1ZZJA

Structure of the third kh domain of hnrnp k in complex with 15-mer ssdna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
75
structure length
75
Chain Sequence
AMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords 5'-D(*TP*TP*CP*CP*CP*CP*TP*CP*CP*CP*CP*AP*TP*TP*T)-3'
total genus 20
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zzjA00
2ANRA 2FMRA 2HH3A 2OPUA 2CTKA 1VIHA 2CPQA 2CTEA 2JVZA 2ANNA 1ZZJA 2PQUA 3U1KA 4OO1G 1ZZIA 1ZTGA 4IFDG 4BA1I 3L7ZC 2QNDA 2YQRA 2AXYA 4WALA 1VIGA 4JVHA 4NBQA 4QMFB 4AIMA 1J4WA 2HH2A 2JA9A 4WANA 4BA2I 2E3UA 2CTJA 5K36G 1KHMA 2PY9A 1EC6A 2OPVA 1WVNA 4B8TA 2BL5A 1DT4A 1WE8A 3V69A 2CTMA 3VKEA 1X4NA 2BA0A 1DTJA 1J5KA 4AM3A 2Z0SA 5C0XG 5JEAG 2CTLA 1TUAA 2P2RA 1ZZKA 2CTFA 2DGRA 2JEBI 4LIJA 2MJHA 2JZXA 2NN6G 3AEVB 1X4MA 2JEAI 4JVYA 2JE6I 1K1GA
chains in the Genus database with same CATH superfamily
2LRRA 2HH3A 2OPUA 1VIHA 2JVZA 4JI6H 4FJSA 1N33H 2K1HA 4OCHA 5A2QW 1WHRA 4DR6H 3RF2A 1J5EH 2CWHA 4JI7H 1X9ZA 1ODHA 3J7AK 4K0KH 2YQRA 2AXYA 4DR7H 3J80W 2JA9A 2JEAI 5LMNH 4B3TH 1N34H 3GABA 1HNWH 4NZTM 4AQYH 2OPVA 4B8TA 4JI5H 3NCVA 2PY9A 4GKKH 4KHPH 1EC6A 1WE8A 2D9IA 4DV0H 1X4NA 1VBIA 4DR3H 4LFCH 1S20A 2DGRA 4JI1H 4G08A 1UG8A 2NN6G 2ZM6H 4DUYH 5IT9W 4NZRM 1N36H 3GR5A 4JI8H 4JI0H 4PDBA 2ANRA 2FMRA 1XRHA 1WTJA 1NXUA 2ANNA 4JYAH 2VQEH 4YY3H 4X66H 4IFDG 2LTMA 4BA1I 3EZJA 2HHHH 4JI4H 5BR8H 4DV7H 2UUAH 4BA2I 4WANA 5K36G 2CPMA 1KHMA 2UUBH 4DV4H 1DT4A 3V69A 2CTMA 3VKEA 1FKAH 1J5KA 4JV5H 4AM3A 2O4CA 3KDKA 2CTLA 2P2RA 4DV1H 2MJHA 2JEBI 4B8CD 4EC5A 4DV6H 4X62H 1HNXH 1XMOH 2FPHX 3I0PA 4AIMA 1K1GA 4GKJH 4JVYA 2Y3MA 2VKCA 4X65H 2CTEA 4LF9H 4DR4H 2UXDH 2UXCH 3FAUA 1HNZH 2ZQEA 1ZTGA 4JI3H 4DUZH 4LF5H 3SB1A 5LL6b 4NXNH 2UUCH 3T1HH 4JVHA 1N32H 1IBKH 4QMFB 4LF4H 4B3MH 4H8AA 2E3UA 2CTJA 2LTLA 4E9JA 4LF6H 1SEIA 1WVNA 2BL5A 3OTOH 2M6QA 4LFAH 2BA0A 1F0XA 1IBLH 1FJGH 2Z0SA 3UOEA 2UXBH 5JEAG 2E5LH 1TUAA 1S03G 1HR0H 4DR1H 3GKUA 4LIJA 1I94H 3JAMW 3AEVB 4FJUA 2LF0A 2JE6I 1V9NA 2CTKA 3KDGA 2CPQA 4JI2H 1MSZA 1PQXA 5LMUH 4DV3H 4OX9H 1ZZJA 2M8WA 2PQUA 4DV5H 5DT9A 3U1KA 1XMQH 1IBMH 4DR5H 4OO1G 4OD6A 1ZZIA 4LF7H 2FFMA 4X64H 3J81W 4LF8H 3OSSD 3L7ZC 2QNDA 3OETA 1VIGA 4WALA 2UU9H 1I6UA 1Z2IA 4NBQA 1J4WA 4B3SH 4B3RH 1XNRH 2HH2A 1AN7A 4NXMH 4LFBH 2CWFA 4YHHH 1XNQH 2PT7G 2X06A 4DV2H 1V8CA 1DTJA 5FLXW 2G8YA 1X0AA 5C0XG 2F4VH 3T1YH 5IWAH 3QD7X 1ZZKA 2CTFA 2VQFH 2JZXA 1X4MA 4DR2H 2A1SA
chains in the Genus database with same CATH topology
2ANRA 2FMRA 2HH3A 2OPUA 2CTKA 1VIHA 2CPQA 2CTEA 2JVZA 2ANNA 1ZZJA 2PQUA 3U1KA 4OO1G 1ZZIA 1ZTGA 4IFDG 4BA1I 3L7ZC 2QNDA 2YQRA 2AXYA 4WALA 1VIGA 4JVHA 4NBQA 4QMFB 4AIMA 1J4WA 2HH2A 2JA9A 4WANA 4BA2I 2E3UA 2CTJA 5K36G 1KHMA 2PY9A 1EC6A 2OPVA 1WVNA 4B8TA 2BL5A 1DT4A 1WE8A 3V69A 2CTMA 3VKEA 1X4NA 2BA0A 1DTJA 1J5KA 4AM3A 2Z0SA 5C0XG 5JEAG 2CTLA 1TUAA 2P2RA 1ZZKA 2CTFA 2DGRA 2JEBI 4LIJA 2MJHA 2JZXA 2NN6G 3AEVB 1X4MA 2JEAI 4JVYA 2JE6I 1K1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANR A;  2FMR A;  2HH3 A;  2OPU A;  2CTK A;  1VIH A;  2CPQ A;  2CTE A;  2JVZ A;  2ANN A;  1ZZJ A;  2PQU A;  3U1K A;  4OO1 G;  1ZZI A;  1ZTG A;  4IFD G;  4BA1 I;  3L7Z C;  2QND A;  2YQR A;  2AXY A;  4WAL A;  1VIG A;  4JVH A;  4NBQ A;  4QMF B;  4AIM A;  1J4W A;  2HH2 A;  2JA9 A;  4WAN A;  4BA2 I;  2E3U A;  2CTJ A;  5K36 G;  1KHM A;  2PY9 A;  1EC6 A;  2OPV A;  1WVN A;  4B8T A;  2BL5 A;  1DT4 A;  1WE8 A;  3V69 A;  2CTM A;  3VKE A;  1X4N A;  2BA0 A;  1DTJ A;  1J5K A;  4AM3 A;  2Z0S A;  5C0X G;  5JEA G;  2CTL A;  1TUA A;  2P2R A;  1ZZK A;  2CTF A;  2DGR A;  2JEB I;  4LIJ A;  2MJH A;  2JZX A;  2NN6 G;  3AEV B;  1X4M A;  2JEA I;  4JVY A;  2JE6 I;  1K1G A; 
#chains in the Genus database with same CATH topology
 2LRR A;  2HH3 A;  2OPU A;  1VIH A;  2JVZ A;  4JI6 H;  4FJS A;  1N33 H;  2K1H A;  4OCH A;  5A2Q W;  1WHR A;  4DR6 H;  3RF2 A;  1J5E H;  2CWH A;  4JI7 H;  1X9Z A;  1ODH A;  3J7A K;  4K0K H;  2YQR A;  2AXY A;  4DR7 H;  3J80 W;  2JA9 A;  2JEA I;  5LMN H;  4B3T H;  1N34 H;  3GAB A;  1HNW H;  4NZT M;  4AQY H;  2OPV A;  4B8T A;  4JI5 H;  3NCV A;  2PY9 A;  4GKK H;  4KHP H;  1EC6 A;  1WE8 A;  2D9I A;  4DV0 H;  1X4N A;  1VBI A;  4DR3 H;  4LFC H;  1S20 A;  2DGR A;  4JI1 H;  4G08 A;  1UG8 A;  2NN6 G;  2ZM6 H;  4DUY H;  5IT9 W;  4NZR M;  1N36 H;  3GR5 A;  4JI8 H;  4JI0 H;  4PDB A;  2ANR A;  2FMR A;  1XRH A;  1WTJ A;  1NXU A;  2ANN A;  4JYA H;  2VQE H;  4YY3 H;  4X66 H;  4IFD G;  2LTM A;  4BA1 I;  3EZJ A;  2HHH H;  4JI4 H;  5BR8 H;  4DV7 H;  2UUA H;  4BA2 I;  4WAN A;  5K36 G;  2CPM A;  1KHM A;  2UUB H;  4DV4 H;  1DT4 A;  3V69 A;  2CTM A;  3VKE A;  1FKA H;  1J5K A;  4JV5 H;  4AM3 A;  2O4C A;  3KDK A;  2CTL A;  2P2R A;  4DV1 H;  2MJH A;  2JEB I;  4B8C D;  4EC5 A;  4DV6 H;  4X62 H;  1HNX H;  1XMO H;  2FPH X;  3I0P A;  4AIM A;  1K1G A;  4GKJ H;  4JVY A;  2Y3M A;  2VKC A;  4X65 H;  2CTE A;  4LF9 H;  4DR4 H;  2UXD H;  2UXC H;  3FAU A;  1HNZ H;  2ZQE A;  1ZTG A;  4JI3 H;  4DUZ H;  4LF5 H;  3SB1 A;  5LL6 b;  4NXN H;  2UUC H;  3T1H H;  4JVH A;  1N32 H;  1IBK H;  4QMF B;  4LF4 H;  4B3M H;  4H8A A;  2E3U A;  2CTJ A;  2LTL A;  4E9J A;  4LF6 H;  1SEI A;  1WVN A;  2BL5 A;  3OTO H;  2M6Q A;  4LFA H;  2BA0 A;  1F0X A;  1IBL H;  1FJG H;  2Z0S A;  3UOE A;  2UXB H;  5JEA G;  2E5L H;  1TUA A;  1S03 G;  1HR0 H;  4DR1 H;  3GKU A;  4LIJ A;  1I94 H;  3JAM W;  3AEV B;  4FJU A;  2LF0 A;  2JE6 I;  1V9N A;  2CTK A;  3KDG A;  2CPQ A;  4JI2 H;  1MSZ A;  1PQX A;  5LMU H;  4DV3 H;  4OX9 H;  1ZZJ A;  2M8W A;  2PQU A;  4DV5 H;  5DT9 A;  3U1K A;  1XMQ H;  1IBM H;  4DR5 H;  4OO1 G;  4OD6 A;  1ZZI A;  4LF7 H;  2FFM A;  4X64 H;  3J81 W;  4LF8 H;  3OSS D;  3L7Z C;  2QND A;  3OET A;  1VIG A;  4WAL A;  2UU9 H;  1I6U A;  1Z2I A;  4NBQ A;  1J4W A;  4B3S H;  4B3R H;  1XNR H;  2HH2 A;  1AN7 A;  4NXM H;  4LFB H;  2CWF A;  4YHH H;  1XNQ H;  2PT7 G;  2X06 A;  4DV2 H;  1V8C A;  1DTJ A;  5FLX W;  2G8Y A;  1X0A A;  5C0X G;  2F4V H;  3T1Y H;  5IWA H;  3QD7 X;  1ZZK A;  2CTF A;  2VQF H;  2JZX A;  1X4M A;  4DR2 H;  2A1S A; 
#chains in the Genus database with same CATH homology
 2ANR A;  2FMR A;  2HH3 A;  2OPU A;  2CTK A;  1VIH A;  2CPQ A;  2CTE A;  2JVZ A;  2ANN A;  1ZZJ A;  2PQU A;  3U1K A;  4OO1 G;  1ZZI A;  1ZTG A;  4IFD G;  4BA1 I;  3L7Z C;  2QND A;  2YQR A;  2AXY A;  4WAL A;  1VIG A;  4JVH A;  4NBQ A;  4QMF B;  4AIM A;  1J4W A;  2HH2 A;  2JA9 A;  4WAN A;  4BA2 I;  2E3U A;  2CTJ A;  5K36 G;  1KHM A;  2PY9 A;  1EC6 A;  2OPV A;  1WVN A;  4B8T A;  2BL5 A;  1DT4 A;  1WE8 A;  3V69 A;  2CTM A;  3VKE A;  1X4N A;  2BA0 A;  1DTJ A;  1J5K A;  4AM3 A;  2Z0S A;  5C0X G;  5JEA G;  2CTL A;  1TUA A;  2P2R A;  1ZZK A;  2CTF A;  2DGR A;  2JEB I;  4LIJ A;  2MJH A;  2JZX A;  2NN6 G;  3AEV B;  1X4M A;  2JEA I;  4JVY A;  2JE6 I;  1K1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...