1ZZVA

Solution nmr structure of the periplasmic signaling domain of the outer membrane iron transporter feca from escherichia coli.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
80
structure length
80
Chain Sequence
AQVNIAPGSLDKALNQYAAHSGFTLSVDASLTRGKQSNGLHGDYDVESGLQQLLDGSGLQVKPLGNNSWTLEPAPAPKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Signal transduction pathway of TonB-dependent transporters.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein, metal transport
molecule keywords Iron(III) dicitrate transport protein fecA
total genus 14
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07660 STN Secretin and TonB N terminus short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.55.50.30 Alpha Beta 3-Layer(bab) Sandwich Phage tail protein beta-alpha-beta fold Phage tail protein beta-alpha-beta fold 1zzvA01
4M0NA 2W6UA 3EZJA 2W75A 2O5PA 1ZZVA 2W6TA 4AR0A 2M5JA 2W76A 2IAHA 2W77A 2W78A 3GR5A 4G08A 4M0HA 2W16A 2D1UA 4JTMA 2A02A
chains in the Genus database with same CATH superfamily
4M0NA 4AR0A 2IAHA 2P5ZX 1WTHD 2X531 2W16A 3ADYA 1K28D 2O5PA 3EZJA 1ZZVA 3D37A 3GR5A 4G08A 3GS9A 2A02A 2M5JA 2W78A 3CDDA 3OV5A 2L4WA 2WZPR 4UHVA 2W6TA 2W75A 2W6UA 2W77A 4MTKA 4M0HA 2W76A 2D1UA 2Z6BD 1WRUA 4JTMA
chains in the Genus database with same CATH topology
4M0NA 4AR0A 2IAHA 1WTHD 2X531 2W16A 3ADYA 1K28D 2O5PA 3EZJA 1ZZVA 3GR5A 4G08A 3GS9A 2A02A 2M5JA 2W78A 3OV5A 2L4WA 2WZPR 2W6TA 2W75A 2W6UA 2W77A 4M0HA 2W76A 2D1UA 2Z6BD 4JTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0N A;  2W6U A;  3EZJ A;  2W75 A;  2O5P A;  1ZZV A;  2W6T A;  4AR0 A;  2M5J A;  2W76 A;  2IAH A;  2W77 A;  2W78 A;  3GR5 A;  4G08 A;  4M0H A;  2W16 A;  2D1U A;  4JTM A;  2A02 A; 
#chains in the Genus database with same CATH topology
 4M0N A;  4AR0 A;  2IAH A;  2P5Z X;  1WTH D;  2X53 1;  2W16 A;  3ADY A;  1K28 D;  2O5P A;  3EZJ A;  1ZZV A;  3D37 A;  3GR5 A;  4G08 A;  3GS9 A;  2A02 A;  2M5J A;  2W78 A;  3CDD A;  3OV5 A;  2L4W A;  2WZP R;  4UHV A;  2W6T A;  2W75 A;  2W6U A;  2W77 A;  4MTK A;  4M0H A;  2W76 A;  2D1U A;  2Z6B D;  1WRU A;  4JTM A; 
#chains in the Genus database with same CATH homology
 4M0N A;  4AR0 A;  2IAH A;  1WTH D;  2X53 1;  2W16 A;  3ADY A;  1K28 D;  2O5P A;  3EZJ A;  1ZZV A;  3GR5 A;  4G08 A;  3GS9 A;  2A02 A;  2M5J A;  2W78 A;  3OV5 A;  2L4W A;  2WZP R;  2W6T A;  2W75 A;  2W6U A;  2W77 A;  4M0H A;  2W76 A;  2D1U A;  2Z6B D;  4JTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...