1ZZJA

Structure of the third kh domain of hnrnp k in complex with 15-mer ssdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
b'AMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*CP*CP*CP*CP*TP*CP*CP*CP*CP*AP*TP*TP*T)-3'
molecule tags Structural protein/dna
source organism Homo sapiens
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
total genus 20
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zzjA00
4BA1I 2CTMA 4WALA 4B8TA 2AXYA 2FMRA 2E3UA 3U1KA 5C0XG 4WANA 1WVNA 2JA9A 4LIJA 2ANNA 2CTFA 3V69A 4QMFB 4JVHA 2HH2A 2OPVA 1K1GA 1VIHA 2JEAI 2BL5A 2PY9A 1DTJA 1TUAA 2PQUA 2HH3A 4JVYA 2JE6I 3AEVB 2NN6G 2CTKA 1X4MA 2CPQA 1ZZKA 3VKEA 1KHMA 1ZTGA 1VIGA 2CTLA 2JVZA 2YQRA 4NBQA 1DT4A 1ZZIA 2MJHA 4AM3A 1J4WA 2Z0SA 4IFDG 2OPUA 2BA0A 3L7ZC 1J5KA 2DGRA 4OO1G 4AIMA 2JZXA 5JEAG 1X4NA 2CTEA 1ZZJA 2ANRA 4BA2I 1WE8A 1EC6A 2P2RA 2CTJA 5K36G 2JEBI 2QNDA
chains in the Genus database with same CATH superfamily
2X06A 2AXYA 4JI2H 3J7AK 4DV3H 2FMRA 4B3SH 4DV7H 5LL6b 4FJUA 4DR6H 4NZRM 1Z2IA 4LF5H 4WANA 2FPHX 4LIJA 2UXCH 2LF0A 4JV5H 3KDKA 1IBKH 2OPVA 5FLXW 1N36H 1K1GA 4PDBA 4JVHA 2BL5A 2UXBH 1TUAA 4LFAH 2JE6I 4GKKH 2CTKA 1XMOH 1SEIA 1ZZKA 4DR1H 3VKEA 3J80W 1ODHA 4YY3H 1VIGA 2JVZA 1NXUA 1DT4A 2Z0SA 2UUAH 2OPUA 3L7ZC 1I94H 2UUCH 4OX9H 2K1HA 1N32H 1S20A 1WE8A 1V8CA 2P2RA 2PQUA 2JEBI 3UOEA 2CTMA 4B8TA 4B3RH 5IT9W 4H8AA 4LFBH 2LRRA 4X65H 3U1KA 4JI3H 5C0XG 1HNZH 4JI4H 1WVNA 4DR7H 1I6UA 4NXMH 1X0AA 3V69A 1V9NA 5A2QW 4NZTM 2VQFH 4EC5A 2E5LH 4DV1H 2UUBH 2M6QA 4JVYA 3OETA 2NN6G 4OD6A 4LF9H 1MSZA 4E9JA 1F0XA 2CPQA 4AQYH 4LF7H 1KHMA 3T1HH 4DV2H 1XNQH 2PT7G 2VQEH 3JAMW 1J4WA 4IFDG 2G8YA 3GABA 2UU9H 1N33H 2DGRA 5JEAG 5IWAH 1X4NA 3FAUA 3I0PA 3RF2A 4DUYH 1FJGH 4JI1H 1VBIA 4G08A 1IBLH 1WTJA 4WALA 1AN7A 1PQXA 3T1YH 4B8CD 3SB1A 1HNXH 2HHHH 2JA9A 4JI7H 2ANNA 2CTFA 2D9IA 4QMFB 2HH2A 3QD7X 2JEAI 2O4CA 1FKAH 2HH3A 4X66H 3OSSD 3AEVB 2FFMA 4JI5H 1X4MA 4LF6H 2A1SA 4GKJH 4DV5H 2CTLA 4NBQA 2CWFA 2ZQEA 4AM3A 4X64H 4JI0H 2BA0A 1J5KA 5BR8H 4DV0H 1IBMH 1EC6A 1XMQH 2CTEA 4X62H 1ZZJA 4B3TH 4JI6H 2CTJA 1XNRH 5K36G 3GR5A 4K0KH 4BA1I 3NCVA 1UG8A 2E3UA 4LF8H 2F4VH 2M8WA 1S03G 4DR4H 1N34H 1HNWH 4DR2H 2CWHA 4DUZH 1J5EH 3EZJA 1VIHA 4DV4H 3GKUA 4JYAH 2PY9A 1DTJA 2LTLA 3J81W 4OO1G 2CPMA 2ZM6H 4DR3H 5LMNH 4LFCH 4OCHA 2VKCA 4JI8H 5LMUH 2LTMA 4B3MH 1ZTGA 1ZZIA 4LF4H 2YQRA 4YHHH 2MJHA 1X9ZA 4KHPH 4DV6H 1WHRA 2Y3MA 5DT9A 2JZXA 3KDGA 4AIMA 3OTOH 4FJSA 4DR5H 1HR0H 2ANRA 4BA2I 4NXNH 1XRHA 2QNDA 2UXDH
chains in the Genus database with same CATH topology
4BA1I 2CTMA 4WALA 4B8TA 2AXYA 2FMRA 2E3UA 3U1KA 5C0XG 4WANA 1WVNA 2JA9A 4LIJA 2ANNA 2CTFA 3V69A 4QMFB 4JVHA 2HH2A 2OPVA 1K1GA 1VIHA 2JEAI 2BL5A 2PY9A 1DTJA 1TUAA 2PQUA 2HH3A 4JVYA 2JE6I 3AEVB 2NN6G 2CTKA 1X4MA 2CPQA 1ZZKA 3VKEA 1KHMA 1ZTGA 1VIGA 2CTLA 2JVZA 2YQRA 4NBQA 1DT4A 1ZZIA 2MJHA 4AM3A 1J4WA 2Z0SA 4IFDG 2OPUA 2BA0A 3L7ZC 1J5KA 2DGRA 4OO1G 4AIMA 2JZXA 5JEAG 1X4NA 2CTEA 1ZZJA 2ANRA 4BA2I 1WE8A 1EC6A 2P2RA 2CTJA 5K36G 2JEBI 2QNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 I;  2CTM A;  4WAL A;  4B8T A;  2AXY A;  2FMR A;  2E3U A;  3U1K A;  5C0X G;  4WAN A;  1WVN A;  2JA9 A;  4LIJ A;  2ANN A;  2CTF A;  3V69 A;  4QMF B;  4JVH A;  2HH2 A;  2OPV A;  1K1G A;  1VIH A;  2JEA I;  2BL5 A;  2PY9 A;  1DTJ A;  1TUA A;  2PQU A;  2HH3 A;  4JVY A;  2JE6 I;  3AEV B;  2NN6 G;  2CTK A;  1X4M A;  2CPQ A;  1ZZK A;  3VKE A;  1KHM A;  1ZTG A;  1VIG A;  2CTL A;  2JVZ A;  2YQR A;  4NBQ A;  1DT4 A;  1ZZI A;  2MJH A;  4AM3 A;  1J4W A;  2Z0S A;  4IFD G;  2OPU A;  2BA0 A;  3L7Z C;  1J5K A;  2DGR A;  4OO1 G;  4AIM A;  2JZX A;  5JEA G;  1X4N A;  2CTE A;  1ZZJ A;  2ANR A;  4BA2 I;  1WE8 A;  1EC6 A;  2P2R A;  2CTJ A;  5K36 G;  2JEB I;  2QND A; 
#chains in the Genus database with same CATH topology
 2X06 A;  2AXY A;  4JI2 H;  3J7A K;  4DV3 H;  2FMR A;  4B3S H;  4DV7 H;  5LL6 b;  4FJU A;  4DR6 H;  4NZR M;  1Z2I A;  4LF5 H;  4WAN A;  2FPH X;  4LIJ A;  2UXC H;  2LF0 A;  4JV5 H;  3KDK A;  1IBK H;  2OPV A;  5FLX W;  1N36 H;  1K1G A;  4PDB A;  4JVH A;  2BL5 A;  2UXB H;  1TUA A;  4LFA H;  2JE6 I;  4GKK H;  2CTK A;  1XMO H;  1SEI A;  1ZZK A;  4DR1 H;  3VKE A;  3J80 W;  1ODH A;  4YY3 H;  1VIG A;  2JVZ A;  1NXU A;  1DT4 A;  2Z0S A;  2UUA H;  2OPU A;  3L7Z C;  1I94 H;  2UUC H;  4OX9 H;  2K1H A;  1N32 H;  1S20 A;  1WE8 A;  1V8C A;  2P2R A;  2PQU A;  2JEB I;  3UOE A;  2CTM A;  4B8T A;  4B3R H;  5IT9 W;  4H8A A;  4LFB H;  2LRR A;  4X65 H;  3U1K A;  4JI3 H;  5C0X G;  1HNZ H;  4JI4 H;  1WVN A;  4DR7 H;  1I6U A;  4NXM H;  1X0A A;  3V69 A;  1V9N A;  5A2Q W;  4NZT M;  2VQF H;  4EC5 A;  2E5L H;  4DV1 H;  2UUB H;  2M6Q A;  4JVY A;  3OET A;  2NN6 G;  4OD6 A;  4LF9 H;  1MSZ A;  4E9J A;  1F0X A;  2CPQ A;  4AQY H;  4LF7 H;  1KHM A;  3T1H H;  4DV2 H;  1XNQ H;  2PT7 G;  2VQE H;  3JAM W;  1J4W A;  4IFD G;  2G8Y A;  3GAB A;  2UU9 H;  1N33 H;  2DGR A;  5JEA G;  5IWA H;  1X4N A;  3FAU A;  3I0P A;  3RF2 A;  4DUY H;  1FJG H;  4JI1 H;  1VBI A;  4G08 A;  1IBL H;  1WTJ A;  4WAL A;  1AN7 A;  1PQX A;  3T1Y H;  4B8C D;  3SB1 A;  1HNX H;  2HHH H;  2JA9 A;  4JI7 H;  2ANN A;  2CTF A;  2D9I A;  4QMF B;  2HH2 A;  3QD7 X;  2JEA I;  2O4C A;  1FKA H;  2HH3 A;  4X66 H;  3OSS D;  3AEV B;  2FFM A;  4JI5 H;  1X4M A;  4LF6 H;  2A1S A;  4GKJ H;  4DV5 H;  2CTL A;  4NBQ A;  2CWF A;  2ZQE A;  4AM3 A;  4X64 H;  4JI0 H;  2BA0 A;  1J5K A;  5BR8 H;  4DV0 H;  1IBM H;  1EC6 A;  1XMQ H;  2CTE A;  4X62 H;  1ZZJ A;  4B3T H;  4JI6 H;  2CTJ A;  1XNR H;  5K36 G;  3GR5 A;  4K0K H;  4BA1 I;  3NCV A;  1UG8 A;  2E3U A;  4LF8 H;  2F4V H;  2M8W A;  1S03 G;  4DR4 H;  1N34 H;  1HNW H;  4DR2 H;  2CWH A;  4DUZ H;  1J5E H;  3EZJ A;  1VIH A;  4DV4 H;  3GKU A;  4JYA H;  2PY9 A;  1DTJ A;  2LTL A;  3J81 W;  4OO1 G;  2CPM A;  2ZM6 H;  4DR3 H;  5LMN H;  4LFC H;  4OCH A;  2VKC A;  4JI8 H;  5LMU H;  2LTM A;  4B3M H;  1ZTG A;  1ZZI A;  4LF4 H;  2YQR A;  4YHH H;  2MJH A;  1X9Z A;  4KHP H;  4DV6 H;  1WHR A;  2Y3M A;  5DT9 A;  2JZX A;  3KDG A;  4AIM A;  3OTO H;  4FJS A;  4DR5 H;  1HR0 H;  2ANR A;  4BA2 I;  4NXN H;  1XRH A;  2QND A;  2UXD H; 
#chains in the Genus database with same CATH homology
 4BA1 I;  2CTM A;  4WAL A;  4B8T A;  2AXY A;  2FMR A;  2E3U A;  3U1K A;  5C0X G;  4WAN A;  1WVN A;  2JA9 A;  4LIJ A;  2ANN A;  2CTF A;  3V69 A;  4QMF B;  4JVH A;  2HH2 A;  2OPV A;  1K1G A;  1VIH A;  2JEA I;  2BL5 A;  2PY9 A;  1DTJ A;  1TUA A;  2PQU A;  2HH3 A;  4JVY A;  2JE6 I;  3AEV B;  2NN6 G;  2CTK A;  1X4M A;  2CPQ A;  1ZZK A;  3VKE A;  1KHM A;  1ZTG A;  1VIG A;  2CTL A;  2JVZ A;  2YQR A;  4NBQ A;  1DT4 A;  1ZZI A;  2MJH A;  4AM3 A;  1J4W A;  2Z0S A;  4IFD G;  2OPU A;  2BA0 A;  3L7Z C;  1J5K A;  2DGR A;  4OO1 G;  4AIM A;  2JZX A;  5JEA G;  1X4N A;  2CTE A;  1ZZJ A;  2ANR A;  4BA2 I;  1WE8 A;  1EC6 A;  2P2R A;  2CTJ A;  5K36 G;  2JEB I;  2QND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...