1ZZ9A

Crystal structure of feii hppe
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
192
Chain Sequence
TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKEPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxypropylphosphonic Acid Epoxidase
publication title Structural insight into antibiotic fosfomycin biosynthesis by a mononuclear iron enzyme
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Oxidoreductase
total genus 44
structure length 192
sequence length 193
chains with identical sequence B, C
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1zz9A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zz9A02
2LYSA 1J3RA 4LULA 4IEYA 2BNOA 3RYPA 1ZZ9A 4KWKA 3R6SA 4FT8A 1GQGA 2KZ8A 2BNMA 4BHPA 3FYMA 3GYDA 2H0VA 4EWDA 4I3PA 1RL3A 3QQ6A 1JFTA 4XETA 4YG1A 3OGJA 4Z5DA 2GZWA 3KCCA 4X4EA 1ZZCA 1XWRA 4UBGA 3ST7A 4MCTA 1DZRA 2XLFA 2O1QA 2Q1ZB 2V09A 3MYXA 3UKTA 1ZZBA 4PIXA 3E6BA 1LQCA 3IBMA 4XEZA 1XE7A 4J1XA 5FCCA 1IC8A 3FHIB 1S7EA 1ZNPA 2ZCWA 2XL9A 4WBBA 2OPKA 4XF0A 1UW8A 1CAXB 2PUCA 3NJZA 3S0MA 1ZZ8A 3IWZA 2LYKA 3M70A 2OYZA 4ORFA 3UKVA 5LRRA 2VQAA 2GU9A 1OFNA 1Q43A 4HVRA 3FX3A 1CAXA 4OB4A 1PNRA 3RNSA 4O8BA 1I5ZA 1DWKA 3ZHMA 2PHDA 4HSLA 2GZUA 1J3QA 2EWTA 3GN5A 1UIKA 2PE5A 3CEWA 2XLGA 3FJSA 3IDBB 2LYQA 3OF1A 1O3TA 1RIOA 4HN0A 4KU7A 1B0NA 1NE6A 5T3NA 1ZX5A 2GRMA 3MLFA 1O3QA 1RUOA 3SCHA 4GULA 4IETA 4LUKA 2ET1A 4HMZA 4X4HA 2OZJA 5HI0A 2UY8A 3OTFA 2WFPA 2HSGA 2B9UA 2Y0OA 1RTVA 2ICPA 3S7IA 4I2OA 4QGNA 3RZZA 4AVBA 3RPQA 3RYRA 1WH8A 1ZZ6A 1PRVA 2D93A 1BDHA 1WGPA 5FLIA 3IVPA 4B29A 3ACLA 4PU7A 4IVZA 1Y9QA 4Q0UA 4AXOA 4O9GA 1LKNA 4F8AA 1AU7A 3E6CC 1OSLA 1DZTA 4Q0QA 4FAHA 3B02A 2OR1L 5KHGA 2D40A 1XE8A 4IEXA 3L2HA 5JR7B 4YG7B 1QY4A 3TNPB 5I93A 3FMYA 5K98B 3HIFA 4KWLA 3OQOA 3MDPA 3VK0A 1QQAA 1VP6A 1R69A 4X4CA 3MZHA 3NSTA 3R1FA 3CL1A 4QM8A 4IEWA 4AVAA 2IXJA 4I01A 4QM9A 1ZVFA 1CJGA 1QP0A 1ZRRA 2PUGA 3IIAA 2LYJA 4DINB 1QP7A 4HN1A 5KHHA 4PU8A 2LYLA 4Z82A 2FQPA 4HZFA 3JXCL 1WH6A 3F6WA 3GBFA 2C0ZA 4Z58A 3WW2A 4LA3A 1L3JA 2IVGA 2PUFA 2XGXA 4YYOA 3LA7A 1RC6A 1SQ8A 1FI2A 1X7NA 2DCTA 3U11A 4EROA 2ZKLA 1WIZA 3U3WA 3KMHA 2PIJA 2OA2A 3WW4A 3H7YA 1NYWA 2KEKA 3OCPA 4MGKE 4YNIA 3NVCA 1UIJA 4X6QB 2AWIA 4MZUA 2KEJA 2CAUA 3EQEA 5I91A 3FYAA 3G5GA 2GRLA 2CV6A 3KZ3A 5I0UA 1Y3TA 4I6TA 2PTMA 1SEFA 2Z2SB 4PIYA 5FDBA 3JZVA 1UXDA 4JCXA 3LA2A 1NERA 1V70A 3DV8A 3I59A 2HINA 3IDCB 1X82A 2WIUB 4XFAA 1RGSA 3H1YA 3QWGA 1PMIA 4QXKA 1X57A 3ES4A 4FBIA 4PIZA 3NKTA 3C3VA 4D7TA 4AQ2A 2ET7A 1LR5A 1IPKA 4IEZA 4X4BA 2VECA 4GQMA 2PUEA 5I8SA 1ZRCA 1WLTA 2XIUA 1EY2A 3H3ZA 3LOIA 1ZRFA 2K9ZA 1GQHA 4XFHA 4HVOA 4XF3A 1ZAYA 4L11A 2L49A 1LRHA 4HLTA 3OQMA 4IEUA 2MEZA 5KBFA 5I8TA 2BNNA 3CF6E 5D1IA 2CGPA 1ZZ7A 2KPJA 4YARA 5KHJA 4P9GA 3GN5B 4BH9A 5BXXA 3FZ3A 5BUVA 2CSFA 5FPXA 2GC1A 3TRBA 1YLLA 4MX3A 4Z5CA 5I8YA 2O38A 1OMIA 4MV2A 2R1JL 1LB2A 2XJ3A 3H5TA 3H8UA 4I0AA 1YWKA 2PAEA 1QWRA 4BIFA 2PUBA 4JQDA 4I0BA 2PQQA 4R52A 1JWLA 4H7LA 3EO6A 1CAUA 1PERL 2ETEA 1XRUA 2I45A 4ZU5A 1VJ2A 1YFYA 3BS3A 1ZPQA 3PXPA 1DGRA 4LTAA 3ZKCA 3LWCA 4Q29A 1RUNA 3N4MA 3E6DA 4IERA 2QNKA 1H1IA 1I6XA 1UD1A 1EPZA 3D0SA 2GAUA 3G7DA 3LA3A 1Q3EA 3RDIA 1ZS4A 1SFNA 1CAVA 5J48A 3CECA 4OLLA 3ROUA 3WW3A 2QVSB 5K8SA 1YFXA 2XLAA 4KU8A 3E5XA 4MH0E 2OZ6A 3ES1A 1J3PA 3HT2A 2MQKA 2HKXA 1YUDA 2XL7A 4WVZA 4E2QA 4Z59A 4E2SA 2IXHA 2UYAA 4JTOA 4QMAA 3SHRA 4X4GA 2LYRA 2F4PA 1JUHA 3DNVB 2Q30A 2IXIA 3H50A 1POUA 1O5LA 4FN3A 1LLIA 1YFUA 5CADA 3F52A 2Q0AA 2IV1A 2HJIA 3I7DA 1CGPA 3EUSA 4IEQA 1TQ5A 4IWRA 3CLCA 5JSPA 3H7JA 2LYPA 3DN7A 3D0JA 3D1NI 3BPZA 1NXMA 1O5UA 1J58A 3CO2A 5JCTA 3H1WA 4X4IA 1E3OC 1EP0A 1IPJA 1LCCA 2O49A 2MPFA 1LCDA 3KGZA 4MUVA 3SXWA 4XFFA 1JH9A 3KJXA 2EA7A 4I09A 2AUWA 3QACA 2IC1A 2R63A 3BCWA 3USSA 5FQ0B 3CJXA 4ZU4A 1Y7YA 4AQ6A 1ZRDA 1NEQA 2AXUA 4Q0PA 4XFIA 2MNGA 3PVBB 1X8EA 2O4AA 2D5FA 5LEJA 2EVXA 4J1WA 4GHJA 2GC3A 2QDRA 2XKPA 2MHFA 3KSCA 5JSRA 2PHLA 5FQ0A 4Y42A 2EAAA 3I59B 4X6RB 5J7MA 4LLOA 2UYBA 2XCJA 2B5AA 4PJYA 3HT1A 5E1RA 2XSDC 3SCGA 1VR3A 1UXCA 5BV6A 5J3UA 3BD1A 1YHFA 4Z07A 2JVLA 4JTNA 4KWJA 1QXRA 1FXZA 4F7ZA 1YSEA 4JV4A 5BPXA 4JCYA 1SQ4A 5CVRA 3SMHA 2B8MA 3NW4A 4KL1A 2LCVA 2PPXA 4LUMA 2IVBA 5C6CA 1CQTA 2PAMA 4AVCA 2D5VA 2BYVE 1EYBA 1QPZA 1X2LA 3HZIB 4LA2A 3BB6A 1HW5A 3DL3A 3E5UA 2UY9A 3O14A 2BJCA 3PLQA 4E2GA 4IESA 4TLFA 3L1PA 3UKNA 1UPIA 4LEJA 3F51A 2IXKA 2BEOA 3LZZA 3ZDSA 4UXAA 4Q0VA 4YSFA 1HF0A 1CX4A 2E9QA 3BU7A 1QQBA 2GC0A 3B7HA 1L1MA 1RPEL 4YBAA 3CROL 2XKOA 2H6BA 4UBHA 1G6NA 4X4DA 4R8HA 1QXJA 4ONUA 4BYYA 4ZU7A 1RZSA 1UTXA 3OQNA 4MGYE 5LRSA 2CROA 4I8TA 2L8NA 4FAGA 1YFWA 2IXCA 1UCXA 2ICTA 3LISA 5KHIA 3FFQA 1CAUB 4FBFA 1O3SA 2PYTA 1CAWB 4PU4C 5C8WA 3OP9A 5F1RA 4O9EA 4IEOA 1ADRA 5FLJA 2BGCA 2KEIA 1O4TA 4HSJA 1LMB3 1FT9A 4F8DA 3EBRA 4META 2Z69A 4IEPA 4IEVA 3KGLA 2QCSB 1CAVB 1CAWA 5I0TA 4I02A 3I54A 2P17A 5JSOA 1WA4A 2A6CA 1DGWA 3S8QA 1O3RA 4NDWA 1QP4A 3M3IA 5AVPA 2D5HA 3OD0A 3JXDL 3O9XA 1OCTC 3H1MA 1PM7A 3QOPA 4RD7A 4A2UA 4CYDA 4YRDA 4WZCA 3U10A 2PUDA 2K0GA 2WUSR 2AXVA 1ZUGA 4MCXA 2PUAA 2AXZA 3QF3A 3BALA 3BDNA 3UFDA 2CAVA 3FWEA 4EWEA 5I0RA 4EWAA 4HVQA 3VHRA 4XFBA 1BDIA 4QGMA 1NZCA 4Q0SA 3LAGA 4XF4A 2IU7A 2WC2A 2EF8A 2B5HA 3E5QA 5KHKA 2XI8A 1DW9A 4I6UA 4D7SA 3WW1A 2EBYA 3EJKA 3SCFA 4MGZE 3TNQA 5FLHA 4QX5A 2AW6A 2Q4SA 5LEKA 3S7EA 3MPBA 3D82A 2FJRA 3QYXA 2ATFA 2KXLA 1OI6A 2VPVA 1PRUA 3H3UA 2N7GA 3ZHIA 4Z5HA 1O7FA 2PFWA 4L2NA 4MGIE 5I0SA 5EFUA 1J1LA 3FE5A 2QJVA 1O4XA 2GC2A 1J59A 3JXBC 2FMYA 3KXAA 3U0ZA 4PU3C 2H6CA 2O8QA 1ZVVA 3OMTA 4NVPA 2GH2A 1H1MA 3NL1A 4XF1A 4QGLA 1GT0C 5EZWA 2OFYA 4HBNA 1WETA 4I6RA 4X4FA 2XHKA 4IA8A 1U12A 2H8RA 2IXLA 5A7LA 1JFSA 3PNAA 3HQXA 4YG4A 3H9AA 3LFPA 2PAKA 1R63A 4XF9A 3EHKA 3ELNA 3CLPA 1EFAA 2IUOA 2IVQA 5JAXA 4JVAA 4K8FA 1RZRA 3RYKA 1Q5OA 3E97A 3DKWA 1NE4A 4XFGA 4N9HA 2PA7A 4EV0A 1ZREA 1OD5A 4N9IA 5BY5A 1VPWA 5FPZA 2JCGA 1X8MA 4XFCA 5E16A 5CU1A 1RZRD 4OFGA 1PRAA 3ETQA
chains in the Genus database with same CATH superfamily
2VR4A 5JI7A 2HBTA 1OXCA 3HD8B 4IEYA 2BNOA 3RYPA 1ZZ9A 1HXS3 4KWKA 3R6SA 2DTYA 4QQHA 4FPGA 4GWJA 3OB8A 1ACCA 4XBNA 4AFMA 5C9AC 2YZ4A 4EN6B 2VULA 1OVSA 1K5MB 1NY72 4M0HA 5JXJA 1LTEA 4J25A 3WG2A 4QHOA 4RN5A 4BQ1A 3QBQA 5JXGA 2XONA 2YU2A 1QB2A 1RL3A 4ZZ5A 3AXEA 1PHMA 5CA6A 1JFTA 1GICA 1QJY2 3HNBM 1CZSA 3PVOA 1C3HA 5FZDA 4Z5DA 3QCWA 1JZ3A 2BOIA 4X4EA 1UOFA 3BTYA 1XWRA 1YYNA 1OQEA 1RUF1 2RDNA 4I0WB 1MEC2 1OA2A 2WN3A 2O1QA 2XLFA 3OGSA 4XPVA 2K2SA 3TEYA 1BLZA 4ZZ8A 4DIQA 2PQSA 1A6CA 1ZZBA 2GP3A 2PXLA 3E6BA 3JU9A 1GLHA 3IBMA 4XEZA 4J1XA 3A0KA 3FHIB 5FUPA 1QQP2 4XUQA 5F3IA 3LDRA 2XL9A 5TSWA 4Q8KA 4BM8A 3N7KA 2QQOA 4B4RA 4Y5TA 3C2UA 2PHWA 3Q8FA 5C4WC 3FHAA 1N3PA 3WSOA 4XHBA 3HWJA 4QPYA 1W06A 1QJFA 1VBE3 2PUCA 4DS0A 3IB3A 3NJZA 3DKQA 1Y9MA 3IWZA 4JGZB 1LOBA 3SEPA 4GB31 2DCJA 5H9PA 1OOPB 3AZYA 3TB0A 4CCDA 5AFBA 3I3MA 2VO5A 4GJZA 3KT7A 5A3UA 3ZFFA 4DXSA 1JZ6A 1MZFA 1OUSA 2GU9A 2WQZC 1CAXA 3TFLA 3CZUA 3K3OA 5FZCA 3RNSA 4UT5A 4LKSA 4NROA 4U36A 1I5ZA 4QQLA 2PHFA 3OY8A 4HSLA 3AC0A 2VBBA 4RL7A 5FMOL 2R073 1N1YA 1H4HA 1UIKA 2PE5A 1UKGA 2WT2A 2C5DA 1ULEA 4R4ZA 3ZN4A 3ZN5A 5GLWA 4LR4A 1RHI2 1RIOA 4EQZA 3GM8A 1B0NA 5A6QA 1VBC1 1RUOA 1PGSA 2ZACA 1LHOA 2BFUS 2KA3A 4CCNA 2DCKA 1JYTA 1D0GA 4YW7A 4MVTA 2OZJA 5HI0A 1GOGA 4ISRA 1HV0A 3VZMA 3WX5A 4Q4Y1 4AVSA 1ASJ1 2D6OX 5IWFA 2ICPA 1CD3G 1W8UA 5AC92 5KC6A 3K75B 2WO1A 4AVBA 3IPVA 1BBT3 1RVF1 1UOBA 1OSGA 2HWE2 2WO7A 3J8F1 3VGIA 4RYDA 1WH8A 1ZZ6A 2D93A 2A6XA 3AYDA 1COV2 4K40A 1XU2A 5FLIA 3MO4A 4B29A 4FFIA 3VD9A 3FL7A 3HAGA 2BV4A 4L97A 1LKNA 2RS32 4Q1PA 4F8AA 1BEV2 2ODRD 3ZYHA 4LBOA 1HLCA 1LOFC 2FDFA 1OSLA 1MS0A 1C5HA 3NMBA 3DEMA 5CFDC 2OR1L 3KCXA 4UFLA 2DDUA 1ND3A 5FMCA 4AL9A 2ZGTA 2O8OA 3L2HA 2Y26A 2A3XA 4EJRA 2LTNA 5DDJ3 3URFA 4AFCA 1K45A 1O8SA 1ODMA 2DVGA 1QNWA 3ZFGA 1QQAA 1OPOA 1EV12 2JENA 3MICA 5BNPC 3MZHA 2F17A 3CL1A 4XIOA 2GMMA 4IEWA 1WLCA 4AVAA 4BISA 1UZYA 2QQPA 2C4XA 5ABJC 1W0NA 4QM9A 4COWA 1ZVFA 5EYYA 5A7PA 4UW3A 1AR73 2LYJA 1ENQA 1W8FA 3TAYA 4HN1A 1W99A 2A6VA 1RUG2 1ZBE3 3I3DA 4Z82A 3WF2A 3K2OA 1UY3A 1DQ6A 2HWB3 5F3CA 4Z58A 4N53A 4LA3A 3T2TA 1AXYA 2IVGA 1L3JA 3ZXJA 2D97A 1PX3A 2HYXA 2QUOA 3J7HA 5GM0A 2XUMA 4M4PA 3U11A 1W90A 4URAA 5ANNA 4FPOB 5FZAA 2OA2A 4FFGA 4MGKE 2QQIA 3M3CA 3VKFC 5J96B 4ER7A 2LALA 1JZ2A 3AMPA 3WV6A 5I91A 3FYAA 3G5GA 4ATEA 5DUWA 1A78A 2Y8KA 1GKBA 4OVEA 5D8AC 3GZTB 1YQ8A 5I0UA 4DXZA 1SEFA 2Z2SB 4CUAA 3JZVA 1AYN1 1HQNA 1XNKA 4JCXA 1UO9A 4LBQA 5FXWA 5IVBA 2QQLA 3D4KA 2HINA 1RUI3 1YO8A 3IDCB 1X82A 2Z5WA 3WG4A 1P8JA 2DYCA 1VB4A 2A3YA 2ZX1A 5GLVA 4M3CF 4OI1A 1ZBA2 3FUQA 5CFCA 4UFHA 5IVFA 4LLFA 3VZLA 4CDQA 4QXKA 2JXAA 2V5DA 5GZGA 5G04L 1NZIA 5B4NA 2XUEA 2RHPA 4FBIA 4K1ZA 3O0VA 1BK1A 3J7MA 4QXBA 5C7GA 2QQJA 4BQ4A 2DUOA 4H3WA 1PK6A 2X53S 4CCJA 1YNAA 2VECA 4FPEA 3EXUA 4IE0A 5I8SA 1EUUA 1MZ6A 3JD71 5IVVA 3ON7A 5FY0A 2K9ZA 5FY9A 1ZAYA 5GZDA 1XSRA 1GV9A 1H8TC 1W6OB 1CX1A 3RRDA 5F6LB 1FMD1 1K3IA 1ZYBA 2HH9A 2YPDA 3UNPA 5A33A 3CF6E 3K48A 1RUF3 5D2AA 2BBVA 3GN5B 4MGQA 2WQ4A 4M3CE 5D8AB 1B09A 1ENSA 4HK9A 5I8YA 5JMCA 1DLLA 2VAUA 3DF0A 4IL7A 1Z78A 3H8UA 4I0AA 4K20A 4DB5A 2D3RA 2PAEA 1Y4WA 4LHKA 2RM22 1JODA 4A7YA 4JQDA 1SLBA 4I0BA 3K77A 4H7LA 1YIFA 3ORJA 4BQ2A 1PERL 2ES3A 1BJQA 1CPMA 4AI8A 1NCRB 4Q4X1 2QE3A 4EN9B 5FY7A 4GB33 1DGRA 1VAVA 2ENRA 1W05A 4LTAA 3M8LA 4Q29A 4FPJA 2E7AA 3W59A 3T4VA 1S0FA 1PMHX 2QNKA 1CONA 1H1IA 4A41A 1EPZA 5FIXA 4RQPA 1W2AX 3U37A 2X8KA 3MEPA 1V0AA 3JB8A 1MS5A 3ZXAC 4Z2AA 4OHYA 2EXIA 4YZ3A 4JDNA 4BA6A 4CCCA 5J48A 2XXAA 4BPZA 3HPNA 1DGWX 5BNOA 1NT0A 3WW3A 1DQ5A 3UJOA 2B9VA 3O1TA 1YFXA 4KU8A 3E5XA 1LCLA 1IS6A 1BCXA 2HKXA 1YUDA 4M3CB 1B35C 4AWDA 2IXHA 1VBC3 2VW0A 2JDZA 4N8MA 4UF0A 2VZRA 2VL4A 3A4UA 4CXYA 4CP9A 1V6OA 4A42A 2J1SA 1FV2A 1W0PA 3BN6A 3BI3A 3H50A 1W9SA 3D6EA 5T5JA 1C1LA 4Q4Y3 3NNJA 1ASJ3 1GU3A 3FC0A 3OUIA 1PVXA 4JGYC 2XQXA 3N7LA 1QJU2 5F8PA 1LEMA 1WLDA 1X9PA 2RS51 3R4DB 2ARXA 2VOKA 3LPGA 2C1FA 3I7DA 2J1AA 1RVF3 3J8F3 3LEKA 4Q26A 3VZOA 4FTBA 1CGPA 2VOTA 4IEQA 3RFRA 5F9TA 4UFMA 4IWRA 1W6QB 2LYPA 2X10A 5FMOS 2P2KA 5B2GB 1HRI1 3BPZA 3JCIA 4Y1VA 3UT0A 1FOD2 3PJQA 2WDBA 2MPFA 2O49A 3KGZA 1LCDA 2JG8C 1YRZA 2NLRA 3MBWA 4QPGA 3KJXA 4B7EA 2AUWA 1OQDA 4WM7A 5DTQA 4J6GA 1PZ9A 2R63A 1IG0A 1OPMA 3BCWA 4XABA 2J42A 1IPSA 4A7ZA 5LB6A 2JKXA 3HBKA 3ZSEA 5DUVA 4XW3A 1NEQA 1F31A 1SFYA 1O91A 4XFIA 5JUWA 2EIBA 1X8EA 3GUUA 4RGAA 3O1OA 5JLVA 2J1VA 1DG6A 2EVXA 2P34A 5IVEA 2QDRA 5LY2A 1D7PM 1F4AA 5JSRA 2PHLA 3ZPOA 5FQ0A 3MEJA 2B45X 4X6RB 3N9OA 3CZJA 2A3WA 4LLOA 1MR5A 4X8PA 4AI1A 4ARXA 5J7MA 3I2DA 2B5AA 3JBG1 1PMJX 2YYOA 2G4IA 1W6MA 5CYYA 5BV6A 4FPFA 4PCRA 3SX0A 2JVLA 1V6IA 4JTNA 5FUNA 1FXZA 3TRSB 4B4PA 4LBMA 4AEDA 4CZSA 3TN91 3VBSB 5FPVA 3NW4A 2W68A 3GBWA 3QOXA 4WVMA 4KL1A 2VBDA 2PPXA 2IVBA 1NXD1 2G9ZA 3PL0A 4Q4V2 2XVGA 4GMP0 2CYFA 5LBEA 3B7MA 1EYBA 3J4UH 4AEJA 3HZIB 1HQ1A 4HETA 4LA2A 4AOCA 2JG8B 4DY3A 2PELA 3O14A 3I49A 4GKXA 4E2GA 4IESA 1OVPA 1SHWB 3S6PA 3WUDA 1HKDA 3L1PA 3UKNA 4L99A 2MXDA 1UPIA 4W8JA 2JDKA 4OMCA 2A75A 2IXKA 1AR61 2BEOA 3T0BA 3WP4A 4Y5SA 3IAQA 2Z42A 2E9QA 4LO7A 4QU1A 1QQBA 2GC0A 4AI9A 1RMU1 1RPEL 4QKDA 4AK3A 3QH6A 2H6BA 4L0PA 1BHGA 3NROA 4R8HA 4UBHA 4NN0A 4AI2A 4ONUA 5FY5A 2LROA 5JIAA 4FTSA 2VMDA 4YPJA 1KRIA 1V6MA 1W8TA 5DAQA 4I8TA 2L8NA 3NNGA 3LDBA 5FZ8A 1GNHA 3ACHA 4DUWA 1WUVA 2GNMA 3VDAA 2ICTA 5FZLA 3LISA 1CJPA 2JICA 3ZFEB 3FFQA 4B3NA 3AMHA 4W4ZA 1K5MA 4FBFA 1R1A2 2OUJA 2PYTA 3AJYA 3B3QE 4CP0A 1NOVA 1O3SA 2VNVA 5C8WA 2ADDA 3LCPA 4O9EA 4Q4W2 3GZAA 3JD73 4XXAA 3JB4C 4AFBA 1MPXA 2KEIA 4NE9A 1UQXA 4HSJA 5CISA 3V0AB 5JMOA 4IV1B 3KGLA 3MFAA 5FP9A 4AEKA 1FMD3 1CAVB 1WLWA 2V72A 3OOXA 4BQXA 5I0TA 2IZWA 2VZPA 4LKDA 2HLEA 2JWPA 3KLSA 4E4DX 2Z4FA 3UESA 1WA4A 1L7RA 2VZ3A 3S8QA 1GUIA 5G05L 4DRVA 2W95A 3O9XA 1WCSA 3I2GA 1RJ8A 3H1MA 1PM7A 1PO12 2ZGSA 3QOPA 4RD7A 4XZUG 4HFSA 5A3WA 4BLJA 4CDXC 1Q8SA 2MEV1 4AG4A 4JGZA 4FCAA 4CDUC 4XDOA 4Z8BA 3U10A 2W1SA 4YGDA 5EPAA 3M2MA 1PGL1 2AXVA 4LOTA 4AHXA 5FP4A 2AR6A 4MCXA 2PUAA 3ZXGA 3BALA 3QF3A 4LORA 3BDNA 5FYVA 2CAVA 3SH3A 5IUQA 2WYSA 3FWEA 1D4M3 2VG9A 4EWAA 4EWEA 4HVQA 3VHRA 5I0RA 5KXCA 4QGMA 1O4ZA 3GALA 5DN2A 3RWKX 2WSVA 2XJRA 3CIHA 3M1HA 4MXWB 3VKMA 3D8CA 1MS8A 3ZM8A 4KWUA 5L19A 3LPFA 2JX9A 2XI8A 2JG9C 3NV4A 1ZM1A 1DW9A 2CSGA 2GNBA 3NNMA 1LAJA 4D7SA 1FYUA 3SCFA 3ECQA 5FOBB 1WKYA 1LGNA 4D69A 5FZKA 5FLHA 1QOTA 1KJRA 4SLIA 3FBYA 3W58A 4QX5A 2R072 1NA1C 3CU7A 3N9QA 3OPWA 3WNMA 3S7EA 2CHHA 5JOZA 2CU5A 1C4RA 2ATFA 2KXLA 4S2FA 2LRPA 3WF0A 3KWVA 1UY2A 2N7GA 2PFWA 3NRUA 5CAZA 2BW8A 2RG4A 1Z7S1 2RS12 4K7JA 4WVWA 1H0BA 3INAA 1QGLA 3W21A 5A1FA 1ODNA 2GC2A 2HFZA 4YGCA 5FOJB 1J59A 1VB2A 4Y1UA 3AVRA 1NKGA 2GSYA 3BU0A 4CDXB 4NIIA 1JXNA 2HWC1 1W3XA 2RS53 4XZPA 4CDUB 2GH2A 1H1MA 3ALQA 4AR2A 2ZGLA 3T30A 1OUXA 2TNFA 3VB9A 4HBNA 4BE3A 4QPWA 3IKWA 1HRI3 4RS5C 2VQTA 4XTPA 3V0BB 2H8RA 2QKDA 2V4AA 1SLTA 1HN0A 3PNAA 5A6XA 5HXMA 1UU5A 1PGW1 3PE5A 1E57A 2ZGQA 3GGLA 3ZXEA 4JQTA 1VPHA 2BU9A 5ACA3 2JG9B 2XXPA 3VBHC 2QQMA 1EAH2 1JU4A 5FKCA 3RS6A 1PIV1 1AJKA 1XNBA 2IVQA 2C9AA 2VQUA 5T5LA 3DXUA 4RHV1 1UWWA 2YPJA 3OGVA 3POJA 1NA1B 3DKWA 5CKQA 1NE4A 4XFGA 3CDZB 4DE8A 3S5QA 1NQDA 5LA9A 1KITA 2QQUA 4TTGA 2ZEWA 3AP7A 3CJIB 3MIHA 4HKWA 1SG3A 2WSUA 1X8MA 4NPLA 1H2MA 4W6WA 4XHXA 2JKBA 3UV9A 1JYXA 1FX5A 1F15A 3TYJA 2LYSA 4LULA 2P5BA 2PXVA 1ZBE2 1NCQC 4CEYC 1ZRIA 1GWMA 4FT8A 4JC1A 1UU4A 1GQGA 1UX7A 1OURA 1VBD1 5EV7A 2BNMA 4BHPA 1HRV1 3TN93 2E7TA 2TUNA 3FYMA 3QD6A 4UFIA 1QEXA 4UWDA 3I97A 3M3EA 4YVSC 2A7AA 4PDWC 4MO3M 4EWDA 3QQ6A 3VD3A 2XBO2 4XETA 3A0NA 4P5HA 1H30A 2WZR1 3LEGA 1CQ9A 1RUD1 3AL5A 2D6LX 2XXZA 4QAWA 4JQRA 4MCTA 4P5YA 3QLQA 2XVLA 3DUIA 4CCKA 1YQ6A 3MYXA 2IFWA 1AYM1 4R9CA 5DG1A 2DUPA 5IW0A 3U78A 3VBHB 3LOBA 1AR63 2SLIA 3UL2A 1LOAA 1IC8A 2AH2A 1TMF2 2J7MA 1S7EA 2ZCWA 3WDTA 3ZMOA 4WBBA 1R093 1RMU3 3VBUB 3IZOA 2R6QA 1W2NA 1JYWA 2Y33A 2UWBA 4C1WA 3VBRB 3HMYA 2IUWA 2ORXA 2WYFA 3ZVXA 1WMEA 1BQPA 1ZA4A 4X8NA 5BNNB 3S0MA 2ARCA 1UYYA 3GJAA 4A7KA 5DT2A 5E1RA 5LBBA 3MV11 4NHYA 5A7SA 4R4XA 3UKVA 3O0XA 5B4XA 1HX6A 2AENA 1XJAA 2R062 3TEZA 1W6OA 2VQAA 1OFNA 1Q43A 2I74A 1Q8QA 2W1UA 3ATGA 3LIHA 3MPPG 4FQ4A 3PU8A 4PT6A 2A70A 4A44A 4Q8LA 3RVHA 2VGDA 1DWKA 2GZUA 1RUE1 1SBEA 1FPN2 2CWMA 2D98A 2YXSA 3GN5A 2PXDA 1OH4A 3A21A 2D6NA 3KVAA 3Q8EA 4YVSB 1QH7A 4M00A 4HK8A 2Y0IA 4GXLA 4PDWB 4R9BA 2XLGA 3FJSA 2RVAA 4TSVA 2WZPP 3RGBA 3V64A 3OF1A 4IGPA 4URTA 4YG3A 3K51A 4AF9A 5CKNA 4LO5B 4ASLA 5JUVA 1ZX5A 5JDBA 2Y6FA 3MLFA 2XJTA 2NMOA 3SCHA 4LUKA 2ET1A 4BXFA 4W6XA 4X4HA 3LE0A 5LZ6A 1Z0HA 3O1SA 1URXA 1WD3A 4INDA 1SZBA 2DFCA 2WT0A 5C8CC 5CEHA 2B9UA 2Y0OA 2ZTNA 1KDKA 1RTVA 2MEV3 1NCRA 4I2OA 3VD5A 3RZZA 1DQ2A 5K0UB 4B1LA 3LSDA 3OBRA 5FZOB 2Q8DA 2VMGA 4PLNA 4KGQA 3RYRA 3ZYFA 5JR2A 2OIIA 2ZX2A 3POBA 2YUEA 1N1TA 3BOWA 4FSJA 1DIWA 4IVZA 5FK7A 2J1EA 5IJRA 5J09A 4TWTA 5FV3A 1AU7A 1LGCA 5FY1A 1UPSA 4GB32 4LXLA 3E6CC 5M0TA 3R05A 1DZTA 2ZGNA 5FJHA 5A3PA 3AKSA 1A34A 4IUGA 2D40A 2O14A 4ATFA 1MQTC 2CTVA 1XE8A 2FCVA 4V1PA 4YG7B 2OS2A 4M3CA 3TNPB 4L9BA 5LASA 5K98B 3MDPA 3VK0A 1H9WA 1R69A 4X4CA 3L9JT 3VBFC 5JXHA 4WM8C 2C26A 1QDOA 3AZVA 2WNVA 4CU6A 1XQNA 2W52A 2VW2A 1IS3A 2A6ZA 5FFOC 2PUGA 1Z7S3 2R30A 1QP7A 2Y64A 1VBC2 1RUC1 3U07A 3VDDC 4Y22A 4PU8A 2LYLA 4Y1ZA 1IKQA 1T6BX 5FZ0A 5IK7A 2E32A 2LLVA 2Y6KA 3NAPC 3ABZA 5T54A 3GBFA 1AR81 2V73A 3GNEA 3WW2A 1JBCA 1W6QA 3D3AA 1OH3A 5HCAA 4YZ1A 1JZ5A 1TME1 4Q4Y2 2VEOA 2JB8A 1ASJ2 4L92A 2OQ7A 4AQTA 5IYYA 4YYOA 2GDFA 1X50A 3HQRA 5C5TA 1FI2A 1W8OA 2DCTA 3FUOA 5CZKA 2ZKLA 4N43B 5FZ9A 4Q2JA 1XPWA 1WIZA 4JDOA 4JDMA 3WW4A 1DQ4A 2VY0A 3GF6A 3OCPA 4OHZA 4YNIA 4NIDA 2ZMKA 2AWIA 1ST8A 2CAUA 1LHNA 1XSQA 2GRLA 1PZ8A 3KZ3A 3JXSA 4XJWA 2JJ6A 1JZ8A 3C7HA 1MQTB 5GAGi 2ADEA 3W5NA 1I3HA 1LU1A 4MLOA 1PIV3 3NJVA 4ES9A 4KBBA 4RR3C 4OUEA 3H8XA 2ID4A 3S30A 2VMFA 1RUNA 4S2HA 4FQZA 2QQVA 4RHV3 1JU3A 3VBFB 2WIUB 3ZPYA 4NRPA 3HEIA 4XURA 4CEWC 2E51A 1W8ZA 3H1YA 1DP0A 1PMIA 2IWGB 3KV5A 2VVFA 2VUDA 3FLRA 1DFQA 4JKKA 3VDDB 3ES4A 4CDWC 3C3VA 3VBSA 1RIRA 4AQ2A 1PVC1 3MW4A 4NWVA 4Q1RA 5C9AB 1AVBA 1IPKA 1SFPA 1IS4A 1VRH1 4GQMA 2PUEA 1NLSA 2FCUA 2VMIA 1GWKA 1VALA 3C7EA 5FKBA 4AI3A 5C3PA 1KD7A 1VBD3 1EY2A 4W65A 3H3ZA 4AI0A 5JOWA 5J36A 1HRV3 5GZFA 2J7WA 4XFHA 3V56A 4L11A 1YC61 2L49A 1LRHA 2E53A 3HN3A 3KD4A 3WQ1A 1PO21 4DOUA 1EPWA 3N3HA 5KBFA 2WZR3 3MF6A 4G4FA 3OG2A 1RUD3 4OYUA 1DF0A 5D1IA 2CGPA 2KPJA 5KHJA 3OSDA 5BUVA 5BXXA 1QKQA 2VUJA 4ISQA 1G9AA 2YBSA 2GMPA 4XDQA 2WZ8A 1PZ7A 2ERFA 4UW5A 4PQQA 3N9MA 2O38A 1LNSA 1YJLA 2R1JL 5EJ1B 5A3TA 1S2BA 2HEYF 1WCKA 4XJZA 1AR93 1OBNA 2JD9A 1UKRA 4K1YA 3CBNA 2R49A 5FZBA 3AXDA 4MG2A 4D6RA 2PUBA 4MSVA 5IK4A 2UWAA 2VOXA 3ZFEA 2PQQA 1GZWB 3WNLA 3MI8A 1YCIA 3EO6A 3ETPA 4GWNA 3J9SA 2I45A 2IVJA 1VJ2A 2WS92 3M7AA 3ZYIB 3M9LA 3PXPA 4NAMA 4MGSA 3LWCA 4CDWB 3N4MA 1QF3A 3E6DA 3ZSKA 4K21A 5FYHA 3W9AA 5K7PA 4Y26A 5FY8A 3V0AA 2ZGMA 2JDAA 2GAUA 3D0SA 4IV1A 4LT5A 3R0RA 1Q3EA 1V00A 3LQCA 4CCLA 4AVVA 1CAVA 3RQ0A 4BWOA 5GLZA 3IDEA 3DPRC 3OWQA 2RMU1 3MIBA 1JYNA 1MVQA 1S0BA 1OT5A 1TNFA 5L36A 4XMAA 1XC6A 3ME5A 5K4LA 5C4WB 4MH0E 1GNZA 3AFKA 4NRQA 5C33A 1XYPA 2WNUA 3HT2A 2MQKA 2XL7A 5A1LA 5L9RA 4E2QA 4Z59A 1FMD2 2X5IC 4JTOA 2JDPA 4QMAA 4Y1YA 4E4SA 2RV9A 2NYYA 3PIGA 1G9FA 1F8VA 1LESA 4LJHA 3DNVB 3VZJA 1ULFA 3N36A 4QB2A 3ZIXA 1OFSA 3OPTA 3KL4A 4YFWA 1YQ5A 1G86A 1AX2A 1YJKA 2BOJA 4DNYA 3W5MA 1ZA7A 3KT4A 5T52A 2VTFA 4GQ7A 4QDQA 5LA2A 2IV1A 2WINB 2HJIA 4XQWA 1YQ2A 3WEZA 4TXWA 3O7OA 4A4AA 2P6CA 4CVUA 1LEDA 5DAWA 3V65A 1UF2C 3CLCA 1WA6X 3D1NI 1QJX2 2VMCA 2PXUA 5JCTA 5ANQA 3H1WA 5L9VA 4UAPA 1D4M2 4XMIA 3SXWA 4B1MA 4CP1A 4XFFA 5EIYB 2VZ1A 4GH4C 4OI2A 2VNOA 3QACA 2VCAA 4RGKA 2IC1A 4NHXA 4XQDA 3USSA 4AE2A 2VZSA 5DAPA 4ZU4A 2RR11 3DECA 4I30A 2A5ZA 3AKRA 4PQ9A 1NY71 4Q0PA 1O8PA 5IATA 3MW2A 3N9PA 5C3QA 3TBDA 1UOJA 2I07B 4KMQA 4J1WA 4CCMA 3KF5A 3ZLIA 4GHJA 2GC3A 2VQ0A 2ZEXA 4JKLA 4YGEA 3MF9A 5IVYA 1QJY1 1RXGA 2MHFA 2X5IB 5FJKA 3ZXLA 4Y42A 2EAAA 4PBPA 4QX0A 2DU1A 4KQ7A 4K3UA 2UYBA 4M01A 1K5JA 1MEC1 2XCJA 1RUC3 2R042 4QPIC 1RUH2 2UURA 4IW3A 5CFDB 4D6SA 2M4HA 2B39A 2XSDC 1AR83 1VR3A 1UXCA 3DCQA 3PHMA 2Y6LA 3BD1A 5F7UA 1YHFA 3IT8A 1QQP1 1TME3 4CSWA 4KWJA 5JI9A 2A73B 2VZUA 2OKXA 4F7ZA 3V0BA 1XU1A 1YSEA 4JV4A 3I3EA 5BPXA 4JCYA 4GWMA 5BNPB 3SMHA 2RS52 2CNAA 3USUB 3S57A 3TELA 4MHUA 1IQAA 4DMIA 1TNRA 3OJBA 4LUMA 2ZEYA 5L7OA 3RZMA 5ABJB 5A7WB 4KH9A 2D5VA 5CB7A 4LIUA 1HRI2 1C8NA 1X2LA 4Y24A 5JZGC 1RITA 4PF5A 4DO0A 2EALA 2OX0A 4OQ9A 5H9RA 2BJCA 2VU9A 2XJUA 1ULDA 3ASIA 3DYMA 3PLQA 1JZ7A 1AL22 5FXXA 2BWCA 3LFIA 1O59A 1QDCA 4YVWC 3SH4A 1NUKA 3F51A 4QU2A 1GSLA 5ACA2 5F3EA 4UI9L 4LBKA 2ZHMA 4UXAA 4Q0VA 4IXLA 1CX4A 3CJIA 2NQYA 3BU7A 1N3OA 3NJXA 1L1MA 2XKOA 4G3YC 5FYIA 3VHPA 3O1VA 3WQBA 1G6NA 2Y6JA 1QXJA 3WG1A 1RHI1 3ACFA 4ZU7A 2EXJA 4ZY9A 5C3SA 3AMQA 2CROA 2ORZA 4FAGA 1TZOA 2A6WA 4COUA 5IVCA 3A9ZA 3AL6A 1IHMA 1L7QA 1PVC3 4OBMA 3ZYPA 5T5OA 5IFTA 1VRH3 4CXXA 2NPIA 5F5IA 4P02B 3ILNA 1ADRA 3HVDA 3OBTA 5AC91 2WWSA 1LGBA 4YG6A 1XXNA 3LB9A 4F8DA 3EBRA 4META 1R082 2YGLA 2Y6HA 1W39A 4IEVA 2WFF2 1QOOA 4HPKA 1PO23 1CAWA 3VBHA 4NOTA 1O6UA 2RS31 1YEWA 5DRTA 1BEV1 2W5FA 3ZSLA 5IHRA 5JZGB 3WD5A 2P3JA 4Y4YA 2DU0A 3O5SA 2P17A 4GAZA 1HDKA 3J26N 3VBUA 2A6CA 1V9U1 4AHZA 2XXQA 5AVPA 3VBRA 4Y20A 5F5CA 3VKOA 3WDXA 3GZDA 2CY6A 5IFPA 1DU3D 2E6VA 1KS5A 5BNNA 1AR62 3Q8AA 1EV11 1LHVA 3QH7A 2C6SA 4WZCA 1F2NA 4JX0A 2PUDA 2W87A 4Y33A 4YRDA 2K0GA 5DPNA 1H8TB 3AYAA 4HKOA 1R092 3LKJA 4RA0A 4Z1VA 4NJ4A 1AX1A 1JUIA 3VBOC 4BXSV 1NG0A 4IE5A 2W1QA 1GMMA 1XNAA 5LCWL 3ACGA 3T2QA 3MLLA 5GZCA 1JYIA 3WCRA 4XFBA 1BDIA 4XJ9A 1BMV2 3I4IA 2DUQA 3AYEA 4PHZA 1NZCA 3E5QA 1OC1A 5KHKA 4PDWA 2XB6C 2ILMA 2WZEA 4XBLA 3T2OA 3RWNA 1FNYA 3ZPXA 1GNYA 2EBYA 2CDPA 2RMU3 2WLQA 2XWBB 3OEBA 4DFSA 1JYVA 3TNQA 1UYZA 4DXRA 2VCMA 2NMNA 3L2YA 3OGGA 4OMDA 2ZGOA 4FPLA 4FFFA 4FVVA 3D82A 3PUHA 3QYXA 4COZA 2CDOA 2VPVA 1AX0A 4FO9A 4ZONA 4BQ5A 2KM2A 3ZHIA 1O7FA 2DV9A 4MGIE 4YWAA 5I0SA 5EFUA 5K0UA 1J1LA 5T55A 3FE5A 2WKKA 3KT1A 4FOWA 4EKGA 2RDSA 2FMYA 4N7IA 1W0OA 5APAA 2OXBA 3POEA 4K6BA 4TLFA 3P6BA 2WJSA 4JRAA 2MEV2 4QX3A 3WHUA 2PXQA 1C8M1 3VBOB 4I6RA 1CIWA 1PGL2 3O12A 2XHKA 1JOJA 1H6XA 1B35B 2ZHKA 3M3OA 4NRMA 3VZKA 4EK9A 1AZDA 1V6JA 3D5OA 2XJQA 4CPBA 3HQXA 4YG4A 4NPRA 3H9AA 1V6NA 3WNXA 1HIXA 1LECA 1R1ZA 1WW7A 4ER0A 4XF9A 1G9BA 3ELNA 4JGYB 2Q8EA 1LHWA 2W1WA 2B46X 2RR13 5HCBA 3K4AA 1VBA1 5A3LA 5JAXA 4W6YA 4JVAA 3OPZA 4C91A 1RZRA 4OHWA 3ZMNA 3WF1A 1WMXA 1Q5OA 2DVFA 4EKIA 3ZFFC 4EE2A 3AMNA 4ASKA 2WO2A 2PA7A 4N9HA 3WXPA 1OD5A 1QJY3 2BERA 3AKTA 3NJYA 4EV0A 2NP0A 1LOGA 4XUTA 5BY5A 4NHKA 3JUUA 5H9QA 2JCGA 1MEC3 3EMRA 3O0WA 3M3IA 3ETQA 4OFGA 5FO9B 5IVJA 2ZX4A 1H4GA 1UZZA 5F37A 1ND2C 4N43A 2D6PA 3OKZA 4FP2A 2GH8A 3I2FA 1AYN3 1QQP3 4KBZA 4PBOA 2EIDA 1N1SA 1VBB2 2GN7A 1C28A 2B42B 1RYYA 4MOAA 1GP5A 2PN5A 4XOGA 4WVLA 3ZO0B 3IMMA 3GYDA 3SH5A 2VCBA 3AYCA 4I3PA 2DCYA 3CKHA 3HBZA 4LOSA 1QXPA 4PF1A 1TEIA 2VBPA 3IIIA 1HJFA 1QJEA 2GZWA 3KCCA 4PI2A 1ZZCA 1F5JA 5C70A 1TE1B 1PGW2 2V09A 1W6NB 3VBFA 3CNAA 3FN9A 3UKTA 2ZX3A 2P6HA 2J22A 2WNOA 1RXFA 1LQCA 3WNKA 3BIWE 2L1PA 5FZGA 4IGOA 1SDDB 3DGTA 1HXS2 1PIV2 5FCCA 1ZNPA 1SCRA 3OUJA 4DRRA 5C71A 2NN8A 5F2WA 3KZ4C 2JD4A 1E5RA 2IFRA 1SPPB 4MXVA 4RHV2 5D21A 4CCOA 2E31A 1RHI3 1ND3C 1CAXB 4LIVA 4E27A 2VOWA 5C9AA 3FFZA 5DMYA 2BQPA 2QFEA 3WDUA 1ZZ8A 2BDRA 4YG0A 2FHRA 4C8DA 3PURA 5L73A 4CUBA 3ZFGC 2OYZA 3KQ4B 4ORFA 2JDUA 2HBUA 3A22A 3RMXA 4QB6A 1ND2B 2XJVA 2ZBJA 3H0OA 3WLUA 3O1UA 2WA3A 2G9FA 1QJU1 1BVP1 3FX3A 4IQPA 1PNRA 4CCEA 5A6ZA 5AC93 4O8BA 5F3GA 4LE3A 2VZVA 1I1EA 3SLIA 2LUWA 2PHDA 1GYKA 4XUOA 1J3QA 4FPYA 1HRV2 2EWTA 1AHSA 1OOPA 1W8NA 2AREA 5FMBA 4AHYA 3IDBB 4N53C 2LYQA 1FOD1 1POV1 4Q4X3 2PHXA 4HN0A 1O3TA 1T2XA 3B9IA 4KU7A 1VBE2 1NE6A 2GP5A 5T3NA 1IQDC 5A80A 1RUD2 1V9U3 1A8DA 4GULA 2ZGRA 1DQ0A 4IETA 4LBNA 4HMZA 2PXKA 4JKMA 4ZXKA 5HXVA 5GZEA 3ZR6A 1VMFA 2UY8A 4CU8A 2WFPA 2HWD1 2XPJA 3S7IA 1EV13 1AR92 3SKVA 4CRQA 1WBFA 1L7LA 2W0XA 3N9LA 1PM4A 2L9LA 1PRVA 1YQCA 3VHOA 2C9KA 1KFXL 4YFZA 5E6HA 2FDIA 3IVPA 3N35A 2VTXJ 4PU7A 3ACLA 4XXPA 1VMJA 1Y9QA 1WMFA 1C57A 4O9GA 3ZFGB 4Y4RA 5KXEA 3DXTA 4V2WA 3WZ1A 1STMA 3BVCA 5CFCC 4FAHA 5C4WA 4BMBA 3B02A 3WDYA 4CDQC 2FZ1A 4A45A 2QTWB 2P3KA 4IEXA 4XDPA 5JR7B 1QY4A 2JB4A 3PUIA 3BTXA 3WDVA 5I93A 1W2TA 3FMYA 1VP6A 1SBDA 2BWAA 4NMIA 4Q4V1 4XTMA 1PK6C 3KV9A 3LDKA 2GMEA 1BBT2 2IXJA 2LW8A 4XYXA 4QHZA 5GKAC 3VDCA 4ES8A 2BVBA 3AVSA 1K12A 2VOVA 1M4WA 2QZ3A 3TWIA 1QP0A 2W08A 5GLTA 4DINB 1UXZA 3ZSJA 2YDEA 3T0DA 2FQPA 3AFGA 2R7EB 3N7JA 3JXCL 3F6WA 3KV4A 3T1MA 2C0ZA 1UMZA 4ZPIA 1WWYA 5L9BA 2PUFA 2HCSA 3ZKYA 2VXRA 1RC6A 1SQ8A 1OKQA 5DABA 5DDJ2 4EROA 2J1UA 1C8M3 1H2LA 1VRBA 3KMHA 1UY1A 3H7YA 4XACA 2KEKA 2ZHNA 5FZ3A 3GCWA 3I2HA 1UIJA 2D43A 4LHSA 2KEJA 1YI7A 3CQOA 2JDYA 2AUYA 3AM2A 3JBG3 1R1A1 3JQXA 3UK9A 1AR72 1KXGA 2PTMA 2YFUA 4Q4W1 4DUXA 2VNRA 1W9TA 5J98B 2R0FA 1J84A 1UXDA 1VBA3 5FWJA 2HWB2 4LO4B 5A1AA 4KGGA 3LA2A 4ZHNA 1V70A 3DV8A 4XILA 2D6KA 1FATA 4EN7B 2BUKA 4C90A 1KJLA 2P3YA 1RGSA 1LOFA 2JQEA 1BK0A 1Y9GA 5GAHi 1XBFA 4RQPC 5LATA 4Z92B 2FDGA 4RS5B 5CFDA 3OGRA 5FPBA 4GD4A 5A7QA 1W3VA 3THDA 1JI6A 3LF7A 3MLJA 4LBQD 4LMFA 1OQ1A 4D6QA 5A6YA 5BNOC 1KFUL 2RJKA 2GNDA 4D3WA 1T6GC 3NKTA 2D3SA 4PIZA 3PMEA 5BNPA 4BU2A 3USUA 4FI9A 5F6KA 4C1XA 1LR5A 1UAIA 1RJ7A 2W92A 1FV3A 1PO11 5EP9A 2ZABA 3G0TA 2XMLA 1WLTA 1E5HA 1XOYA 2XIUA 1OLME 4Q2FA 5A7WA 4BOWA 5ABJA 4O61A 4DZGA 1RINA 2BPA2 1TME2 2ZMLA 1APNA 4N90A 4XAEA 5SV8A 1RUI2 1UYPA 2NM1A 2WO3A 2XWJB 2VE1A 2VZTA 3LQXA 4JAAA 1BZWA 4NR1A 2GALA 5JPNB 3A23A 4IEUA 2WBKA 5DZFA 5FMDA 3HJRA 5I8TA 1REDA 1ZZ7A 1A8MA 4P9GA 3VKNA 4V2VA 2CSFA 2GC1A 3TRBA 4Z5CA 1AL0G 3P3NA 1NCQB 4MV2A 4CEYB 2V4VA 1LB2A 3T1LA 5LY1A 3I3BA 3H5TA 1TG7A 3SEEA 3SKJE 1YWKA 3C7GA 2OUHA 2VM9A 4NUBA 4QPGC 4BJ0A 1W03A 2P37A 4RQPB 4ASMB 3F95A 4RSUA 4R52A 1JWLA 5D8AA 1X36A 5FZMA 4TYSA 2ETEA 4ZU5A 3M3QA 1IS5A 1YFYA 3BS3A 1ZPQA 5FTTC 1S2EA 2ZKNA 2RS11 2VZOA 1VLNA 5FZ7A 3WHTA 3IDAA 1CZVA 3H42B 4IERA 5FO8B 3RZHA 1JHNA 5EYXA 5FR3A 2VCCA 1RUF2 2LNMA 1UD1A 3FMGA 1HB2A 1QJU3 3LA3A 4DPNA 3B01A 3LEIA 4CEWA 4C0HA 4ER5A 1MS4A 2HWF1 2YBPA 1GANA 4H55A 4OLLA 3ROUA 2OW4A 2QVSB 5JZGA 5A7OA 1BVVA 4QX7A 2XLAA 3POGA 3T09A 2WABA 3G6JB 4Y3OA 1LOEA 4WZFA 1FOD3 1POV3 4YGBA 5FZ1A 3T0AA 1QJZA 1F4HA 2P4EA 4WVZA 2PLV1 3UGHA 5BYNA 1S0EA 4HANA 3SHRA 4YZ2A 4AEDC 2YY1A 2YMZA 1JUHA 1N3QA 1WMDA 2Q30A 1H8TA 1HN1A 1EAH1 3NV1A 5FP7A 1E5IA 1VIWB 2HWD3 3EYPA 1YFUA 5CADA 2Q5TA 1UNBA 2JDNA 4JCKA 3F52A 2AACA 3B94A 3C7OA 4IV3C 2A6YA 5EHDA 2R16A 2AC1A 1S55A 3WNPA 1AXKA 2R32A 2Q1FA 4DY5A 3THTA 3EB7A 2JEMA 3VWSA 3H7JA 3UWPA 3D0JA 1OF4A 3BTAA 4DE9A 2VVEA 1NXMA 4YM0A 3CO2A 2OT7A 4OHVA 2AEYA 4X4IA 2LM3A 5FYZA 1LCCA 4LKEA 2ZGUA 4MUVA 2DVBA 2ZPXA 4YM2A 1JH9A 3ZXFA 3GHNA 3T2PA 2RJLA 4Q5OA 5C8CB 3H8RA 2VVDA 5FQ0B 2DTWA 5FP8A 2HWC3 3CJXA 3PVEA 1JN2P 1Y7YA 1XYOA 1DGRN 2MNGA 3PVBB 1X33A 1K5MC 4Q4V3 2XQRA 1S4CA 2D5FA 1GZTA 5JVVA 3J8F2 1RVF2 1J1TA 3AKPA 2BP6A 2XBO1 3KSCA 2WQ8A 3GBGA 3I59B 2V5YA 4OZOA 5KXBA 1US3A 5LA0A 3ME2A 3HT1A 2J7UA 1U5YA 1W8HA 2AYHA 2VJXA 2X09A 3GDBA 5J3UA 1RUJ1 3QFIA 1JW6A 3KS7A 1SLCA 1TMF1 4Z07A 3VLBB 4OI0A 1B35A 1D0HA 1QXRA 3NQHA 4IV3B 3CHXA 1I9RA 4FOVA 2QBXA 1HJGA 4WM8B 5LK7B 5DG2A 1M06G 1UN1A 2LCVA 5C6CA 3P1IA 4MADA 2F4LA 2PAMA 2XJPA 1SLIA 1CJDA 3K46A 4JGYA 2KR2A 1A3KA 1QPZA 1U0AA 2OVUA 4JGZC 3N7MA 1HW5A 1R1A3 2W3JA 2EF6A 1JH5A 1QHDA 1QU0A 4XCAA 2R061 5F2SA 3U4SA 3NAPB 2YC4A 4Q4W3 4XIKA 4LEJA 4QKNA 5C5UA 2A71A 1JS9A 3B00A 5CBLA 3R4UA 3FBMA 2VW1A 1SDWA 2D3PA 1FPN1 2RR12 3POIA 4QT6A 4HL0A 2DFBA 2JG8A 3MW3A 4CUGA 2ZA9A 4FFHA 4R9AA 4CA9A 4X4DA 4EN0A 5DTMA 5FYMA 2VD7A 4DEQA 3NXHA 1DGLA 4P14A 4BYYA 1RZSA 4MGYE 4SBVA 1W04A 2IXCA 3PDQA 3VL8A 3WNNA 1NW3A 2VMEA 4MGTA 2JE7A 3K4ZA 1JMUB 4MYEA 5KHIA 4AGGA 1CAUB 3ACIA 4TN7A 3UETA 1AYM3 1PO13 2FDJA 3J7NA 1OLRA 1G9CA 2XOMA 4RR3B 1ULPA 1MS1A 3SR4A 4BIOA 5H9SA 1XB9A 1AYN2 1O4TA 4P9WA 3Q8CA 1FT9A 2E7QA 4CEWB 2Z69A 1FNZA 4IEPA 1JZ4A 4Y1XA 2HYKA 1W6NA 1W9YA 2P1BA 5FXZA 4I02A 3HNMA 2AEZA 4OI4A 2ZMNA 5HBAA 3VD7A 3NZLA 4FPHA 4H14A 1DGWA 5FZHA 1NAEA 1AF9A 4P9XA 4E8DA 2YGMA 4QQPA 4NDWA 1QP4A 1SPPA 4UW6A 5AVAA 4EZ4A 3RJRA 1OCTC 5DRYA 4UFKA 3GZCA 1I5PA 4NIGA 1TVGA 4AW7A 1QZXA 1HV1A 2W91A 3JD72 2DVAA 1VMHA 1RUE3 3VD4A 2PXPA 2PXEA 4O65A 3T3YA 2WUSR 1QNYA 1ZUGA 1BXHA 1ND2A 3LFMA 4Y5Z0 3UJQA 1HQWA 5IK5A 1N47A 3I3QA 4AYUA 2D7FA 5DUUA 2RS13 2Y34A 2HEWF 1UZVA 2SBAA 4QXCA 3NKGA 3U14A 5A70A 4Q0SA 2JDMA 3PUSA 4N7UA 4XF4A 3ZYBA 2WC2A 2W94A 3THPA 2HWF3 4ER6A 3A7QA 3WW1A 3RG0A 4QQ2A 2VUAA 4MGZE 4HT1T 1MVEA 2CGOA 1MZEA 2WA4A 1POQA 4MXWA 3NNLA 1XNCA 2C24A 2AW6A 3ZR5A 2X05A 3HOBA 4P9JA 2WIIB 3Q9OA 4XVHA 2PLV3 4LO8A 5FYCA 5LEKA 3B93A 3I2IA 1OI6A 1PNGA 4Q4X2 1PRUA 1WW6A 1UMHA 4DUVA 5IAVA 4Z5HA 2CGNA 2UU8A 3KB5A 3ZN6B 4Z2WA 4YZ5A 4A3ZA 1EAH3 2QJVA 1O4XA 1GZCA 1V9U2 5FZIA 4QD2A 3JXBC 3U0ZA 3KXAA 4PU3C 1IG3A 1Q8OA 2BZDA 4IE4A 2H6CA 3UGGA 5E89A 3DPRB 4NVPA 5E8AA 4XF1A 1GT0C 3ILFA 3RJ2X 1GWLA 5EZWA 1YI9A 2FBEA 1MZ5A 1DLCA 3WDWA 2WT1A 4IA8A 3SITA 4QX2A 2HCNA 4L8QA 5ERLA 5EXOA 1ULCA 4CDXA 2JIJA 5A7LA 3IAPA 2WN2A 4CXWA 3P5BA 3LFPA 4NPMA 4CDUA 4A3XA 2W46A 3VUOA 1NX9A 4C0BA 5GLUA 3AP4A 4QKBA 3CLPA 2JE8A 4YW4A 3KVBA 2E26A 3NWKA 5FZFA 2EAKA 3K3NA 4TLGA 3RYKA 4AQSA 2QDNA 3A9YA 1H9PA 3KHCA 3E97A 4ZXEA 1LOCA 1SLLA 2PXTA 2XBO3 1ZREA 3M4FA 1DYPA 4N9IA 3GHMA 2PHUA 2JG9A 3POSA 1GQPA 4BQYA 3AP9A 3WP6A 4GA9A 2G9GA 2B7YA 3MV01 1AUYA 4D8MA 2VXJA 5HV0A 5E16A 2D44A 4XFCA 5CU1A 1S0IA 4P08A 4GH4B 1PRAA 4NWWA 5I0DA 3U4XA 4ZS3A 1J3RA 3WP3A 5HCHA 3TOJA 1NA1A 1RUJ3 2YB7A 3PU3A 4FP3A 1TMF3 2LS6A 3WUCA 2KZ8A 1IKPA 4COVA 3BYWA 1DHKB 2EICA 5CNAA 2CL2A 3PTYA 5FP3A 5C3OA 5FO7B 3POWA 1YIPA 2DCZA 4EZHA 3RMYA 2WS91 1C8M2 2H0VA 4XJUA 4FOYA 3HN1A 1NCRC 1F5FA 1XYNA 4YG1A 4XAAA 2TEPA 3OGJA 1DBNA 3PJYA 5IT6A 2ZXQA 2G19A 1WCUA 3AX4A 3OYWB 4UBGA 3ST7A 4QPIB 2YC2A 1DZRA 2R063 4B8EA 2Q1ZB 4GMP1 3JBG2 3RZJA 4PIXA 1MS9A 4IDZA 3CMGA 4LO6B 4RS5A 5FBJA 4GWIA 3BTZA 1XE7A 5FAXA 3RZGA 2Q8CA 2WLPA 1WCQA 1FPN3 1HQLA 1H6YA 1VBA2 2HWE1 2OPKA 3NO8A 4XF0A 4AGRA 1DQ1A 1FAYA 1UW8A 3TN92 1COV1 2QQNA 4QWNA 3PTRB 5DXDA 3WR0A 4CUCA 3MFCA 5DAXA 3OEAA 3VV1A 3BOPA 2LYKA 3TEXA 3QOWA 1SBFA 2XJSA 1PNFA 3M70A 4W50A 4MHRA 4YLZA 1LULA 5LRRA 4IGQA 1OA3A 2WNVC 1D4VB 4YVWB 1UZWA 1J83A 1NLQA 5FREA 4HVRA 4OB4A 1DZQA 1UU6A 3GCXA 3OBAA 2PXJA 4AVTA 2O0OA 4S2GA 3ZHMA 5F5QA 5LA1A 2VMHA 4YM3A 1REFA 1RMU2 2DBNA 3KV6A 1QJX1 2PHTA 3CEWA 3LGRA 4QQOA 4XC9A 5E88A 4CEYA 1MFQC 3HNYM 1NCQA 1Q8PA 2R1DA 3SQOA 4UYBA 2YBDA 2R0HA 1D4M1 1DYOA 1W2OA 1WZXA 5A32B 2GRMA 1O3QA 1RUG1 5T5PA 3SC7X 3ZKUA 5FYUA 1MS3A 2FD8A 2X29A 4HOOA 4YVSA 2XVKA 4S2DA 3OTFA 2RE9A 2HSGA 4YW3A 2BVVA 1SLAA 5A3MA 5FZ4A 1H8VA 5A7NA 3VKLA 1CZTA 3PMSA 4QGNA 4XCBA 1ZRCA 1CIYA 2P3IA 1OD3A 4GJYA 1OLMA 3RPQA 3W20A 2AGSA 4NO4A 1BDHA 1WGPA 3FLPA 4XUPA 4YW6A 4BQWA 5JWPA 4Q0UA 4AXOA 4EYUA 2R041 4P9YA 1RUH1 3C8XA 2EIGA 1JYCA 2W39A 2WNEA 1XNDA 1ULOA 2WNVB 4Q0QA 3SISA 5FZOA 3ENRA 3ZSMA 1U5IA 5KHGA 1F9KA 1BYHA 3AP6A 1X9TA 2JIGA 5FYSA 3HIFA 4KWLA 3OQOA 4Y22B 2VUCA 2BGOA 1HB4A 1ZBA1 2ZAHA 3NSTA 3R1FA 4QM8A 3VBSC 5HV4A 5CG9A 3UYJA 4ET7A 4I01A 4DQAA 1ALYA 2BGPA 1CJGA 1ZRRA 3GJBA 5T50A 3IIAA 1ONAA 3WF3A 3VZNA 5KHHA 2WL1A 1KQRA 1AL21 5FBZA 3BUCA 4HZFA 4RFRB 1WH6A 1IGOA 4UFJA 5ACA1 1W6PB 3O1MA 1KGYA 4ZKTB 2XGXA 2HWD2 5IAXA 4AFAA 5SV5A 2XHNA 3LA7A 1CWPA 1X7NA 3SNMA 1G9DA 1D2SA 3U75A 4P00B 3U3WA 2XG3A 2PIJA 3RI9A 4CE8A 5DZEA 5HPOA 5C8CA 1NYWA 4K8RB 4GIQA 4XJAA 3KHBA 1DULA 3WF4A 3NVCA 3OBZA 4X6QB 4MZUA 4HONA 1XE0A 3EQEA 3JQWA 4OUMA 3KCYA 2CV6A 1ENRA 5DTRA 4ITCA 5F39A 3POFA 1UL9A 2OPWA 3DYOA 4WVVA 3ZFEC 1Z7S2 1VAMA 4LITA 2YG0A 1Y3TA 4I6TA 4PIYA 5FDBA 3B9CA 5F32A 4NIAA 5C3RA 1UY4A 4LHLA 4FXGB 2BRTA 4A6SA 4B4QA 1NERA 3ZIWA 1W9FA 3BPSA 2RM21 3BGAA 1GZ9A 2HWC2 1R081 3I59A 4OZXA 2Z79A 4XFAA 2WFF1 1QH6A 4IV1C 5LK5A 3MIGA 2FDKA 2WR9A 4YW2A 3QWGA 1MQTA 3T08A 3ZOIA 5KR7A 1SCSA 4QX8A 3IMNA 3VN4A 1X57A 4QHBA 1SMVA 3APBA 4IV3A 1D2QA 2DBIA 1JTZX 2VC9A 4D7TA 4WM8A 2ET7A 1H2NA 1OHFA 2WNUC 3T4HB 1EUTA 4IEZA 4LHNA 4X4BA 2FMDA 3PUQA 1S0CA 3LOIA 3AJZA 4BK4A 1GQHA 1ZRFA 1CPNA 4HVOA 1R091 4EZIA 3FHQA 4XF3A 3VDDA 5DZGA 3ZFFB 3ILRA 4HLTA 2WS93 1BKZA 2QQWA 3OQMA 2TBVA 2YBKA 3NAPA 5FZEA 4JZRA 4ARYA 1C5IA 3UGFA 2J1TA 2MEZA 3GZEA 1BMV1 2BNNA 3OY8B 4YARA 1GFF2 3VHNA 1MACA 2ZZJA 4G9SB 4BH9A 3FZ3A 4E9KA 5J37A 4GMP3 4UW4A 5FPXA 1YLLA 1R64A 4MX3A 1OMIA 3IM0A 2XJ3A 1LHUA 3H3LA 2W47A 4OUSA 2GN3A 4NHLA 5A3NA 1G7YA 1QWRA 2HWE3 3U1XA 1VBD2 3O1PA 4BIFA 4PI0A 1COV3 2K46A 3AZZA 5FXVA 4GZ9A 1CAUA 2WAOA 1XRUA 2RS33 4DXTA 1BEV3 4RR3A 3R09A 3ZKCA 1OLQA 2Y6GA 3IPVB 3OD4A 2WZR2 1WW5A 4D94A 3VL9A 2FFHA 2XDVA 4KG0A 1I6XA 5FYYA 2WNUB 4P9LA 3G7DA 1LODA 2I2SA 2JDHA 2Y38A 1GZWA 4U2AA 4A6OA 1RB8G 1U5XA 2A1XA 1ZS4A 1AYM2 1SFNA 2ARBA 4Q27A 3RDIA 1HB1A 1DDLA 3CECA 4D0QA 3ZXDA 2H0BA 1UOGA 4CDWA 5K8SA 1V6KA 3AZWA 1QJX3 2JECA 2OZ6A 1ND3B 3ES1A 4QDRA 1J3PA 2Q8OA 3ITQA 3AB0A 2DURA 2YV8A 1LJ7A 5CIRA 4HG6B 5EJ3A 4E2SA 2Q1MA 2UYAA 3AKQA 4ZS2A 4X4GA 2LYRA 5DUXA 1RUG3 5CG8A 2FZ2A 2ZHLA 4TZDA 2F4PA 3LEMA 5FPUA 3MIFA 3GXUA 2E63A 5JPMB 2IXIA 4XQ4A 1POUA 1O5LA 5L7OC 2ZEZA 2HEVF 4FN3A 1LLIA 1GP4A 2W9XA 3RZKA 4F83A 2Q0AA 2WUHA 5AFEA 1Q8VA 1Y43B 4DEVA 3BKZA 3NV3A 2BJSA 1YXWA 3EUSA 2ZOEB 1RUE2 4XJ8A 4EN8B 1KS4A 1TQ5A 2RJ2A 4N53B 2VTXA 5JSPA 5KXDA 3DN7A 1O5UA 1J58A 3B69A 4OULA 1PX4A 2B4KA 4H7MA 2R043 1E3OC 1EP0A 3CJIC 1IPJA 3RI8A 2OQ6A 1AJOA 1LENA 1RUH3 2RDRA 4RGGA 4XBQA 5JOXA 2EA7A 2WWUA 3C7FA 4I09A 4FPCA 5HCFA 4I3GA 5BNQA 5LWBA 1S1AA 5DQ0A 2KD7A 3HQUA 3LSEA 4PLMA 2YFZA 2ZZQA 1GOHA 1VBB1 5DSXA 4AQ6A 2HWF2 1ZRDA 2AXUA 2GNTA 1S0GA 4BB3A 4CU9A 1ZBA3 4BK5A 2BTVC 2O4AA 3ZN6A 3O1RA 5LEJA 5FPLA 3Q8BA 4AZZA 1US2A 2XKPA 4LBQB 4FTEA 4HXCA 5J1XA 2QQKA 2XR4A 2PLV2 4FPKA 3ZYGA 1CVNA 3DPRA 2EIEA 1AL23 4GKYA 5CFCB 4PJYA 5FZ6A 5L7OB 4CDQB 5JOYA 3SCGA 2DWRA 2PXBA 4P9IA 1HXS1 4OHXA 5FY4A 4BCUA 2X5IA 3MGUA 4E8CA 5EJZB 4BMEA 1SQ4A 5CVRA 5F5AA 1NQJA 3VBUC 1W28A 1V6LA 1KDMA 2B8MA 1UX6A 3AZXA 1PK6B 1O4YA 4FOQA 4LBLA 5DAVA 3VBRC 4AEMA 3MLKA 3NV2A 2ZJCA 1CQTA 3GZDC 5EQUA 4AVCA 4HKLA 2BYVE 5BNNC 1QMJA 4CP2A 4KG8A 3BB6A 3DL3A 3E5UA 2UY9A 3PVNA 5FRAA 2ARAA 4XUNA 3H8OA 3GZUC 1RUC2 1WCDJ 1XNTA 2BBAA 4LK6A 2EXKA 1CESA 1GOFA 2VNGA 3MIDA 5FUIA 3ZYRA 4B7KA 1S0DA 2YHJA 4BQ3A 1AR82 5A33B 3LZZA 5GJ6A 2PXFA 1GP6A 1QIQA 2RM23 3ZDSA 1G8WA 1HF0A 1R083 2YU1A 4YSFA 3POYA 3AMMA 3B7HA 3CROL 4YBAA 2WFF3 4NHMA 4GH4A 1H1AA 3TEPA 1SACA 3WY6A 4M4RA 4H2AA 2ZGKA 1UTXA 1VBE1 2UWCA 1E5SA 1H2KA 2BFUL 3OQNA 4YM1A 3X29B 5LRSA 3KQRA 1YFWA 1VE0A 1UCXA 1NLRA 2YROA 4AGVA 1WW4A 1UY0A 2Y60A 2RDQA 5EWSA 3IN9A 4YW5A 3DM5A 4HPKB 1CAWB 4GALA 4PU4C 1QOSA 3OP9A 5LBFA 5F1RA 3LIGA 4IEOA 1RUJ2 1OKOA 1AR91 1Y7BA 1POV0 5FLJA 4LNVA 2BGCA 2JE9A 1LMB3 2W2IA 5K0UC 1IZ3A 1REEA 3OYWA 4FXKB 2R071 4YZ4A 4WM7C 3J7LA 4QPIA 1ENXA 1U5ZA 4Y20B 1F35A 5FPAA 1VAKA 2QCSB 3N9NA 4AFDA 2DF7A 4LKFA 2R1BA 2VZQA 3I54A 5BNOB 3DYPA 4F3JA 4LPLA 3RSJA 2F6BA 3WT3A 4CTEA 4D7YA 5JSOA 1HB3A 5KC5A 4M0NA 1O3RA 1WD4A 2D5HA 3MHZA 1PVC2 3A9XA 3JXDL 1DCSA 3OD0A 4ER3A 3WCSA 1VRH2 3FLTA 3LD8A 4UF0B 3MIEA 4NIHA 5FK8A 3PUAA 4A2UA 4CP9B 3ZYJB 4CYDA 4NAOA 2CWSA 2ZAAA 4QDSA 2V3CC 4HRAA 4O7XA 2PMWB 4OCTA 1AXZA 3NDBB 1BBT1 2PHRA 3PIJA 4WV8A 4QB1A 5IK8A 1N1VA 2AXZA 4KI5M 4YVWA 3ZDVA 3UFDA 1CR7A 3B5LB 1PO22 1GBGA 2DVDA 4IE6A 1W9WA 2XH6A 5CKMA 1JHJA 5FYBA 4BDVB 2NZ9A 3LAGA 3KM5A 2IU7A 3E1F1 2EF8A 2B5HA 1UZ0A 1C1FA 3K4DA 1W2UA 3I2OA 3MUY1 3THCA 4I6UA 5FWEA 1KEXA 4KNCA 3EJKA 3I8TA 4QPGB 5DDJ1 3S5AA 5A32A 3I2KA 4WM7B 5KWRA 4K9SA 1LU2A 1JOBA 4N43C 4QKFA 5LBCA 3BIEA 5JXIA 2Q4SA 4COYA 3MPBA 2FJRA 2LLWA 2WRAA 2ZX0A 4QXHA 3MUZ1 3WQ0A 3HR9A 5A3OA 3H3UA 4L2NA 5GALA 1AR71 1ULGA 4RFT0 1ZBE1 3F2ZA 3WP5A 4LE4A 4AHWA 3P3PA 4CU7A 4JRLA 1OF3A 2HWB1 1K42A 2O8QA 1ZVVA 1CN1A 3OMTA 1GR3A 4PLOA 4LK7A 3NL1A 3WG3A 1S0JA 4JHZA 4QGLA 2RMU2 4R9DA 1W6MB 4LBJA 2G1MA 2WAAA 2OFYA 2VH9A 5LW9A 3TEWA 4YW1A 1DYKA 1WETA 3ZXKA 3WNOA 4X4FA 4E4ZA 1U12A 3RZLA 1U2ZA 1IOAA 5FYTA 2IXLA 2ZGPA 1JFSA 2E33A 4AEDB 4EQVA 5JIUA 2PAKA 4WVMB 4UOJA 1R63A 3OUHA 4AAXA 4AAPA 2FDHA 2YC0A 3EHKA 2ZS6B 3KF3A 3ZX7A 1WBLA 1OA4A 1EFAA 2AZ5A 1UYXA 2FCTA 2WWJA 1VBB3 3NNFA 4QX1A 3VBOA 2IUOA 2EXHA 3WQ7A 5K9YA 3VDBA 1UXXX 4OQ8A 1W8WA 4K8FA 4CPBD 4BLIA 1RUI1 4E4HA 1S2KA 3WOGA 2D6MA 1UMIA 2QZ2A 3I2JA 3WVJA 1W6PA 3R4SA 3AP5A 1VPWA 4XE9A 5FPZA 3AK0A 2IVIB 3BODA 4LQRA 1JOPA 2J1RA 4JHTA 3WINE 1RZRD 4BZ4A 1Q56A 1OOPC 5ISLA 4IE7A
chains in the Genus database with same CATH topology
5JI7A 3HD8B 4IEYA 2BNOA 3RYPA 1ZZ9A 1HXS3 4KWKA 3R6SA 2DTYA 4QQHA 4FPGA 4XBNA 4AFMA 2YZ4A 2VULA 1K5MB 1NY72 4M0HA 1LTEA 3WG2A 4BQ1A 3QBQA 1RL3A 3AXEA 1PHMA 5CA6A 1JFTA 1GICA 1QJY2 3PVOA 1C3HA 4Z5DA 3QCWA 4X4EA 1XWRA 1YYNA 1OQEA 1RUF1 4I0WB 1MEC2 1OA2A 2XLFA 2O1QA 4XPVA 2K2SA 1A6CA 1ZZBA 3E6BA 3JU9A 1GLHA 3IBMA 4XEZA 4J1XA 3A0KA 3FHIB 1QQP2 2XL9A 5TSWA 4Q8KA 4BM8A 3N7KA 4B4RA 3C2UA 2PHWA 5C4WC 1N3PA 4XHBA 3HWJA 4QPYA 1VBE3 2PUCA 4DS0A 3NJZA 3IWZA 4JGZB 1LOBA 4GB31 2DCJA 5H9PA 1OOPB 3AZYA 3TB0A 5AFBA 3KT7A 3ZFFA 1MZFA 2GU9A 2WQZC 1CAXA 3RNSA 4U36A 1I5ZA 4QQLA 2PHFA 3OY8A 4HSLA 5FMOL 4RL7A 2R073 1N1YA 1H4HA 1UIKA 2PE5A 1UKGA 2WT2A 2C5DA 1ULEA 4R4ZA 3ZN4A 3ZN5A 5GLWA 4LR4A 1RHI2 1RIOA 1B0NA 1VBC1 1RUOA 1PGSA 2ZACA 1LHOA 2BFUS 2KA3A 2DCKA 1D0GA 4MVTA 2OZJA 5HI0A 4ISRA 3WX5A 1HV0A 3VZMA 4Q4Y1 4AVSA 1ASJ1 2D6OX 2ICPA 1CD3G 5AC92 5KC6A 4AVBA 3IPVA 1BBT3 1RVF1 3J8F1 1OSGA 2HWE2 3VGIA 1WH8A 1ZZ6A 2D93A 2A6XA 3AYDA 1COV2 4K40A 1XU2A 5FLIA 4B29A 3HAGA 4L97A 4Q1PA 1LKNA 2RS32 4F8AA 1BEV2 4LBOA 1HLCA 1LOFC 1OSLA 1MS0A 1C5HA 5CFDC 2OR1L 3KCXA 1ND3A 2ZGTA 2O8OA 3L2HA 2Y26A 2A3XA 4EJRA 2LTNA 5DDJ3 3URFA 4AFCA 2DVGA 1QNWA 3ZFGA 1QQAA 1OPOA 1EV12 2JENA 3MICA 5BNPC 3MZHA 3CL1A 4XIOA 2GMMA 4IEWA 1WLCA 4AVAA 1UZYA 2QQPA 5ABJC 4QM9A 4COWA 1ZVFA 5EYYA 4UW3A 1AR73 2LYJA 1ENQA 3TAYA 4HN1A 2A6VA 1RUG2 1ZBE3 4Z82A 1DQ6A 2HWB3 4Z58A 4N53A 4LA3A 3T2TA 1AXYA 2IVGA 1L3JA 3ZXJA 2D97A 2QUOA 5GM0A 2XUMA 3U11A 4FPOB 2OA2A 4MGKE 3M3CA 3VKFC 5J96B 2LALA 3AMPA 3WV6A 5I91A 3FYAA 3G5GA 4ATEA 5DUWA 1A78A 1GKBA 4OVEA 5D8AC 3GZTB 5I0UA 4DXZA 1SEFA 2Z2SB 3JZVA 1AYN1 1HQNA 1XNKA 4JCXA 4LBQA 3D4KA 2HINA 1RUI3 1YO8A 3IDCB 1X82A 2Z5WA 3WG4A 2DYCA 1VB4A 2A3YA 2ZX1A 5GLVA 4M3CF 4OI1A 1ZBA2 3FUQA 5CFCA 4LLFA 3VZLA 4CDQA 4QXKA 2JXAA 5GZGA 2RHPA 4FBIA 4K1ZA 3O0VA 1BK1A 2DUOA 4H3WA 1PK6A 2X53S 1YNAA 2VECA 4FPEA 3EXUA 5I8SA 1MZ6A 3JD71 2K9ZA 1ZAYA 5GZDA 1GV9A 1H8TC 1W6OB 3RRDA 5F6LB 1FMD1 1ZYBA 5A33A 3CF6E 3K48A 1RUF3 2BBVA 3GN5B 5D8AB 2WQ4A 4M3CE 1B09A 1ENSA 4HK9A 5I8YA 5JMCA 1DLLA 3DF0A 4IL7A 1Z78A 3H8UA 4I0AA 4K20A 4DB5A 2D3RA 2PAEA 4LHKA 2RM22 4A7YA 4JQDA 1SLBA 4I0BA 4H7LA 1YIFA 1PERL 2ES3A 1BJQA 1CPMA 4AI8A 1NCRB 4Q4X1 2QE3A 4EN9B 4GB33 1DGRA 1VAVA 2ENRA 4LTAA 4Q29A 3M8LA 1RUNA 4FPJA 2E7AA 3W59A 1S0FA 2QNKA 1CONA 1H1IA 1EPZA 4RQPA 2X8KA 3MEPA 3JB8A 3ZXAC 1MS5A 4OHYA 2EXIA 4YZ3A 4JDNA 4BA6A 5J48A 4BPZA 5BNOA 1DGWX 3WW3A 1DQ5A 3UJOA 1YFXA 4KU8A 3E5XA 1LCLA 1IS6A 1BCXA 2HKXA 1YUDA 4M3CB 1B35C 4AWDA 2IXHA 1VBC3 2VW0A 2JDZA 3A4UA 1V6OA 1FV2A 1W0PA 3H50A 5T5JA 3D6EA 1C1LA 4Q4Y3 1ASJ3 3FC0A 4JGYC 1PVXA 3N7LA 1QJU2 1LEMA 1WLDA 3R4DB 2RS51 2ARXA 2VOKA 2C1FA 3I7DA 3J8F3 1RVF3 4Q26A 3VZOA 4FTBA 1CGPA 4IEQA 5F9TA 4IWRA 1W6QB 2LYPA 5FMOS 2P2KA 5B2GB 1HRI1 3BPZA 3JCIA 4Y1VA 1FOD2 3PJQA 2MPFA 2O49A 3KGZA 1LCDA 2JG8C 1YRZA 2NLRA 4QPGA 4B7EA 3KJXA 2AUWA 1OQDA 4WM7A 4J6GA 1PZ9A 2R63A 3BCWA 1OPMA 4A7ZA 5DUVA 4XW3A 1NEQA 1F31A 1SFYA 1O91A 4XFIA 1X8EA 4RGAA 5JLVA 1DG6A 2EVXA 2P34A 2QDRA 5JSRA 2PHLA 5FQ0A 2B45X 4X6RB 5J7MA 2A3WA 4LLOA 1MR5A 4X8PA 4AI1A 3I2DA 2B5AA 3JBG1 2YYOA 2G4IA 1W6MA 5BV6A 4FPFA 4PCRA 2JVLA 1V6IA 4JTNA 1FXZA 3TRSB 4B4PA 4LBMA 4AEDA 4CZSA 3TN91 3VBSB 3NW4A 2W68A 3GBWA 4WVMA 4KL1A 2PPXA 2IVBA 1NXD1 4Q4V2 2XVGA 4GMP0 2CYFA 3B7MA 1EYBA 3J4UH 4AEJA 3HZIB 4LA2A 4HETA 2JG8B 4DY3A 2PELA 3O14A 4GKXA 4E2GA 4IESA 3S6PA 3WUDA 1HKDA 3L1PA 3UKNA 4L99A 1UPIA 2A75A 2IXKA 1AR61 2BEOA 3WP4A 2Z42A 2E9QA 4LO7A 1QQBA 2GC0A 1RMU1 1RPEL 4AK3A 3QH6A 2H6BA 4UBHA 4R8HA 4NN0A 4AI2A 4ONUA 5JIAA 4FTSA 1KRIA 1V6MA 4I8TA 2L8NA 1GNHA 1WUVA 2GNMA 2ICTA 3ZFEB 3LISA 1CJPA 2JICA 4B3NA 3FFQA 3AMHA 1K5MA 4FBFA 1R1A2 2OUJA 2PYTA 3AJYA 3B3QE 4CP0A 1NOVA 1O3SA 5C8WA 3LCPA 4O9EA 4Q4W2 3GZAA 3JD73 4XXAA 3JB4C 4AFBA 2KEIA 4HSJA 3V0AB 4IV1B 3KGLA 3MFAA 4AEKA 1FMD3 1CAVB 1WLWA 5I0TA 2IZWA 3KLSA 4E4DX 1WA4A 3S8QA 4DRVA 3O9XA 1WCSA 1RJ8A 3H1MA 1PM7A 1PO12 2ZGSA 3QOPA 4RD7A 4BLJA 4HFSA 4CDXC 1Q8SA 2MEV1 4AG4A 4JGZA 4FCAA 4CDUC 4Z8BA 3U10A 4YGDA 3M2MA 1PGL1 2AXVA 4AHXA 2AR6A 4MCXA 2PUAA 3ZXGA 3BALA 3QF3A 3BDNA 3SH3A 2CAVA 5IUQA 3FWEA 4EWEA 1D4M3 2VG9A 4EWAA 4HVQA 5I0RA 3VHRA 5KXCA 4QGMA 1O4ZA 3GALA 2WSVA 2XJRA 3M1HA 4MXWB 3VKMA 3D8CA 1MS8A 5L19A 2JX9A 2XI8A 2JG9C 3NV4A 1ZM1A 1DW9A 2GNBA 4D7SA 1FYUA 3SCFA 3ECQA 5FOBB 1LGNA 4D69A 5FLHA 1QOTA 1KJRA 4SLIA 3FBYA 3W58A 4QX5A 2R072 1NA1C 3CU7A 3S7EA 5JOZA 1C4RA 2ATFA 2KXLA 4S2FA 2N7GA 2PFWA 5CAZA 2BW8A 1Z7S1 2RS12 4K7JA 4WVWA 1H0BA 3INAA 1QGLA 2GC2A 4YGCA 5FOJB 1J59A 1VB2A 4Y1UA 2GSYA 4CDXB 1JXNA 2HWC1 4XZPA 2RS53 4CDUB 2GH2A 1H1MA 3ALQA 2ZGLA 2TNFA 4HBNA 4BE3A 3IKWA 1HRI3 4RS5C 4XTPA 3V0BB 2H8RA 2QKDA 1SLTA 3PNAA 1UU5A 1PGW1 1E57A 2ZGQA 3ZXEA 5ACA3 2JG9B 3VBHC 3RS6A 1EAH2 1PIV1 1AJKA 1XNBA 2IVQA 2C9AA 5T5LA 4RHV1 2YPJA 1NA1B 3DKWA 1NE4A 4XFGA 1NQDA 1KITA 3AP7A 3CJIB 3MIHA 4HKWA 2WSUA 1X8MA 4W6WA 1H2MA 4XHXA 3UV9A 2JKBA 1FX5A 3TYJA 2LYSA 4LULA 4CEYC 1ZBE2 1NCQC 4FT8A 4JC1A 1UU4A 1GQGA 1VBD1 5EV7A 2BNMA 4BHPA 1HRV1 3TN93 2E7TA 2TUNA 3FYMA 3QD6A 4YVSC 3M3EA 2A7AA 4PDWC 4EWDA 3QQ6A 2XBO2 4XETA 3A0NA 4P5HA 1H30A 2WZR1 1CQ9A 1RUD1 2D6LX 4JQRA 4MCTA 3QLQA 2XVLA 3DUIA 3MYXA 2IFWA 1AYM1 4R9CA 5DG1A 2DUPA 3VBHB 3LOBA 1AR63 2SLIA 3UL2A 1LOAA 1IC8A 2AH2A 1TMF2 3WDTA 1S7EA 2ZCWA 3ZMOA 4WBBA 1R093 1RMU3 3VBUB 2R6QA 2UWBA 4C1WA 3VBRB 3HMYA 3ZVXA 1WMEA 1BQPA 1ZA4A 4X8NA 5BNNB 3S0MA 4A7KA 4R4XA 3UKVA 3O0XA 1HX6A 2AENA 2R062 1W6OA 2VQAA 1OFNA 1Q43A 2I74A 1Q8QA 3ATGA 3MPPG 4FQ4A 3ZSEA 2A70A 4Q8LA 2VGDA 1DWKA 2GZUA 1RUE1 2CWMA 1FPN2 2D98A 1SBEA 2YXSA 3GN5A 4YVSB 3VKOA 3ZXKA 2D6NA 1QH7A 4M00A 4HK8A 2Y0IA 4GXLA 4PDWB 4R9BA 2XLGA 3FJSA 4TSVA 2WZPP 3V64A 4Z92B 3OF1A 4URTA 4YG3A 3K51A 4AF9A 4LO5B 4ASLA 1ZX5A 5JDBA 3MLFA 2XJTA 2NMOA 3SCHA 4LUKA 2ET1A 4W6XA 4X4HA 1Z0HA 1URXA 1WD3A 4INDA 5C8CC 2DFCA 2WT0A 2B9UA 2Y0OA 2ZTNA 1KDKA 1RTVA 2MEV3 1NCRA 4I2OA 3RZZA 1DQ2A 5K0UB 3LSDA 3OBRA 2VMGA 4PLNA 4KGQA 3RYRA 2OIIA 2ZX2A 2YUEA 1N1TA 3BOWA 4FSJA 1DIWA 4IVZA 5J09A 4TWTA 1AU7A 1LGCA 1UPSA 4GB32 3E6CC 3R05A 1DZTA 2ZGNA 3AKSA 4ATFA 2D40A 1MQTC 2CTVA 1XE8A 4V1PA 4YG7B 4M3CA 3TNPB 4L9BA 5K98B 3MDPA 3VK0A 1H9WA 1R69A 4X4CA 3L9JT 3VBFC 4WM8C 3AZVA 1QDOA 2WNVA 1XQNA 2W52A 2VW2A 1IS3A 2A6ZA 5FFOC 2PUGA 1Z7S3 2R30A 1QP7A 3VDDC 1VBC2 1RUC1 3U07A 4Y22A 4PU8A 2LYLA 4Y1ZA 1IKQA 5IK7A 5T54A 3NAPC 3GBFA 1AR81 2V73A 3GNEA 3WW2A 1JBCA 1W6QA 5HCAA 4YZ1A 1TME1 4Q4Y2 4L92A 1ASJ2 4AQTA 4YYOA 2GDFA 1X50A