 1QXPA 2OA2A 1W6PB 1GYKA 4JGZA 4LO4B 1C4RA 2VU9A 1SFNA 1Y3TA 2OZJA 4D7SA 2H0BA 2OFYA 1MEC1 3HMYA 1IKPA 4M3CA 3NAPC 1U12A 3M70A 5DDJ1 4IEUA 2UY9A 2I74A 1FI2A 2HWF2 2KEJA 2FMYA 2GZWA 1DGRA 1JH9A 3ZVXA 4RR3C 1DGLA 4YGEA 1ZRFA 5J7MA 4MV2A 4Q4X1 2XJ3A 4K1YA 3F51A 5KHIA 5H9RA 2EWTA 3HQXA 5ABJA 2AGSA 3DPRB 2GMEA 1RUF2 1W6NB 4RGAA 1PK6A 4WM8A 5FO8B 4J1WA 4P9GA 3H7YA 1CAUB 3S0MA 1PZ7A 3FFQA 3PNAA 1QOSA 3WXPA 3D6EA 1POV1 4ISRA 1APNA 2QQPA 2D6PA 4JTNA 1W6MB 5BY5A 4Q4V1 5BNNA 2CGPA 3SHRA 3UK9A 3S6PA 4LULA 2YUEA 3HN1A 1TMF1 5K7PA 4AGGA 4YFZA 2BQPA 4YVWA 2AW6A 2HWB2 2VG9A 3FLPA 3LKJA 2GN7A 3WZ1A 1LMB3 5T5JA 4IV1C 4K20A 1PO11 3QWGA 1AR61 1AR83 3VBOA 2YMZA 4LLOA 3USUB 1PERL 3RDIA 1OCTC 2BBVA 4CDQC 3OPZA 2PHRA 1HV1A 4IETA 1YNAA 1ULDA 4M3CB 1ONAA 1RUI3 1MS5A 3EXUA 4K9SA 3D1NI 4FPYA 3UKNA 4LTAA 1AR72 1R081 4AI1A 5I93A 2WNUC 2B5AA 4PIZA 2WFF1 2XKPA 3I54A 1HDKA 1X82A 2O49A 2VW2A 4XETA 2WFPA 5D8AC 1XRUA 2Y0OA 1COV3 2B39A 4XXPA 4YZ5A 1MQTA 1RL3A 3FFZA 3M3OA 4WM8B 1QQP3 4B4QA 4JRLA 3RPQA 2HJIA 5CB7A 1CN1A 5KC5A 1W0PA 4NDWA 4AF9A 1S0GA 2PAKA 4IEXA 3DUIA 3SXWA 4YGBA 1V9U3 1AYM3 4OHXA 5I8YA 3RMXA 5IK7A 1MR5A 2PUGA 1F5FA 2BGCA 4ASLA 2YZ4A 3VHPA 1S2BA 1RJ8A 4QT6A 1PO23 1HKDA 2JVLA 4OHYA 1FPN3 4DPNA 3MW4A 4XJ8A 2DVGA 2VMGA 2Q1MA 4PBOA 1O3QA 1RVF3 2HEWF 2OUJA 4H3WA 1X57A 3KT7A 3VBOB 1X8EA 1JFTA 1C1LA 1N47A 1BVVA 4DY3A 1OD5A 1FMD1 3SH5A 1FXZA 2PTMA 2WS92 1AL23 3UKTA 1DBNA 4YG1A 4Y4YA 1IKQA 1LR5A 4X4GA 1XYOA 2JENA 2PHTA 5JSOA 2VNRA 4GH4B 1EPWA 3VBHA 4Z1VA 5JDBA 1EPZA 1RZRD 2CAUA 2YPJA 3DF0A 2WNEA 1VBC2 1X50A 1OQDA 2HWE1 4IVZA 1ZM1A 5K0UB 5JVVA 2YV8A 1XWRA 4AYUA 5HI0A 5K9YA 2QE3A 3EUSA 1GR3A 5FREA 2BFUS 3DPRC 5GLTA 3KJXA 1C5IA 2AUYA 2WT1A 3N7KA 4XIOA 5FTTC 2DTWA 3HD8B 2HWD1 1CPMA 1QJX1 4ORFA 3QCWA 3CJIB 3J26N 3MEPA 5IK8A 3RS6A 2YGLA 2R071 1BKZA 2BUKA 1AX2A 4I3PA 3MIHA 3WY6A 1R093 3WP6A 4AHZA 4Q4Y1 4IEOA 4MLOA 3O0VA 2B9UA 2GSYA 1YJLA 2E63A 4MGYE 4FOYA 1BZWA 4KG8A 2C9AA 2YY1A 4ZXKA 5A32B 1YHFA 2WZR2 2Y0IA 5K98B 4AVTA 1IPJA 2X53S 1RC6A 2Z79A 4I0WB 1ZPQA 1I9RA 3MDPA 1YWKA 3AYAA 5FO9B 5CBLA 1V6JA 4AGVA 2V5YA 2EIGA 3DKWA 5JIAA 4AFMA 1H4HA 2GAUA 1UX6A 2JCGA 4HANA 4XQDA 4FQ4A 3EO6A 1RUD2 3X29B 4GKXA 3VBHB 3JBG1 2OW4A 3O0XA 3QH7A 4YW3A 3PVEA 3PMSA 1OA4A 1RTVA 2K9ZA 1LULA 3ILNA 3NW4A 3FJSA 3GZAA 3POWA 4CEYB 1B35A 1A8MA 3ME2A 2HSGA 1RUC1 3ZMNA 3MW3A 2PHFA 2DYCA 1O4TA 4H7LA 4WM8C 4WZCA 1ND2A 1MZ5A 4RQPA 1UIKA 2R042 5I8SA 4R4ZA 1A8DA 1WETA 2R32A 3B93A 3MI8A 1NOVA 1GZWB 2JDZA 2JJ6A 1JW6A 1ULCA 2NYYA 2NPIA 3S8QA 4Y22A 4YM1A 2UURA 1KXGA 3ZIWA 1NEQA 2VY0A 2FBEA 3ZFGA 4SBVA 2PUBA 4XQWA 4OB4A 5CNAA 3S7EA 2X29A 4K8FA 1RUH2 3B7HA 1HXS2 4LBQA 1HRI1 1PIV2 4OI4A 4PDWC 3WINE 4XXAA 4XJUA 4IEWA 2ICPA 5C9AA 4UW4A 1AYN3 5J09A 2E9QA 2ZCWA 1C8NA 4E2SA 1VBD2 3TWIA 1RJ7A 3MYXA 3SISA 4L92A 4XQ4A 3ZN6A 1LOFA 2CY6A 1ZBE2 3H5TA 1A78A 2OYZA 3VBFA 1HQWA 3BTAA 4GH4C 4IEZA 2RS13 5FFOC 3VKNA 1QQBA 1NXD1 1BDIA 1REFA 3L9JT 4I0BA 1B35B 1H8VA 2EALA 3M3CA 3ZYRA 1ENXA 4AHYA 5K0UC 2X8KA 1FX5A 5LRSA 3VDDA 3A0NA 2VH9A 3EHKA 1ASJ3 1YFXA 4QPYA 5IK5A 4INDA 4MH0E 2CYFA 2NMOA 2F4PA 1LENA 4F7ZA 4UBHA 1SCRA 4FPGA 1NLSA 2BJCA 3CJIC 3WV6A 1UMZA 4Y22B 2FMDA 3MF6A 3VBUC 1TE1B 1X36A 3MZHA 2L8NA 4YZ3A 3LISA 1KDMA 5EZWA 5FAXA 1WLDA 3ETQA 3QYXA 4F3JA 4X6RB 2A7AA 2W0XA 1JFSA 3TYJA 4Z5DA 5A33B 1TME2 3AXDA 4FBIA 3U07A 5FOJB 1J1TA 1WW4A 1XQNA 5C9AB 1YSEA 2RS33 1QMJA 1SLCA 2XB6C 3E97A 2HWB1 3KT1A 2VW1A 3VL9A 1QKQA 1FATA 4QPGC 3ZN6B 4YARA 3JXDL 4HPKA 3KS7A 4COVA 1QY4A 1H2MA 4OI2A 1H1MA 2JE7A 4OHWA 5A3MA 1JTZX 1VBA1 5JOXA 3VBHC 1UKRA 4X4HA 1PVXA 4LEJA 4YVSA 5C4WB 1PRAA 4Q27A 4F8AA 4NWVA 4S2GA 1LGCA 1AR82 2D93A 4FOQA 2JG8A 3AFGA 2Q4SA 4CEYC 3RI8A 3LCPA 4N7UA 3VDDB 4L2NA 1AR93 1VRH1 2ZGQA 4MSVA 1AUYA 3RG0A 4L11A 1AR71 1JHNA 3IMNA 2FHRA 3E6DA 3FLTA 4P9WA 3R0RA 2ZGMA 4M0HA 1QJY2 3FYMA 4X4IA 1UXDA 2GNBA 1D4M3 2XLFA 3U10A 3MIEA 4IV3B 2UWBA 4Y5Z0 3RJRA 4W6WA 4GB33 4IEYA 1VALA 4WVMA 4BOWA 1LU2A 3KD4A 4QPIA 3TAYA 2X5IB 1DU3D 2EA7A 5I0UA 3LFPA 1QQP2 4XF9A 2CWMA 1RINA 2LALA 1R69A 2CNAA 5KBFA 2ARXA 4E4DX 1NE4A 4KWLA 4I0AA 3VV1A 4KL1A 2KZ8A 1AYM2 1BBT3 1GZCA 1NCQA 1U5IA 1RZRA 2O8QA 5SV8A 1X2LA 3MLJA 2HEYF 2ZGOA 3DN7A 1FV3A 2XKOA 1ULGA 3LB9A 5FO7B 5AFBA 1PO22 3V65A 4AEKA 3VKOA 1ZZ7A 3AP6A 3PLQA 1DHKB 2DU0A 1OOPA 5L7OA 4YVSB 5FLIA 3D5OA 1I6XA 5C8CC 1G9CA 2QNKA 1S7EA 2YHJA 3N7JA 4YNIA 2PHXA 5C6CA 1C8M2 2A3WA 5HBAA 3TNPB 1DWKA 1WMEA 1OHFA 1AL22 3GN5A 1BYHA 4LA3A 1V6MA 4XILA 3JB4C 4A2UA 2IUOA 1XXNA 2XJTA 2LTNA 2P34A 3ZDSA 1UF2C 4KWJA 5E89A 4AK3A 4K7JA 4EN7B 4Z58A 1S0DA 2GN3A 2A3XA 4XF0A 2ZHLA 2XIUA 4YSFA 1VBE3 2VNGA 2AZ5A 5KWRA 2ZGUA 1QXRA 2D6LX 1ALYA 1QF3A 4XFAA 4H14A 3DNVB 4LBMA 4XHXA 1REEA 3NV2A 1AJOA 3D0SA 1AZDA 1QWRA 4HKWA 4Y1XA 3IT8A 3ENRA 1Q56A 3HWJA 3POSA 1R092 3ZN4A 1YJKA 5DUVA 4META 2WSVA 3AJZA 3NAPA 3TOJA 2XCJA 1WUVA 5EYYA 2XH6A 4PU7A 1NYWA 5JCTA 4RR3A 1N1SA 4MX3A 1ZBA3 5HCBA 2VOVA 1W6OA 2DCJA 2DUOA 5C4WC 2Y38A 4XOGA 3FHIB 3THPA 1V6IA 3V0BA 1CR7A 2DCKA 1RUD1 2R063 3E6CC 4HL0A 1WH6A 2JE9A 4AWDA 1BJQA 1KITA 1VP6A 2XBO2 2ZGKA 3OGJA 2A6YA 1OKQA 4GMP3 2D98A 2VQ0A 3N35A 4Q1RA 4QM9A 3FUOA 4BH9A 4Y1UA 3UFDA 1PVC2 1ZVFA 4CRQA 3ECQA 1J58A 1I5ZA 2KEIA 3AP9A 2LYRA 4IV3C 4KU8A 5DZEA 4ONUA 3B94A 2NLRA 3RYKA 2WLQA 3WG2A 4X4FA 4TYSA 4XFIA 2R041 2X5IC 1CVNA 3NSTA 4JAAA 1HV0A 4BCUA 2LYJA 2AXVA 4J1XA 3FC0A 1CESA 4YZ4A 1D2QA 1AXZA 1GANA 3PVNA 1D2SA 4JV4A 1QP0A 1S0JA 1E57A 3B69A 3ZSLA 4IEQA 1RUH1 1HXS1 1O91A 2ZACA 3D82A 4CDQA 4M0NA 1FOD3 1QNYA 4AEJA 1CJDA 4KWKA 2ZKLA 1DQ4A 4W6YA 3TN92 4BM8A 1JXNA 1ZS4A 1GBGA 1O3TA 1XNKA 1VBD1 1D0HA 2XWBB 2VVDA 2MQKA 4Y20A 2RMU3 4YVSC 1AYN2 2GRMA 2WNUA 5FQ0B 4YLZA 1Y43B 2ZBJA 4Z82A 2XL9A 1RUG2 1NG0A 1CAVA 3RYPA 3BDNA 3NL1A 5D8AA 5EXOA 1LHUA 5I0RA 1EAH1 1PHMA 2W68A 4FT8A 3ZSEA 2RS12 3M8LA 1RUNA 2XVKA 4M00A 1YFUA 1KS4A 2R0HA 3ZSKA 1WCSA 4HK9A 1H2NA 2GC1A 3TBDA 3WG1A 1N3PA 1RUJ1 1WCDJ 4LBLA 1N3QA 2P2KA 3ACLA 3F52A 1FNYA 1C28A 1OLQA 4RD7A 4E9KA 1QP7A 2EBYA 1BK1A 4DNYA 5DXDA 1W6PA 4OUSA 3H1WA 4PLOA 2C0ZA 3I59B 2AXZA 2PE5A 5CG8A 1TME1 4HKOA 2BNOA 3K51A 3OF1A 1EP0A 2PLV3 3U4XA 2IZWA 4AI0A 3AK0A 5F1RA 1YFWA 3AZZA 5FPXA 4R9BA 3ST7A 3WX5A 1NQJA 3KSCA 2ERFA 2WNUB 1AX0A 2RS32 3B5LB 1DGRN 3NKTA 5CFDB 3UV9A 1CAVB 5J48A 1QP4A 1NQDA 3AYCA 3M3QA 3RWNA 5JSRA 1UPIA 3DPRA 2ZGLA 1AXYA 3MGUA 3ZSJA 2AUWA 1VB4A 1SBFA 1DQ0A 4XZPA 1ZZ9A 1UPSA 1H1IA 1AR81 2WNVC 3AKSA 5GALA