1ZZYA

Crystal structure of thioredoxin mutant l7v
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin 1
publication title Crystal Structure of Thioredoxin Mutant L7V
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 27
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zzyA00
3LG6A 3W8JA 5IMAA 2RIIA 2OA7A 2FLSA 5D8IA 4GF0A 2I81A 1GTBA 2H72A 3GYKA 3CMIA 2WDUA 3KP9A 2R3XA 2I4AA 2ZNMA 1SU9A 1T1VA 5CRDA 4GWRA 5J41A 1U88A 3V1WA 2XBQA 4WR4A 5D9TA 4I97A 1A0RP 3L9VA 3A3TA 1TU8A 5F05A 3GL5A 2A2RA 4V1Ag 5IO0A 3QD9A 1EGOA 5JCGA 2LNTA 3GH9A 4HOJA 5IMCA 3QFAC 4NHWA 4TR1A 2MBSA 3ISOA 1YZXA 2HT9A 1AUCA 4CHSA 2GS3A 3QCPA 2DJJA 1VF4A 2FCHA 2K8SA 4EVMA 1J0FA 3EU3A 1TW9A 2XC2A 1GSFA 4XHMA 4QQ7A 4JZQA 2B1LA 1BEDA 4YH2A 2FHEA 3AY8A 4RI7A 4KDUA 3CYNA 3F6FA 2P5QA 1I9DA 3DGQA 4F0CA 2J9HA 4Q5QA 1G6YA 4EDZA 2DJ1A 4JR6A 3WD6A 1QK8A 1S3CA 2DBCA 1UN2A 5B7CA 4HQZA 2AB6A 1WRYA 4X1UA 3VURA 4K9ZA 2CVDA 4L5LA 1SKSB 5J9CA 1PMTA 2ON7A 1B4PA 1GWCA 2JL4A 4BWSA 2CX3A 2AYTA 5FWGA 2YCDA 3ZVJA 1SKRB 1ZCPA 2PVOC 3TGZA 2H1GA 1XFLA 4E8HA 1XWGA 1PA3A 1TTZA 3C8EA 3PINA 2HXKA 3N9JA 1SL1B 1YF0A 3KZQA 3GRXA 4ECBA 1JZWA 1M7TA 2H1BA 1SENA 4DVCA 4ZBAA 1UA5A 2GGTA 3D21A 2HZFA 4EE0A 3UIWA 3TJBA 3BBYA 5L71A 3TKPA 2GT6A 1PKZA 2KLXA 3UVTA 1TRWA 1FB0A 2GVPA 1JZDA 5IIZA 1U3AA 2GLRA 4POLA 4V1Ap 3A2WA 4V2LA 4F9ZA 1JZRA 1QMVA 5IOXA 3FZ9A 4ZXGA 4G10A 4ZB9A 3F4SA 2O89A 5KEJA 2B5EA 3WT2A 1SK2A 4BVYA 4N11A 3M1GA 3GMFA 1S3AA 4I5QA 4PQIA 5ECIB 4EKZA 4P3YB 4K6XA 3VI5A 3L4NA 1A23A 1V9WA 4HJ2A 5LD0A 2DMLA 3D6IA 3TKSC 2WGRA 2H76A 3FEUA 3G7JA 6GSVA 1S3DA 2IMFA 3C1SA 1T4ZA 3ZIVA 3HVVA 4MZWA 3ZITA 2H0IA 3EVIA 1G0TA 4ZL9A 2WZ9A 1XBSA 2TRCP 4IS0A 4NWYA 1HNCA 5IO2A 5DALB 4ZL7A 3I6AA 1FVJA 2FWGA 3LQ7A 3LGCA 2HFDA 1K0BA 1PL1A 1PN9A 1QUWA 3ZMKA 3F3RA 3RBTA 4MJAA 3ZFBA 4IJIA 5D9VA 2NBSA 1AXDA 5JWRB 3WYWA 3LORA 3QPMA 4MH2A 2FGXA 1ABAA 2R5GA 4DEJA 1Z7PA 3BCIA 4FH8A 4GSNA 1SJ6A 2JSZA 3IAS2 2A2SA 3KIJA 2DMMA 4YQVA 5F0GA 17GSA 5JWQB 4H86A 2YWIA 1T8EB 2LV3A 3E0UA 4GRFA 2GQMA 1X5CA 2PMTA 5DCGA 2IMDA 4WEYA 2QKEA 2OE1A 1Z9HA 5HQPA 3ZIJA 4EC0A 3I9V2 5JWOB 5G30A 3GSSA 1GSSA 1R5AA 2L59A 1XVQA 6GSSA 3C73A 3ERWA 1VGLA 4EUYA 2KUCA 1DE2A 5FHIA 1DBYA 5B6NA 1ML6A 3CSJA 4ZBBA 4GSSA 1EOGA 2VCTA 1GSUA 5DDLA 2R37A 3TDGA 4OFTA 1B8XA 1Q4JA 4TR3A 4AJ6A 4V2MA 1O8WA 2HNLA 1H4OA 1IYIA 3IHQA 1IYHA 2XPEA 4K7OA 4YQMA 2OE0A 12GSA 2RM6A 4POKA 5A4VA 1TDIA 3DD3A 3GL3A 2L4CA 5CAXA 1XVWA 3K8NA 3IOSA 5A4UA 3GTUA 3IK9A 3DRNA 1KTEA 2M46A 3APQA 1HNAA 2WFCA 3UMAA 1TKDB 4CDOA 2NVLA 3EYTA 3KH7A 3ZL5A 3S9FA 5DALA 5GZZB 3H79A 2CAIA 1XWBA 2OE3A 5CO3A 5LCZA 5A4WA 3F4RA 5F07A 1HNBA 4ZILA 1A8LA 4GSTA 4PQ1A 3DIEA 2IPAA 3D0ZA 3GFKA 2JACA 3GA4A 3GURA 4KCEA 5IM9A 2DLXA 2WS2A 5EL8A 2YPMA 1V57A 1MD4A 2N5BA 2JZRA 1GH2A 2HRNA 1M9BA 2DJ0A 1ON4A 4LMVA 4TOPA 2X8GA 1NHOA 5DQYA 2L5LA 1GLQA 3TKSA 2RM5A 1OYJA 4K2DA 3L9UA 22GSA 2VLUA 1U3IA 3ZREA 1SKWB 3JCML 1PKWA 2E2MA 4GXZA 4MZCA 10GSA 1FOVA 2DJ3A 4EF0A 2KHPA 3ED3A 5D9XA 4OWYA 3VWVA 4TXOB 2C8UA 5C04A 3ZRDA 1V98A 4GTUA 4IHUA 1C72A 2CZ2A 4MH3A 1R5PA 2E2GA 5AN1A 2H19A 5ECLB 4XRDA 3QOUA 2JZTA 9GSSA 4F82A 3FKFA 4HZ4A 2R4VA 3Q74A 4ISDA 1KEBA 1M99A 2H01A 4IKHA 3GUSA 2O8VB 2OACA 3F0IA 1PL2A 3I43A 3P90A 1PGTA 4MZBA 3DKSA 2HRFA 1A24A 4MF7A 3CTFA 1BG5A 4N30A 2FWEA 3D4TA 4L8EA 2IWTA 2AV4A 1XW9A 4PGTA 2RUEA 5HR0A 4PQHA 2M72A 4L5OA 2LRTA 3GNJA 3KXOA 4POBA 5CP1A 7GSSA 3KD0A 4F2IA 2CA8A 4BL7A 11GSA 4G19A 5G1KA 5AGYA 2PWJA 3ERFA 3HJPA 1O7UA 2VL9A 3KTLA 4OCEA 2WB9A 4HUAA 1BYEA 1G6WA 4HU9A 2PU9C 3GH6A 3RDWA 1GSQA 3WGEA 3KMNA 2C3TA 3TOUA 3RHBA 1YY7A 5COHA 4ML1A 4KSOA 1ERWA 2H73A 2VUPA 3GKKA 4J2FA 1AW9A 5JCUA 4MCUA 1Z6NA 1WPIA 4ZL8A 1F6MC 3H93A 4AGSA 2H70A 1GUMA 1ACVA 1W4VA 4JBBA 3W6GA 1XW6A 5IMVA 5CREA 1TP9A 1SJIA 1N2AA 1EGRA 1ZOFA 5ECNB 3O3TA 1K3YA 4PNFA 4TXOA 5HFIA 2X8HA 1GRXA 1I5GA 2X8CA 3LXTA 2DSAA 1BQ7A 2H6ZA 3IC4A 2J23A 3F63A 4RI6A 4WF4A 3KEBA 1YDKA 2YZUA 3EMPA 2CAQA 3HA9A 1SL0B 13GSA 1QFNA 3F4TA 4WKWA 2GSSA 3P7XA 3US3A 2A4VA 2DIZA 5CYYA 5J5NA 1LJRA 2I1UA 2TRXA 3PR8A 3ZMLA 2VLTA 4K0NA 5E59A 1PD21 4IVFA 2GSRA 3RAZA 2CT6A 2MBTA 1OKTA 2H6YA 5F06A 2PPTA 2HSYA 4MPGA 3IXRA 2C0FA 1RW1A 1Z5YE 3VPQA 2ZCTA 1QQ2A 2IMIA 4L0UA 5HFGA 2YOIA 3BJ5A 2CQ9A 3FR3A 3FK8A 4OFNA 2I9HA 2IL3A 2V6OA 2R2JA 5GSTA 1O8XA 2YV7A 3LYKA 1M2BA 4ILFA 3FR9A 3TJGA 2L6CA 1Z6MA 4TR4A 4ML6A 3F6DA 3D22A 2GDRA 3CBUA 2C3NA 1GULA 1UVZA 2OADA 5AISA 1V2AA 2H1DA 2VCVA 2LJKA 2LUSA 3KH9A 4KH7A 4NV5A 3M0FA 1HQOA 4JR4A 6GSTA 4YAPA 1J08A 1G7OA 5ELAA 3M9KA 2B7KA 3ME7A 4OCFA 2C4JA 3WT1A 1B9YC 2XHFA 5DBQA 4ZBDA 2V32A 3TCOA 3UAPA 4OD7A 14GSA 3TRXA 1SD9A 3FY7A 2EIQA 4NAXA 4DSQA 4TN8A 4X43A 1PX6A 2CV4A 4MJEA 2JADA 2C80A 5H5SA 5DJLA 4AF2A 4GQCA 1T7PB 2F51A 2FY6A 3DWVA 4PUFC 1URMA 1WP0A 4MABA 18GSA 3KP8A 4KDXA 5G5FA 3MWHA 3GTUB 1BJXA 2N5AA 2L57A 2LS5A 2KP1A 1AC1A 1T3BA 1TK5B 1XOBA 2YNXA 4ULXA 5CRGA 1TRVA 2X99A 1SYRA 5D93A 1O81A 3IAM2 1JFUA 3SBCA 3FYGA 1X9MB 4PURA 1JLVA 4OMVA 3F9UA 3DEXA 3A2VA 4WF5A 1Y6EA 4PUAA 1TJDA 2XPDA 6GSWA 1SL2B 1SK1A 2LTKA 1EZKA 2GZPA 4FYUA 2M80A 1CQHA 1TRUA 5DVBA 4IN0A 2LKUA 2WJUA 1ERTA 4ECIA 1VF3A 2C3QA 1PQNA 1XWCA 2OBIA 3GX8A 1O73A 5B6MA 3F8UA 1X5DA 3FZ5A 4PX1A 1WE0A 1E6BA 1TK8B 4HU7A 5CRWA 3VI7A 4LL4B 2HYXA 1Y25A 3MSZA 4QL9A 4AJ8A 2GSTA 1X5EA 4IP6A 1R4WA 4X0XA 5D73A 2H8LA 1H75A 1XXUA 4N10A 3W8SA 4KW6A 4K0GA 5HR2A 2VCZA 1YEXA 2ON5A 2VD0A 3O6TA 2ALBA 3NOFA 1MDJA 3Q18A 5DCHA 1GSEA 1K0CA 3E9JB 3TJFA 4DSRA 3ZYWA 1ZZYA 5DQSA 3UVHA 3VWUA 4JEDA 2IMKA 3OR5A 5KN1A 2VO4A 2FUG2 3GKXA 1M0UA 2WRTA 1R7HA 5IMFA 4NXIA 4HQSA 3ZLPA 3QR6A 5ECSA 2B7JA 2QC7A 2HE3A 1ZYQB 5HFKA 1YF1A 2HSHA 4XIHA 5KN3A 3LYPA 1X9WB 3LEFA 4IQAA 2EIRA 3IR4A 2PBJA 4Q5NA 3HDCA 1ILOA 4N0ZA 1E2YA 3KMOA 4I6XA 1WJKA 4POMA 4BWQA 3VWXA 2LJRA 4K1FA 3ZFLA 3UL3A 5ECQB 2AHEA 2G0FA 3GSTA 2CZ3A 4HJMA 3FRCA 1AAZA 4KGIA 4EL1A 1PRXA 4MDCA 3GV1A 1QXHA 3D5JA 3WGXA 5AIXA 4MPFA 1GTAA 2GT5A 4F03A 1VF2A 3EURA 4O32A 3MDKA 5IOWA 5IMDA 2K6VA 1GSDA 2FWHA 5HR3A 3QDNA 4FYCA 3FR6A 3QFBC 4QL7A 3RPPA 4OO4A 4WBRD 3J7Yb 5CNWA 3R2QA 2LEGA 2V1MA 1MD3A 4ACSA 4IP1A 1B48A 1V40A 3VPTA 4BA7A 4TRXA 1WIKA 3L78A 2C1YA 4BVXA 1THXA 5B8BA 5KN0A 2DJ2A 2QGVA 4IELA 4HEA2 3HVXA 1ZMAA 3QAVA 3IE3A 2L4QA 1USBA 5IQYA 4LMWA 3TJKA 3KM6A 4ECJA 1THOA 3APSA 4EDYA 3BOAA 2I3YA 2YWOA 2PERA 4MLYA 3M3MA 3FZ4A 2JSYA 2CVKA 2VD1A 3EU4A 1AIUA 5ECOB 3P8WA 2MMZA 1OC9B 4RUVA 2VCWA 4HS1A 1EV4A 1MDIA 2XBIA 4HZ2A 2HZEB 2YZHA 4EO3A 2ES7A 3EMXA 1GTUA 1K0DA 2C0GA 3CXGA 1OKDA 2P31A 3C71A 2MMAA 5DAKB 3L9SA 3DXBA 4WETA 2LSTA 1RK4A 1FB6A 2RUFA 3HZ4A 2MMNA 3QAWA 1M9AA 2H1AA 3U5RE 2F9SA 2V6KA 2YJHA 3TRPA 3UARA 2VL2C 2C0EA 1AQVA 4KB3A 3NIVA 2H66A 2PGTA 1XOAA 2LRCA 2K9FA 4KDYA 2E7PA 3LWAA 3TKQA 1FAAA 4JRRA 4XCSA 1W89A 3DMLA 1GSYA 2FNOA 1CQGA 4I8BA 4G2EA 4TW5A 5AIVA 1XCCA 3H1NA 1EP7A 2G2QA 4KNDA 2H0GA 2YANA 3EINA 1MTCA 2YP6A 5B8AA 2LQQA 3HY2A 4K7IA 4ZB8A 1YKCA 2H71A 2BTOT 4CW9A 1PSQA 1FO5A 1OVNA 3MAKA 3Q6OA 2P5RA 1SYXA 3TRQA 2AUVA 3Q19A 3QAGA 6GSXA 2GQKA 2HLSA 1A2LA 3LXZA 2X64A 1EOHA 1TU7A 3EWLA 2H6XA 1DSBA 1K0MA 2VOCA 4I2TA 1K3OA 2C0DA 4K7NA 4L0WA 1LU4A 2GZZA 1M2DA 3HJOA 2O87A 1TOFA 4ECCA 5G31A 3H8QA 3RPNA 1ST9A 2B5YA 3GHAA 3IA1A 5C00A 2VCQA 1Z3EA 3ZTLA 3UBLA 2PUKC 3HCZA 4XRAA 3N5OA 2AJQB 2V2GA 3I69A 1OC9A 2WCIA 4WR5A 3LFLA 4TR0A 3CRTA 5ECRB 1F2EA 4KA0A 3UJ1A 2HZEA 1KNGA 1J9BA 3VLNA 4MJBA 1KBNA 2B6MA 1SJZA 5DAKA 2VLVA 5LNKe 1VF1A 2IN3A 4RQRA 3IDVA 1N8JA 1F37A 4MMMA 4YQUA 3LJRA 2H0HA 4NPBA 4NV2A 2NPBA 5ENUA 4RQXA 3EE2A 5D9WA 3GN3A 2MYGA 2YV9A 1K0OA 4IGJA 3FZAA 4O5RA 5CRHA 1NHYA 4MK3A 1EEMA 3PH9A 1MEKA 4GCIA 3G7YA 3IV4A 3HYPA 1NW2A 1YQ1A 3IK7A 1AQXA 1FW1A 2RLIA 2F8FA 5KN2A 3KCMA 8GSSA 1FVKA 16GSA 1K0NA 1T00A 2IMEA 2TIRA 3GIXA 1K0AA 2YWNA 1EP8A 2F3MA 1M2AA 1K3LA 4DSSB 3FW2A 3P2AA 1OC3A 3J7Yk 3UBKA 5ECMB 5ECPB 2GQLA 4XS6A 6GSYA 1X9SB 2B3SA 2VL2A 1ERVA 2OJLA 3APOA 1FG4A 1FHEA 5D96A 2VM1A 3U6VA 1GUHA 1V58A 1U87A 1SD8A 2JU5A 2KOKA 4OO5A 5E4WA 5IPHA 2Z9SA 5FT3A 4WXTA 2B1KA 1GP1A 2H75A 2BJXA 1R26A 5DJMA 3UEMA 1YJ6A 2L5OA 1OC8A 2EIOA 3CRUA 3M8NA 5EVOA 5ECKB 1WWJA 5ECHB 19GSA 4NHZA 1PX7A 2REMA 1XPVA 2E0QA 4G9HA 2D2ZA 2IJYA 1HYUA 2WULA 3IBHA 4XTSA 4KX4A 3HJMA 4AJ7A 3CSIA 1A0FA 1WOUA 2JZSA 1G7EA 4Q5FA 4D73B 3VFIA 1HD2A 2DJKA 5J9BA 4MF5A 5A5KA 2LQOA 1GNEA 3EC3A 3O76A 3VK9A 5H5RA 4ZIJA 2VM2A 2DIYA 3VWWA 2VAFA 2FA4A 3GKMA 3KJYA 4HDEA 1B4QA 2N5FA 2LRNA 2FD3A 5J4UA 1JLWA 4JE1A 1TRSA 3CTGA 2EC4A 2K8VA 2ZUPA 4O92A 1XIYA 4MA9A 1JHBA 1JZOA 4FYBA 3KGKA 4F0BA 4HI7A 1ZL9A 4MF6A 1TI3A 3WGDA 1F9MA 2NDOA 1A2JA 4LA1A 5ID2B 2LJAA 2LNSA 4GLTA 4EXJA 4DSSA 3DVWA 3IRAA 1EWXA 1XW5A 2IFQB 3DVXA 1QGVA 1DE1A 3UOMA 5G5EA 1T4YA 4E8EA 4I2UA 1B9XC 2AAWA 4TVEA 2R6KA 4MJCA 5GAND 3D4MA 1ZGNA 4XS4B 3TOTA 5EY6A 5GAPD 2MZCA 1O6JA 5INYA 5IPGA 1TK0B 3BCKA 2O7KA 3G7IA 3TKRA 3KTBA 2VIMA 1VRSD 5GSSA 1WMJA 2PN8A 3RHCA 1EEJA 5HR1A 3HVSA 2CVBA 4N0VA 4GQFA 3A5WA 20GSA 3E3EA 3ZVJD 4KCAA 3TUEA 3GKNA 3TKSE 1F3AA 4JU5A 2YWMA 2B5XA 1XWAA 3QMXA 1U6TA 3G9BA 5H5QA 4BPYA 1BX9A 3MNGA 3L0HA 2CX4A 4IQ1A 2DC5A 4D73A 2KP2A 3HKRA 1GLPA 2IIYA 3PGTA 2VCXA 4FIWA 3HHVA 4FO5A 1A2MA 2OKAA 3HD5A 1OE8A 2O85A 4Q5RA 2V41A 5J3RA 1AQWA 5IMZA 4O7HA 1EV9A 2OBKA 3CSHA 2P0GA 4LLRA 1GNWA 1GUKA 4OFMA 4KSMA 4IBPA 3ME8A 2YN1A 1YEPA 1GTIA 2F8AA 2QSIA 2FWFA 4WBJA 5EPFA 1Q98A 5ELGA 4V2NA 4TR1B 3FHKA 3F3QA 5ID2A 1XZOA 4PNGA 1O85A 4ID0A 4PXOA 3BD2A 2GZYA 1GL8A 2K18A 3SWLA 3HZ8A 1ZYEA 2IFQA 5JCWA 5F8BA 1X0RA 1F3BA 4IW9A 1MDKA 3NZNA 4Z7XA 1ERUA 4NMUA 4ZB6A 2H30A 2MMOA 2BMXA 1XWKA 1NM3A 4MP4A 4KAEA 2GTUA 4XS4A 4KE3A 1DUGA 1RQMA 2H74A 3H4KA 3ZZXA 3HXSA 2PVQA 4K8MA 2GSQA 4KUNA 4IJ3A 1A8YA 2L6DA 4TKYA 1BAYA 1SK0A 5ABRA 3M9JA 3ERGA 3GX0A 2FA8A 3LSZA 1NSWA 5G1LA 3IPZA 2HI7A 3A2XA 1TI1A 2VL3A 4TXVA 4XS1A 4YAVA 1OAZA 1Z7RA 1OE7A 2NTOA 3C7MA 1LBKA 4J56E 3TB2A 1TXXA 4LL1B 2YJ7A 3DYRA 4J57E 5G2ZA 1UC7A 6GSUA 3TJJA 1YKAA 3C1RA
chains in the Genus database with same CATH superfamily
3LG6A 3W8JA 5IMAA 2RIIA 2OA7A 2FLSA 5D8IA 4GF0A 2I81A 1GTBA 2H72A 3GYKA 3CMIA 2WDUA 3KP9A 2R3XA 2I4AA 2ZNMA 1SU9A 1T1VA 5CRDA 4GWRA 5J41A 1U88A 3V1WA 2XBQA 4WR4A 5D9TA 1ZYPA 4I97A 1A0RP 2UZ8A 3A3TA 1TU8A 3L9VA 5F05A 3GL5A 2A2RA 4V1Ag 5IO0A 3QD9A 5BMUA 1EGOA 2R0PA 1FOHA 5JCGA 2LNTA 3GH9A 4HOJA 5IMCA 3QFAC 4NHWA 4TR1A 2MBSA 3ISOA 1YZXA 2HT9A 1AUCA 4Z2TA 4CHSA 2GS3A 3QCPA 2DJJA 1VF4A 2FCHA 2K8SA 4EVMA 1J0FA 3EU3A 5KOWA 1TW9A 2XC2A 1GSFA 3FMWA 4PTSA 4XHMA 4QQ7A 4JZQA 2B1LA 1BEDA 4YH2A 2FHEA 3AY8A 4RI7A 4KDUA 3CYNA 3F6FA 2P5QA 1I9DA 3DGQA 4F0CA 2J9HA 4Q5QA 1G6YA 4EDZA 2DJ1A 4Z2RA 4JR6A 3WD6A 1QK8A 1S3CA 2DBCA 1UN2A 5B7CA 4HQZA 2AB6A 1WRYA 4X1UA 3VURA 4K9ZA 2CVDA 4L5LA 1SKSB 5J9CA 1PMTA 2ON7A 1B4PA 1GWCA 2JL4A 4BWSA 2CX3A 2AYTA 5FWGA 2YCDA 3ZVJA 1SKRB 1ZCPA 2PVOC 4K2XA 2H1GA 3TGZA 1XFLA 4E8HA 1XWGA 1PA3A 1TTZA 3C8EA 3PINA 2HXKA 3N9JA 1SL1B 1YF0A 3KZQA 3GRXA 4ECBA 1JZWA 1M7TA 2H1BA 1SENA 4DVCA 4ZBAA 1UA5A 2GGTA 3D21A 2HZFA 4EE0A 3UIWA 3TJBA 3BBYA 5L71A 3TKPA 2X4AA 2GT6A 1PKZA 2KLXA 3UVTA 1TRWA 1FB0A 2GVPA 1JZDA 2HSMA 5IIZA 1U3AA 2GLRA 4POLA 4V1Ap 3A2WA 4V2LA 4F9ZA 1JZRA 1QMVA 5IOXA 3FZ9A 4ZXGA 4G10A 4ZB9A 3F4SA 2O89A 5KEJA 2B5EA 3IHGA 3WT2A 1SK2A 4BVYA 4N11A 3M1GA 4Z2UA 3GMFA 1S3AA 4I5QA 4PQIA 5ECIB 4EKZA 4P3YB 4K6XA 3VI5A 3L4NA 1A23A 1V9WA 4HJ2A 5LD0A 2DMLA 3D6IA 3TKSC 2WGRA 2H76A 3FEUA 3G7JA 6GSVA 1S3DA 2IMFA 3C1SA 1T4ZA 3ZIVA 3HVVA 4MZWA 3ZITA 2H0IA 3EVIA 1G0TA 4ZL9A 2WZ9A 1XBSA 2TRCP 4IS0A 4NWYA 1HNCA 5IO2A 5DALB 4ZL7A 3I6AA 1FVJA 2FWGA 3LQ7A 3LGCA 2HFDA 1K0BA 1PL1A 1PN9A 1QUWA 3ZMKA 3F3RA 3RBTA 4MJAA 3ZFBA 3R3EA 4IJIA 5D9VA 2NBSA 1AXDA 4FQUA 5JWRB 3WYWA 3LORA 3QPMA 4MH2A 2FGXA 1ABAA 2R5GA 4DEJA 1Z7PA 1PFOA 3BCIA 4FH8A 4GSNA 1SJ6A 2JSZA 3IAS2 2A2SA 3KIJA 2DMMA 4YQVA 5F0GA 17GSA 5JWQB 4H86A 2YWIA 1T8EB 2LV3A 3E0UA 4GRFA 2GQMA 1X5CA 3EPTA 2PMTA 5DCGA 2IMDA 4WEYA 2QKEA 2OE1A 1Z9HA 5HQPA 3ZIJA 4EC0A 3I9V2 5JWOB 5G30A 3GSSA 1GSSA 1R5AA 2L59A 1XVQA 6GSSA 3C73A 3ERWA 1VGLA 4EUYA 3MYDA 2KUCA 1DE2A 5FHIA 1DBYA 5B6NA 1ML6A 3CSJA 4ZBBA 4GSSA 1EOGA 2VCTA 1GSUA 5DDLA 2R37A 3TDGA 4OFTA 1B8XA 1Q4JA 4TR3A 4AJ6A 4V2MA 2A2PA 1O8WA 2HNLA 1H4OA 1IYIA 3IHQA 1IYHA 2XPEA 4K7OA 4YQMA 2OE0A 12GSA 2RM6A 4POKA 5A4VA 3PPUA 1TDIA 3DD3A 3GL3A 2L4CA 5CAXA 1XVWA 3K8NA 3IOSA 5A4UA 3GTUA 3IK9A 3DRNA 1KTEA 2M46A 3APQA 1HNAA 1ZYNA 2WFCA 3UMAA 1TKDB 4CDOA 2NVLA 3EYTA 3KH7A 3ZL5A 3S9FA 5DALA 5GZZB 3H79A 4BL7B 2CAIA 1XWBA 2OE3A 2QA2A 5CO3A 5LCZA 5A4WA 3F4RA 3MIXA 5F07A 1HNBA 4ZILA 1A8LA 4GSTA 4PQ1A 3DIEA 2IPAA 3D0ZA 3GFKA 2JACA 3GA4A 3GURA 4KCEA 5IM9A 2DLXA 2WS2A 5EL8A 2YPMA 1V57A 1MD4A 2N5BA 2JZRA 1GH2A 2HRNA 1M9BA 2DJ0A 1ON4A 4LMVA 4TOPA 2X8GA 1NHOA 5DQYA 2L5LA 1GLQA 3TKSA 2RM5A 1OYJA 4K2DA 3L9UA 22GSA 2VLUA 1U3IA 3ZREA 1SKWB 3JCML 1PKWA 2E2MA 4GXZA 4MZCA 10GSA 1FOVA 2DJ3A 4EF0A 2KHPA 3ED3A 5D9XA 4OWYA 3VWVA 4TXOB 2C8UA 5C04A 3ZRDA 1V98A 4GTUA 4IHUA 1C72A 2CZ2A 4MH3A 1R5PA 2E2GA 5AN1A 2H19A 5ECLB 4XRDA 3QOUA 2JZTA 9GSSA 4F82A 3FKFA 4HZ4A 1XG8A 2R4VA 3Q74A 4ISDA 1KEBA 1M99A 2H01A 4IKHA 3GUSA 2O8VB 2OACA 3F0IA 1PL2A 3I43A 3P90A 1PGTA 4MZBA 2HRKA 3DKSA 2HRFA 1A24A 4MF7A 3CTFA 1BG5A 4N30A 2FWEA 3D4TA 4L8EA 2IWTA 2AV4A 1XW9A 4PGTA 2RUEA 5HR0A 4PQHA 2M72A 4L5OA 2LRTA 3GNJA 3KXOA 4POBA 5CP1A 7GSSA 3KD0A 4F2IA 2CA8A 4BL7A 11GSA 4G19A 2QA1A 5G1KA 5AGYA 2PWJA 3ERFA 4EIQA 3HJPA 1O7UA 2VL9A 3KTLA 4OCEA 2WB9A 4HUAA 1BYEA 4USSA 1G6WA 4HU9A 2DKHA 2PU9C 3GH6A 3RDWA 1GSQA 3WGEA 3KMNA 2C3TA 3TOUA 3RHBA 1YY7A 4CY6A 5COHA 4ML1A 4KSOA 1ERWA 2H73A 2VUPA 3GKKA 4J2FA 1AW9A 5JCUA 4MCUA 1Z6NA 1WPIA 4ZL8A 1F6MC 3H93A 4AGSA 2H70A 1GUMA 1ACVA 1W4VA 4JBBA 4BVYB 3W6GA 1XW6A 5IMVA 5CREA 1TP9A 1SJIA 1N2AA 1EGRA 1ZOFA 5ECNB 3O3TA 1K3YA 4PNFA 4TXOA 5HFIA 2X8HA 1GRXA 1I5GA 2X8CA 3LXTA 2DSAA 1BQ7A 2H6ZA 3IC4A 2J23A 3F63A 4RI6A 4WF4A 3KEBA 1YDKA 2YZUA 3EMPA 2CAQA 3HA9A 1SL0B 13GSA 1QFNA 3F4TA 4WKWA 2GSSA 3P7XA 3US3A 2A4VA 2DIZA 5CYYA 5J5NA 1LJRA 2I1UA 2TRXA 3PR8A 3ZMLA 2VLTA 4K0NA 5E59A 1PD21 4IVFA 2GSRA 3RAZA 2CT6A 2MBTA 1OKTA 2H6YA 5F06A 2PPTA 2HSYA 4MPGA 2A4HA 3IXRA 2C0FA 3CQFA 1RW1A 1Z5YE 3VPQA 2ZCTA 1QQ2A 2IMIA 4L0UA 5HFGA 4G0KA 2YOIA 3BJ5A 2CQ9A 3FR3A 3FK8A 4OFNA 2I9HA 2IL3A 2V6OA 2R2JA 5GSTA 1O8XA 2YV7A 3LYKA 1M2BA 4ILFA 3FR9A 3TJGA 2L6CA 1Z6MA 4TR4A 4ML6A 3F6DA 3D22A 2GDRA 3CBUA 2C3NA 1GULA 1UVZA 2OADA 5AISA 1V2AA 2H1DA 2VCVA 2LJKA 2LUSA 3KH9A 4KH7A 4NV5A 4ICYA 3M0FA 1HQOA 4JR4A 6GSTA 4YAPA 1J08A 1G7OA 5ELAA 3M9KA 2B7KA 3ME7A 4OCFA 2C4JA 3WT1A 1B9YC 2XHFA 5DBQA 4ZBDA 2V32A 3TCOA 3UAPA 4OD7A 14GSA 3TRXA 1SD9A 3FY7A 2EIQA 4NAXA 4DSQA 4TN8A 4X43A 1PX6A 2CV4A 4MJEA 2X49A 2JADA 2C80A 5H5SA 5DJLA 4AF2A 4GQCA 1T7PB 2F51A 2FY6A 3DWVA 4PUFC 1URMA 1WP0A 4MABA 18GSA 3KP8A 4KDXA 5G5FA 3MWHA 3GTUB 1BJXA 2N5AA 2L57A 2LS5A 4X4JA 2KP1A 1AC1A 4G0LA 1T3BA 1TK5B 1XOBA 2YNXA 4ULXA 5CRGA 1TRVA 2X99A 1SYRA 5D93A 1O81A 3IAM2 1JFUA 3SBCA 3FYGA 1X9MB 4PURA 1JLVA 4OMVA 3F9UA 3DEXA 3A2VA 4WF5A 1Y6EA 4PUAA 1TJDA 2XPDA 6GSWA 1SL2B 1SK1A 2LTKA 1EZKA 2GZPA 4FYUA 2M80A 1CQHA 1TRUA 5DVBA 4IN0A 2LKUA 2WJUA 1ERTA 4ECIA 1VF3A 2C3QA 1PQNA 1XWCA 2OBIA 3GX8A 1O73A 5B6MA 3F8UA 1X5DA 3FZ5A 4PX1A 1WE0A 1E6BA 1TK8B 4HU7A 5CRWA 3VI7A 4LL4B 2HYXA 1Y25A 3MSZA 4QL9A 4AJ8A 4CY8A 2GSTA 1X5EA 4IP6A 1R4WA 4X0XA 5D73A 2H8LA 1H75A 1XXUA 4N10A 3W8SA 4KW6A 4KF9A 4K0GA 5HR2A 2VCZA 1YEXA 2ON5A 2VD0A 4A5PA 4EIPA 3O6TA 2ALBA 3NOFA 1MDJA 3Q18A 5DCHA 1GSEA 1K0CA 3E9JB 3TJFA 4DSRA 3ZYWA 1ZZYA 5DQSA 3UVHA 3VWUA 4JEDA 2IMKA 3OR5A 5KN1A 2VO4A 2FUG2 3GKXA 1M0UA 2WRTA 1R7HA 5IMFA 4NXIA 4HQSA 3ZLPA 3QR6A 5ECSA 2B7JA 2QC7A 2HE3A 1ZYQB 5HFKA 1YF1A 2HSHA 4XIHA 5KN3A 3LYPA 1X9WB 3LEFA 4IQAA 2EIRA 3IR4A 2PBJA 4Q5NA 3HDCA 1ILOA 4N0ZA 1E2YA 3KMOA 4I6XA 1WJKA 4POMA 4BWQA 3VWXA 2LJRA 4K1FA 3ZFLA 3UL3A 5ECQB 2AHEA 2G0FA 3GSTA 2CZ3A 4HJMA 3FRCA 1AAZA 4KGIA 4EL1A 1PRXA 4MDCA 3GV1A 1QXHA 3D5JA 3WGXA 5AIXA 4MPFA 1GTAA 2DKIA 2GT5A 4F03A 1VF2A 3EURA 4O32A 3MDKA 5IOWA 5IMDA 2K6VA 1GSDA 2FWHA 5HR3A 3QDNA 4FYCA 3FR6A 3QFBC 4QL7A 3RPPA 4OO4A 4WBRD 3J7Yb 5CNWA 3R2QA 2LEGA 2V1MA 1MD3A 4ACSA 4IP1A 1B48A 1V40A 3VPTA 4BA7A 4TRXA 1WIKA 3L78A 4O5QA 2C1YA 4BVXA 1THXA 1M3JA 5B8BA 5KN0A 2DJ2A 2QGVA 4IELA 3HVNA 4HEA2 3HVXA 1ZMAA 3QAVA 3IE3A 2L4QA 1USBA 5IQYA 4LMWA 3TJKA 3KM6A 4ECJA 1THOA 3APSA 4EDYA 3BOAA 2I3YA 2YWOA 4K5RA 2PERA 4MLYA 3M3MA 3FZ4A 2JSYA 2CVKA 2VD1A 3EU4A 1AIUA 5ECOB 3P8WA 5BRTA 2MMZA 1OC9B 4RUVA 3IC8A 2VCWA 4HS1A 1EV4A 1MDIA 2XBIA 4HZ2A 2HZEB 2YZHA 4EO3A 2ES7A 3EMXA 1GTUA 1K0DA 2C0GA 3CXGA 1OKDA 2P31A 3C71A 2MMAA 5DAKB 3L9SA 3DXBA 4WETA 2LSTA 1RK4A 1FB6A 2RUFA 3HZ4A 2MMNA 3QAWA 1M9AA 2H1AA 3U5RE 2F9SA 2V6KA 2YJHA 2HRAA 3TRPA 3UARA 2VL2C 2C0EA 1AQVA 4KB3A 3NIVA 2H66A 2PGTA 1XOAA 2LRCA 2K9FA 2R0GA 4KDYA 2E7PA 3LWAA 3TKQA 1FAAA 4JRRA 4O5UA 4XCSA 1W89A 3DMLA 1GSYA 1PN0A 2FNOA 1CQGA 4I8BA 4G2EA 4TW5A 5AIVA 1XCCA 3H1NA 1EP7A 2G2QA 4KNDA 2H0GA 2YANA 3EINA 1MTCA 2YP6A 3A5IA 5B8AA 2LQQA 3HY2A 4K7IA 4ZB8A 1YKCA 2H71A 2BTOT 4CW9A 1PSQA 1FO5A 1OVNA 3MAKA 3Q6OA 2P5RA 1SYXA 3TRQA 2AUVA 3Q19A 3QAGA 6GSXA 2GQKA 2HLSA 1A2LA 3LXZA 2X64A 1EOHA 1TU7A 3EWLA 2H6XA 1DSBA 1K0MA 2VOCA 4BIKA 4K5SA 4I2TA 1K3OA 2C0DA 4K7NA 4L0WA 1LU4A 2GZZA 1M2DA 3HJOA 2O87A 1TOFA 4ECCA 5G31A 3H8QA 3RPNA 1ST9A 2B5YA 3GHAA 3IA1A 5C00A 2VCQA 1Z3EA 3ZTLA 3UBLA 2PUKC 3HCZA 4XRAA 3N5OA 2AJQB 2V2GA 3I69A 1OC9A 2WCIA 4WR5A 3LFLA 4TR0A 3CRTA 5ECRB 1F2EA 4KA0A 3UJ1A 2HZEA 1KNGA 1J9BA 3VLNA 4MJBA 1KBNA 2B6MA 1SJZA 5DAKA 2VLVA 5LNKe 1VF1A 2IN3A 4RQRA 3IDVA 1N8JA 1F37A 4MMMA 4YQUA 3LJRA 2H0HA 4NPBA 4NV2A 2NPBA 5ENUA 4RQXA 3EE2A 5D9WA 3GN3A 2MYGA 2YV9A 1K0OA 4IGJA 3FZAA 4O5RA 5CRHA 1NHYA 4MK3A 1EEMA 3PH9A 1MEKA 4GCIA 3G7YA 3IV4A 3HYPA 1NW2A 1YQ1A 3IK7A 1AQXA 1FW1A 2RLIA 2F8FA 5KN2A 3KCMA 8GSSA 1FVKA 16GSA 1K0NA 1T00A 2IMEA 2TIRA 3GIXA 4MNNA 1K0AA 2YWNA 1EP8A 2F3MA 1M2AA 1K3LA 5KOXA 4DSSB 3FW2A 3P2AA 1OC3A 3J7Yk 3UBKA 5ECMB 5ECPB 2GQLA 4XS6A 6GSYA 1X9SB 2B3SA 2VL2A 1ERVA 2OJLA 3APOA 1FG4A 1FHEA 5D96A 2VM1A 3U6VA 1GUHA 3LW9A 1V58A 1U87A 1SD8A 2JU5A 2KOKA 4OO5A 5E4WA 5IPHA 2Z9SA 5FT3A 4WXTA 2B1KA 1GP1A 2H75A 2BJXA 1R26A 4YKFA 5DJMA 3UEMA 1YJ6A 2L5OA 1OC8A 2EIOA 3CRUA 3M8NA 5EVOA 5ECKB 1WWJA 5ECHB 19GSA 4NHZA 1PX7A 2REMA 1XPVA 2E0QA 4G9HA 2D2ZA 2IJYA 1HYUA 2WULA 3IBHA 4XTSA 4KX4A 3HJMA 4AJ7A 3CSIA 1A0FA 1WOUA 4HSCX 2JZSA 1G7EA 4Q5FA 4BVXB 4D73B 3VFIA 1HD2A 2DJKA 5J9BA 4MF5A 5A5KA 2LQOA 1GNEA 3EC3A 3O76A 3VK9A 5H5RA 4ZIJA 2VM2A 2DIYA 3VWWA 2VAFA 2FA4A 2R0CA 3GKMA 3KJYA 4HDEA 1B4QA 2N5FA 2LRNA 2FD3A 5J4UA 1JLWA 4JE1A 1TRSA 3CTGA 2EC4A 2K8VA 2ZUPA 4O92A 1XIYA 4MA9A 1JHBA 1JZOA 4FYBA 3KGKA 4F0BA 4HI7A 1ZL9A 4MF6A 1TI3A 3WGDA 1F9MA 2NDOA 1A2JA 4LA1A 5ID2B 2LJAA 2LNSA 4GLTA 4EXJA 4DSSA 3DVWA 3IRAA 1EWXA 1XW5A 2IFQB 3DVXA 1QGVA 1DE1A 3UOMA 4YKGA 5G5EA 1T4YA 1S3RA 4E8EA 4I2UA 1B9XC 2AAWA 4TVEA 2R6KA 4MJCA 5GAND 3D4MA 1ZGNA 4XS4B 3TOTA 5EY6A 5GAPD 2MZCA 1O6JA 5INYA 5IPGA 1TK0B 3BCKA 2O7KA 3G7IA 3TKRA 3KTBA 2VIMA 1VRSD 5GSSA 1WMJA 2PN8A 3RHCA 1EEJA 5HR1A 3HVSA 2CVBA 4N0VA 4GQFA 3A5WA 20GSA 3E3EA 3ZVJD 4KCAA 3TUEA 3GKNA 3TKSE 1F3AA 4JU5A 2YWMA 2B5XA 1XWAA 3QMXA 1U6TA 3G9BA 5H5QA 4BPYA 1BX9A 3MNGA 3L0HA 2CX4A 4IQ1A 2DC5A 4D73A 2KP2A 3HKRA 1GLPA 2IIYA 3PGTA 2VCXA 4FIWA 3HHVA 4FO5A 1A2MA 2OKAA 3HD5A 1OE8A 2O85A 4Q5RA 2V41A 5J3RA 1AQWA 5IMZA 4O7HA 1EV9A 2OBKA 1M3IA 3CSHA 2P0GA 4LLRA 1GNWA 1GUKA 4OFMA 4KSMA 4IBPA 3ME8A 2YN1A 1YEPA 1GTIA 2F8AA 2QSIA 2FWFA 4WBJA 5EPFA 1Q98A 5ELGA 4V2NA 4TR1B 3FHKA 3F3QA 5ID2A 1XZOA 4PNGA 1O85A 4ID0A 4PXOA 3BD2A 2GZYA 1GL8A 2K18A 3SWLA 3HZ8A 1ZYEA 2IFQA 5JCWA 5F8BA 1X0RA 1F3BA 4IW9A 1MDKA 3NZNA 4Z7XA 1ERUA 4NMUA 4ZB6A 2H30A 2MMOA 2BMXA 1XWKA 1NM3A 4MP4A 4KAEA 2GTUA 4XS4A 4KE3A 1DUGA 1RQMA 2H74A 3H4KA 3ZZXA 3HXSA 2PVQA 4K8MA 2GSQA 4KUNA 4IJ3A 1A8YA 2L6DA 4TKYA 1BAYA 1SK0A 5ABRA 3M9JA 3ERGA 3GX0A 2FA8A 3LSZA 1NSWA 5G1LA 3IPZA 2HI7A 3A2XA 1TI1A 2VL3A 4TXVA 4XS1A 4YAVA 1OAZA 1Z7RA 1OE7A 2NTOA 3C7MA 1LBKA 4J56E 3TB2A 1TXXA 4LL1B 2YJ7A 3DYRA 4J57E 5G2ZA 1UC7A 4G0IA 6GSUA 3TJJA 1YKAA 3C1RA
chains in the Genus database with same CATH topology
3LG6A 3W8JA 5IMAA 2RIIA 2OA7A 2FLSA 5D8IA 4GF0A 2I81A 1GTBA 2H72A 3GYKA 3CMIA 2WDUA 3KP9A 2R3XA 2I4AA 2ZNMA 1SU9A 1T1VA 5CRDA 4GWRA 5J41A 1U88A 3V1WA 2XBQA 4WR4A 5D9TA 1ZYPA 4I97A 1A0RP 2UZ8A 3A3TA 1TU8A 3L9VA 5F05A 3GL5A 2A2RA 4V1Ag 5IO0A 3QD9A 5BMUA 1EGOA 2R0PA 1FOHA 5JCGA 2LNTA 3GH9A 4HOJA 5IMCA 3QFAC 4NHWA 4TR1A 2MBSA 3ISOA 1YZXA 2HT9A 1AUCA 4Z2TA 4CHSA 2GS3A 3QCPA 2DJJA 1VF4A 2FCHA 2K8SA 4EVMA 1J0FA 3EU3A 5KOWA 1TW9A 2XC2A 1GSFA 3FMWA 4PTSA 4XHMA 4QQ7A 4JZQA 2B1LA 1BEDA 4YH2A 2FHEA 3AY8A 4RI7A 4KDUA 3CYNA 3F6FA 2P5QA 1I9DA 3DGQA 4F0CA 2J9HA 4Q5QA 1G6YA 4EDZA 2DJ1A 4Z2RA 4JR6A 3WD6A 1QK8A 1S3CA 2DBCA 1UN2A 5B7CA 4HQZA 2AB6A 1WRYA 4X1UA 3VURA 4K9ZA 2CVDA 4L5LA 1SKSB 5J9CA 1PMTA 2ON7A 1B4PA 1GWCA 2JL4A 4BWSA 2CX3A 2AYTA 5FWGA 2YCDA 3ZVJA 1SKRB 1ZCPA 2PVOC 4K2XA 2H1GA 3TGZA 1XFLA 4E8HA 1XWGA 1PA3A 1TTZA 3C8EA 3PINA 2HXKA 3N9JA 1SL1B 1YF0A 3KZQA 3GRXA 4ECBA 1JZWA 1M7TA 2H1BA 1SENA 4DVCA 4ZBAA 1UA5A 2GGTA 3D21A 2HZFA 4EE0A 3UIWA 3TJBA 3BBYA 5L71A 3TKPA 2X4AA 2GT6A 1PKZA 2KLXA 3UVTA 1TRWA 1FB0A 2GVPA 1JZDA 2HSMA 5IIZA 1U3AA 2GLRA 4POLA 4V1Ap 3A2WA 4V2LA 4F9ZA 1JZRA 1QMVA 5IOXA 3FZ9A 4ZXGA 4G10A 4ZB9A 3F4SA 2O89A 5KEJA 2B5EA 3IHGA 3WT2A 1SK2A 4BVYA 4N11A 3M1GA 4Z2UA 3GMFA 1S3AA 4I5QA 4PQIA 5ECIB 4EKZA 4P3YB 4K6XA 3VI5A 3L4NA 1A23A 1V9WA 4HJ2A 5LD0A 2DMLA 3D6IA 3TKSC 2WGRA 2H76A 3FEUA 3G7JA 6GSVA 1S3DA 2IMFA 3C1SA 1T4ZA 3ZIVA 3HVVA 4MZWA 3ZITA 2H0IA 3EVIA 1G0TA 4ZL9A 2WZ9A 1XBSA 2TRCP 4IS0A 4NWYA 1HNCA 5IO2A 5DALB 4ZL7A 3I6AA 1FVJA 2FWGA 3LQ7A 3LGCA 2HFDA 1K0BA 1PL1A 1PN9A 1QUWA 3ZMKA 3F3RA 3RBTA 4MJAA 3ZFBA 3R3EA 4IJIA 5D9VA 2NBSA 1AXDA 4FQUA 5JWRB 3WYWA 3LORA 3QPMA 4MH2A 2FGXA 1ABAA 2R5GA 4DEJA 1Z7PA 3BCIA 4FH8A 4GSNA 1SJ6A 2JSZA 3IAS2 2A2SA 3KIJA 2DMMA 4YQVA 5F0GA 17GSA 5JWQB 4H86A 2YWIA 1T8EB 2LV3A 3E0UA 4GRFA 2GQMA 1X5CA 3EPTA 2PMTA 5DCGA 2IMDA 4WEYA 2QKEA 2OE1A 1Z9HA 5HQPA 3ZIJA 4EC0A 3I9V2 5JWOB 5G30A 3GSSA 1GSSA 1R5AA 2L59A 1XVQA 6GSSA 3C73A 3ERWA 1VGLA 4EUYA 3MYDA 2KUCA 1DE2A 5FHIA 1DBYA 5B6NA 1ML6A 3CSJA 4ZBBA 4GSSA 1EOGA 2VCTA 1GSUA 5DDLA 2R37A 3TDGA 4OFTA 1B8XA 1Q4JA 4TR3A 4AJ6A 4V2MA 2A2PA 1O8WA 2HNLA 1H4OA 1IYIA 3IHQA 1IYHA 2XPEA 4K7OA 4YQMA 2OE0A 12GSA 2RM6A 4POKA 5A4VA 3PPUA 1TDIA 3DD3A 3GL3A 2L4CA 5CAXA 1XVWA 3K8NA 3IOSA 5A4UA 3GTUA 3IK9A 3DRNA 1KTEA 2M46A 3APQA 1HNAA 1ZYNA 2WFCA 3UMAA 1TKDB 4CDOA 2NVLA 3EYTA 3KH7A 3ZL5A 3S9FA 5DALA 5GZZB 3H79A 4BL7B 2CAIA 1XWBA 2OE3A 2QA2A 5CO3A 5LCZA 5A4WA 3F4RA 3MIXA 5F07A 1HNBA 4ZILA 1A8LA 4GSTA 4PQ1A 3DIEA 2IPAA 3D0ZA 3GFKA 2JACA 3GA4A 3GURA 4KCEA 5IM9A 2DLXA 2WS2A 5EL8A 2YPMA 1V57A 1MD4A 2N5BA 2JZRA 1GH2A 2HRNA 1M9BA 2DJ0A 1ON4A 4LMVA 4TOPA 2X8GA 1NHOA 5DQYA 2L5LA 1GLQA 3TKSA 2RM5A 1OYJA 4K2DA 3L9UA 22GSA 2VLUA 1U3IA 3ZREA 1SKWB 3JCML 1PKWA 2E2MA 4GXZA 4MZCA 10GSA 1FOVA 2DJ3A 4EF0A 2KHPA 3ED3A 5D9XA 4OWYA 3VWVA 4TXOB 2C8UA 5C04A 3ZRDA 1V98A 4GTUA 4IHUA 1C72A 2CZ2A 4MH3A 1R5PA 2E2GA 5AN1A 2H19A 5ECLB 4XRDA 3QOUA 2JZTA 9GSSA 4F82A 3FKFA 4HZ4A 2R4VA 3Q74A 4ISDA 1KEBA 1M99A 2H01A 4IKHA 3GUSA 2O8VB 2OACA 3F0IA 1PL2A 3I43A 3P90A 1PGTA 4MZBA 2HRKA 3DKSA 2HRFA 1A24A 4MF7A 3CTFA 1BG5A 4N30A 2FWEA 3D4TA 4L8EA 2IWTA 2AV4A 1XW9A 4PGTA 2RUEA 5HR0A 4PQHA 2M72A 4L5OA 2LRTA 3GNJA 3KXOA 4POBA 5CP1A 7GSSA 3KD0A 4F2IA 2CA8A 4BL7A 11GSA 4G19A 2QA1A 5G1KA 5AGYA 2PWJA 3ERFA 4EIQA 3HJPA 1O7UA 2VL9A 3KTLA 4OCEA 2WB9A 4HUAA 1BYEA 4USSA 1G6WA 4HU9A 2DKHA 2PU9C 3GH6A 3RDWA 1GSQA 3WGEA 3KMNA 2C3TA 3TOUA 3RHBA 1YY7A 4CY6A 5COHA 4ML1A 4KSOA 1ERWA 2H73A 2VUPA 3GKKA 4J2FA 1AW9A 5JCUA 4MCUA 1Z6NA 1WPIA 4ZL8A 1F6MC 3H93A 4AGSA 2H70A 1GUMA 1ACVA 1W4VA 4JBBA 4BVYB 3W6GA 1XW6A 5IMVA 5CREA 1TP9A 1SJIA 1N2AA 1EGRA 1ZOFA 5ECNB 3O3TA 1K3YA 4PNFA 4TXOA 5HFIA 2X8HA 1GRXA 1I5GA 2X8CA 3LXTA 2DSAA 1BQ7A 2H6ZA 3IC4A 2J23A 3F63A 4RI6A 4WF4A 3KEBA 1YDKA 2YZUA 3EMPA 2CAQA 3HA9A 1SL0B 13GSA 1QFNA 3F4TA 4WKWA 2GSSA 3P7XA 3US3A 2A4VA 2DIZA 5CYYA 5J5NA 1LJRA 2I1UA 2TRXA 3PR8A 3ZMLA 2VLTA 4K0NA 5E59A 1PD21 4IVFA 2GSRA 3RAZA 2CT6A 2MBTA 1OKTA 2H6YA 5F06A 2PPTA 2HSYA 4MPGA 2A4HA 3IXRA 2C0FA 1RW1A 1Z5YE 3VPQA 2ZCTA 1QQ2A 2IMIA 4L0UA 5HFGA 4G0KA 2YOIA 3BJ5A 2CQ9A 3FR3A 3FK8A 4OFNA 2I9HA 2IL3A 2V6OA 2R2JA 5GSTA 1O8XA 2YV7A 3LYKA 1M2BA 4ILFA 3FR9A 3TJGA 2L6CA 1Z6MA 4TR4A 4ML6A 3F6DA 3D22A 2GDRA 3CBUA 2C3NA 1GULA 1UVZA 2OADA 5AISA 1V2AA 2H1DA 2VCVA 2LJKA 2LUSA 3KH9A 4KH7A 4NV5A 4ICYA 3M0FA 1HQOA 4JR4A 6GSTA 4YAPA 1J08A 1G7OA 5ELAA 3M9KA 2B7KA 3ME7A 4OCFA 2C4JA 3WT1A 1B9YC 2XHFA 5DBQA 4ZBDA 2V32A 3TCOA 3UAPA 4OD7A 14GSA 3TRXA 1SD9A 3FY7A 2EIQA 4NAXA 4DSQA 4TN8A 4X43A 1PX6A 2CV4A 4MJEA 2X49A 2JADA 2C80A 5H5SA 5DJLA 4AF2A 4GQCA 1T7PB 2F51A 2FY6A 3DWVA 4PUFC 1URMA 1WP0A 4MABA 18GSA 3KP8A 4KDXA 5G5FA 3MWHA 3GTUB 1BJXA 2N5AA 2L57A 2LS5A 4X4JA 2KP1A 1AC1A 4G0LA 1T3BA 1TK5B 1XOBA 2YNXA 4ULXA 5CRGA 1TRVA 2X99A 1SYRA 5D93A 1O81A 3IAM2 1JFUA 3SBCA 3FYGA 1X9MB 4PURA 1JLVA 4OMVA 3F9UA 3DEXA 3A2VA 4WF5A 1Y6EA 4PUAA 1TJDA 2XPDA 6GSWA 1SL2B 1SK1A 2LTKA 1EZKA 2GZPA 4FYUA 2M80A 1CQHA 1TRUA 5DVBA 4IN0A 2LKUA 2WJUA 1ERTA 4ECIA 1VF3A 2C3QA 1PQNA 1XWCA 2OBIA 3GX8A 1O73A 5B6MA 3F8UA 1X5DA 3FZ5A 4PX1A 1WE0A 1E6BA 1TK8B 4HU7A 5CRWA 3VI7A 4LL4B 2HYXA 1Y25A 3MSZA 4QL9A 4AJ8A 4CY8A 2GSTA 1X5EA 4IP6A 1R4WA 4X0XA 5D73A 2H8LA 1H75A 1XXUA 4N10A 3W8SA 4KW6A 4KF9A 4K0GA 5HR2A 2VCZA 1YEXA 2ON5A 2VD0A 4A5PA 4EIPA 3O6TA 2ALBA 3NOFA 1MDJA 3Q18A 5DCHA 1GSEA 1K0CA 3E9JB 3TJFA 4DSRA 3ZYWA 1ZZYA 5DQSA 3UVHA 3VWUA 4JEDA 2IMKA 3OR5A 5KN1A 2VO4A 2FUG2 3GKXA 1M0UA 2WRTA 1R7HA 5IMFA 4NXIA 4HQSA 3ZLPA 3QR6A 5ECSA 2B7JA 2QC7A 2HE3A 1ZYQB 5HFKA 1YF1A 2HSHA 4XIHA 5KN3A 3LYPA 1X9WB 3LEFA 4IQAA 2EIRA 3IR4A 2PBJA 4Q5NA 3HDCA 1ILOA 4N0ZA 1E2YA 3KMOA 4I6XA 1WJKA 4POMA 4BWQA 3VWXA 2LJRA 4K1FA 3ZFLA 3UL3A 5ECQB 2AHEA 2G0FA 3GSTA 2CZ3A 4HJMA 3FRCA 1AAZA 4KGIA 4EL1A 1PRXA 4MDCA 3GV1A 1QXHA 3D5JA 3WGXA 5AIXA 4MPFA 1GTAA 2DKIA 2GT5A 4F03A 1VF2A 3EURA 4O32A 3MDKA 5IOWA 5IMDA 2K6VA 1GSDA 2FWHA 5HR3A 3QDNA 4FYCA 3FR6A 3QFBC 4QL7A 3RPPA 4OO4A 4WBRD 3J7Yb 5CNWA 3R2QA 2LEGA 2V1MA 1MD3A 4ACSA 4IP1A 1B48A 1V40A 3VPTA 4BA7A 4TRXA 1WIKA 3L78A 4O5QA 2C1YA 4BVXA 1THXA 5B8BA 5KN0A 2DJ2A 2QGVA 4IELA 4HEA2 3HVXA 1ZMAA 3QAVA 3IE3A 2L4QA 1USBA 5IQYA 4LMWA 3TJKA 3KM6A 4ECJA 1THOA 3APSA 4EDYA 3BOAA 2I3YA 2YWOA 4K5RA 2PERA 4MLYA 3M3MA 3FZ4A 2JSYA 2CVKA 2VD1A 3EU4A 1AIUA 5ECOB 3P8WA 5BRTA 2MMZA 1OC9B 4RUVA 3IC8A 2VCWA 4HS1A 1EV4A 1MDIA 2XBIA 4HZ2A 2HZEB 2YZHA 4EO3A 2ES7A 3EMXA 1GTUA 1K0DA 2C0GA 3CXGA 1OKDA 2P31A 3C71A 2MMAA 5DAKB 3L9SA 3DXBA 4WETA 2LSTA 1RK4A 1FB6A 2RUFA 3HZ4A 2MMNA 3QAWA 1M9AA 2H1AA 3U5RE 2F9SA 2V6KA 2YJHA 2HRAA 3TRPA 3UARA 2VL2C 2C0EA 1AQVA 4KB3A 3NIVA 2H66A 2PGTA 1XOAA 2LRCA 2K9FA 2R0GA 4KDYA 2E7PA 3LWAA 3TKQA 1FAAA 4JRRA 4O5UA 4XCSA 1W89A 3DMLA 1GSYA 1PN0A 2FNOA 1CQGA 4I8BA 4G2EA 4TW5A 5AIVA 1XCCA 3H1NA 1EP7A 2G2QA 4KNDA 2H0GA 2YANA 3EINA 1MTCA 2YP6A 3A5IA 5B8AA 2LQQA 3HY2A 4K7IA 4ZB8A 1YKCA 2H71A 2BTOT 4CW9A 1PSQA 1FO5A 1OVNA 3MAKA 3Q6OA 2P5RA 1SYXA 3TRQA 2AUVA 3Q19A 3QAGA 6GSXA 2GQKA 2HLSA 1A2LA 3LXZA 2X64A 1EOHA 1TU7A 3EWLA 2H6XA 1DSBA 1K0MA 2VOCA 4K5SA 4I2TA 1K3OA 2C0DA 4K7NA 4L0WA 1LU4A 2GZZA 1M2DA 3HJOA 2O87A 1TOFA 4ECCA 5G31A 3H8QA 3RPNA 1ST9A 2B5YA 3GHAA 3IA1A 5C00A 2VCQA 1Z3EA 3ZTLA 3UBLA 2PUKC 3HCZA 4XRAA 3N5OA 2AJQB 2V2GA 3I69A 1OC9A 2WCIA 4WR5A 3LFLA 4TR0A 3CRTA 5ECRB 1F2EA 4KA0A 3UJ1A 2HZEA 1KNGA 1J9BA 3VLNA 4MJBA 1KBNA 2B6MA 1SJZA 5DAKA 2VLVA 5LNKe 1VF1A 2IN3A 4RQRA 3IDVA 1N8JA 1F37A 4MMMA 4YQUA 3LJRA 2H0HA 4NPBA 4NV2A 2NPBA 5ENUA 4RQXA 3EE2A 5D9WA 3GN3A 2MYGA 2YV9A 1K0OA 4IGJA 3FZAA 4O5RA 5CRHA 1NHYA 4MK3A 1EEMA 3PH9A 1MEKA 4GCIA 3G7YA 3IV4A 3HYPA 1NW2A 1YQ1A 3IK7A 1AQXA 1FW1A 2RLIA 2F8FA 5KN2A 3KCMA 8GSSA 1FVKA 16GSA 1K0NA 1T00A 2IMEA 2TIRA 3GIXA 4MNNA 1K0AA 2YWNA 1EP8A 2F3MA 1M2AA 1K3LA 5KOXA 4DSSB 3FW2A 3P2AA 1OC3A 3J7Yk 3UBKA 5ECMB 5ECPB 2GQLA 4XS6A 6GSYA 1X9SB 2B3SA 2VL2A 1ERVA 2OJLA 3APOA 1FG4A 1FHEA 5D96A 2VM1A 3U6VA 1GUHA 3LW9A 1V58A 1U87A 1SD8A 2JU5A 2KOKA 4OO5A 5E4WA 5IPHA 2Z9SA 5FT3A 4WXTA 2B1KA 1GP1A 2H75A 2BJXA 1R26A 4YKFA 5DJMA 3UEMA 1YJ6A 2L5OA 1OC8A 2EIOA 3CRUA 3M8NA 5EVOA 5ECKB 1WWJA 5ECHB 19GSA 4NHZA 1PX7A 2REMA 1XPVA 2E0QA 4G9HA 2D2ZA 2IJYA 1HYUA 2WULA 3IBHA 4XTSA 4KX4A 3HJMA 4AJ7A 3CSIA 1A0FA 1WOUA 2JZSA 1G7EA 4Q5FA 4BVXB 4D73B 3VFIA 1HD2A 2DJKA 5J9BA 4MF5A 5A5KA 2LQOA 1GNEA 3EC3A 3O76A 3VK9A 5H5RA 4ZIJA 2VM2A 2DIYA 3VWWA 2VAFA 2FA4A 2R0CA 3GKMA 3KJYA 4HDEA 1B4QA 2N5FA 2LRNA 2FD3A 5J4UA 1JLWA 4JE1A 1TRSA 3CTGA 2EC4A 2K8VA 2ZUPA 4O92A 1XIYA 4MA9A 1JHBA 1JZOA 4FYBA 3KGKA 4F0BA 4HI7A 1ZL9A 4MF6A 1TI3A 3WGDA 1F9MA 2NDOA 1A2JA 4LA1A 5ID2B 2LJAA 2LNSA 4GLTA 4EXJA 4DSSA 3DVWA 3IRAA 1EWXA 1XW5A 2IFQB 3DVXA 1QGVA 1DE1A 3UOMA 4YKGA 5G5EA 1T4YA 4E8EA 4I2UA 1B9XC 2AAWA 4TVEA 2R6KA 4MJCA 5GAND 3D4MA 1ZGNA 4XS4B 3TOTA 5EY6A 5GAPD 2MZCA 1O6JA 5INYA 5IPGA 1TK0B 3BCKA 2O7KA 3G7IA 3TKRA 3KTBA 2VIMA 1VRSD 5GSSA 1WMJA 2PN8A 3RHCA 1EEJA 5HR1A 3HVSA 2CVBA 4N0VA 4GQFA 3A5WA 20GSA 3E3EA 3ZVJD 4KCAA 3TUEA 3GKNA 3TKSE 1F3AA 4JU5A 2YWMA 2B5XA 1XWAA 3QMXA 1U6TA 3G9BA 5H5QA 4BPYA 1BX9A 3MNGA 3L0HA 2CX4A 4IQ1A 2DC5A 4D73A 2KP2A 3HKRA 1GLPA 2IIYA 3PGTA 2VCXA 4FIWA 3HHVA 4FO5A 1A2MA 2OKAA 3HD5A 1OE8A 2O85A 4Q5RA 2V41A 5J3RA 1AQWA 5IMZA 4O7HA 1EV9A 2OBKA 3CSHA 2P0GA 4LLRA 1GNWA 1GUKA 4OFMA 4KSMA 4IBPA 3ME8A 2YN1A 1YEPA 1GTIA 2F8AA 2QSIA 2FWFA 4WBJA 5EPFA 1Q98A 5ELGA 4V2NA 4TR1B 3FHKA 3F3QA 5ID2A 1XZOA 4PNGA 1O85A 4ID0A 4PXOA 3BD2A 2GZYA 1GL8A 2K18A 3SWLA 3HZ8A 1ZYEA 2IFQA 5JCWA 5F8BA 1X0RA 1F3BA 4IW9A 1MDKA 3NZNA 4Z7XA 1ERUA 4NMUA 4ZB6A 2H30A 2MMOA 2BMXA 1XWKA 1NM3A 4MP4A 4KAEA 2GTUA 4XS4A 4KE3A 1DUGA 1RQMA 2H74A 3H4KA 3ZZXA 3HXSA 2PVQA 4K8MA 2GSQA 4KUNA 4IJ3A 1A8YA 2L6DA 4TKYA 1BAYA 1SK0A 5ABRA 3M9JA 3ERGA 3GX0A 2FA8A 3LSZA 1NSWA 5G1LA 3IPZA 2HI7A 3A2XA 1TI1A 2VL3A 4TXVA 4XS1A 4YAVA 1OAZA 1Z7RA 1OE7A 2NTOA 3C7MA 1LBKA 4J56E 3TB2A 1TXXA 4LL1B 2YJ7A 3DYRA 4J57E 5G2ZA 1UC7A 4G0IA 6GSUA 3TJJA 1YKAA 3C1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LG6 A;  3W8J A;  5IMA A;  2RII A;  2OA7 A;  2FLS A;  5D8I A;  4GF0 A;  2I81 A;  1GTB A;  2H72 A;  3GYK A;  3CMI A;  2WDU A;  3KP9 A;  2R3X A;  2I4A A;  2ZNM A;  1SU9 A;  1T1V A;  5CRD A;  4GWR A;  5J41 A;  1U88 A;  3V1W A;  2XBQ A;  4WR4 A;  5D9T A;  4I97 A;  1A0R P;  3L9V A;  3A3T A;  1TU8 A;  5F05 A;  3GL5 A;  2A2R A;  4V1A g;  5IO0 A;  3QD9 A;  1EGO A;  5JCG A;  2LNT A;  3GH9 A;  4HOJ A;  5IMC A;  3QFA C;  4NHW A;  4TR1 A;  2MBS A;  3ISO A;  1YZX A;  2HT9 A;  1AUC A;  4CHS A;  2GS3 A;  3QCP A;  2DJJ A;  1VF4 A;  2FCH A;  2K8S A;  4EVM A;  1J0F A;  3EU3 A;  1TW9 A;  2XC2 A;  1GSF A;  4XHM A;  4QQ7 A;  4JZQ A;  2B1L A;  1BED A;  4YH2 A;  2FHE A;  3AY8 A;  4RI7 A;  4KDU A;  3CYN A;  3F6F A;  2P5Q A;  1I9D A;  3DGQ A;  4F0C A;  2J9H A;  4Q5Q A;  1G6Y A;  4EDZ A;  2DJ1 A;  4JR6 A;  3WD6 A;  1QK8 A;  1S3C A;  2DBC A;  1UN2 A;  5B7C A;  4HQZ A;  2AB6 A;  1WRY A;  4X1U A;  3VUR A;  4K9Z A;  2CVD A;  4L5L A;  1SKS B;  5J9C A;  1PMT A;  2ON7 A;  1B4P A;  1GWC A;  2JL4 A;  4BWS A;  2CX3 A;  2AYT A;  5FWG A;  2YCD A;  3ZVJ A;  1SKR B;  1ZCP A;  2PVO C;  3TGZ A;  2H1G A;  1XFL A;  4E8H A;  1XWG A;  1PA3 A;  1TTZ A;  3C8E A;  3PIN A;  2HXK A;  3N9J A;  1SL1 B;  1YF0 A;  3KZQ A;  3GRX A;  4ECB A;  1JZW A;  1M7T A;  2H1B A;  1SEN A;  4DVC A;  4ZBA A;  1UA5 A;  2GGT A;  3D21 A;  2HZF A;  4EE0 A;  3UIW A;  3TJB A;  3BBY A;  5L71 A;  3TKP A;  2GT6 A;  1PKZ A;  2KLX A;  3UVT A;  1TRW A;  1FB0 A;  2GVP A;  1JZD A;  5IIZ A;  1U3A A;  2GLR A;  4POL A;  4V1A p;  3A2W A;  4V2L A;  4F9Z A;  1JZR A;  1QMV A;  5IOX A;  3FZ9 A;  4ZXG A;  4G10 A;  4ZB9 A;  3F4S A;  2O89 A;  5KEJ A;  2B5E A;  3WT2 A;  1SK2 A;  4BVY A;  4N11 A;  3M1G A;  3GMF A;  1S3A A;  4I5Q A;  4PQI A;  5ECI B;  4EKZ A;  4P3Y B;  4K6X A;  3VI5 A;  3L4N A;  1A23 A;  1V9W A;  4HJ2 A;  5LD0 A;  2DML A;  3D6I A;  3TKS C;  2WGR A;  2H76 A;  3FEU A;  3G7J A;  6GSV A;  1S3D A;  2IMF A;  3C1S A;  1T4Z A;  3ZIV A;  3HVV A;  4MZW A;  3ZIT A;  2H0I A;  3EVI A;  1G0T A;  4ZL9 A;  2WZ9 A;  1XBS A;  2TRC P;  4IS0 A;  4NWY A;  1HNC A;  5IO2 A;  5DAL B;  4ZL7 A;  3I6A A;  1FVJ A;  2FWG A;  3LQ7 A;  3LGC A;  2HFD A;  1K0B A;  1PL1 A;  1PN9 A;  1QUW A;  3ZMK A;  3F3R A;  3RBT A;  4MJA A;  3ZFB A;  4IJI A;  5D9V A;  2NBS A;  1AXD A;  5JWR B;  3WYW A;  3LOR A;  3QPM A;  4MH2 A;  2FGX A;  1ABA A;  2R5G A;  4DEJ A;  1Z7P A;  3BCI A;  4FH8 A;  4GSN A;  1SJ6 A;  2JSZ A;  3IAS 2;  2A2S A;  3KIJ A;  2DMM A;  4YQV A;  5F0G A;  17GS A;  5JWQ B;  4H86 A;  2YWI A;  1T8E B;  2LV3 A;  3E0U A;  4GRF A;  2GQM A;  1X5C A;  2PMT A;  5DCG A;  2IMD A;  4WEY A;  2QKE A;  2OE1 A;  1Z9H A;  5HQP A;  3ZIJ A;  4EC0 A;  3I9V 2;  5JWO B;  5G30 A;  3GSS A;  1GSS A;  1R5A A;  2L59 A;  1XVQ A;  6GSS A;  3C73 A;  3ERW A;  1VGL A;  4EUY A;  2KUC A;  1DE2 A;  5FHI A;  1DBY A;  5B6N A;  1ML6 A;  3CSJ A;  4ZBB A;  4GSS A;  1EOG A;  2VCT A;  1GSU A;  5DDL A;  2R37 A;  3TDG A;  4OFT A;  1B8X A;  1Q4J A;  4TR3 A;  4AJ6 A;  4V2M A;  1O8W A;  2HNL A;  1H4O A;  1IYI A;  3IHQ A;  1IYH A;  2XPE A;  4K7O A;  4YQM A;  2OE0 A;  12GS A;  2RM6 A;  4POK A;  5A4V A;  1TDI A;  3DD3 A;  3GL3 A;  2L4C A;  5CAX A;  1XVW A;  3K8N A;  3IOS A;  5A4U A;  3GTU A;  3IK9 A;  3DRN A;  1KTE A;  2M46 A;  3APQ A;  1HNA A;  2WFC A;  3UMA A;  1TKD B;  4CDO A;  2NVL A;  3EYT A;  3KH7 A;  3ZL5 A;  3S9F A;  5DAL A;  5GZZ B;  3H79 A;  2CAI A;  1XWB A;  2OE3 A;  5CO3 A;  5LCZ A;  5A4W A;  3F4R A;  5F07 A;  1HNB A;  4ZIL A;  1A8L A;  4GST A;  4PQ1 A;  3DIE A;  2IPA A;  3D0Z A;  3GFK A;  2JAC A;  3GA4 A;  3GUR A;  4KCE A;  5IM9 A;  2DLX A;  2WS2 A;  5EL8 A;  2YPM A;  1V57 A;  1MD4 A;  2N5B A;  2JZR A;  1GH2 A;  2HRN A;  1M9B A;  2DJ0 A;  1ON4 A;  4LMV A;  4TOP A;  2X8G A;  1NHO A;  5DQY A;  2L5L A;  1GLQ A;  3TKS A;  2RM5 A;  1OYJ A;  4K2D A;  3L9U A;  22GS A;  2VLU A;  1U3I A;  3ZRE A;  1SKW B;  3JCM L;  1PKW A;  2E2M A;  4GXZ A;  4MZC A;  10GS A;  1FOV A;  2DJ3 A;  4EF0 A;  2KHP A;  3ED3 A;  5D9X A;  4OWY A;  3VWV A;  4TXO B;  2C8U A;  5C04 A;  3ZRD A;  1V98 A;  4GTU A;  4IHU A;  1C72 A;  2CZ2 A;  4MH3 A;  1R5P A;  2E2G A;  5AN1 A;  2H19 A;  5ECL B;  4XRD A;  3QOU A;  2JZT A;  9GSS A;  4F82 A;  3FKF A;  4HZ4 A;  2R4V A;  3Q74 A;  4ISD A;  1KEB A;  1M99 A;  2H01 A;  4IKH A;  3GUS A;  2O8V B;  2OAC A;  3F0I A;  1PL2 A;  3I43 A;  3P90 A;  1PGT A;  4MZB A;  3DKS A;  2HRF A;  1A24 A;  4MF7 A;  3CTF A;  1BG5 A;  4N30 A;  2FWE A;  3D4T A;  4L8E A;  2IWT A;  2AV4 A;  1XW9 A;  4PGT A;  2RUE A;  5HR0 A;  4PQH A;  2M72 A;  4L5O A;  2LRT A;  3GNJ A;  3KXO A;  4POB A;  5CP1 A;  7GSS A;  3KD0 A;  4F2I A;  2CA8 A;  4BL7 A;  11GS A;  4G19 A;  5G1K A;  5AGY A;  2PWJ A;  3ERF A;  3HJP A;  1O7U A;  2VL9 A;  3KTL A;  4OCE A;  2WB9 A;  4HUA A;  1BYE A;  1G6W A;  4HU9 A;  2PU9 C;  3GH6 A;  3RDW A;  1GSQ A;  3WGE A;  3KMN A;  2C3T A;  3TOU A;  3RHB A;  1YY7 A;  5COH A;  4ML1 A;  4KSO A;  1ERW A;  2H73 A;  2VUP A;  3GKK A;  4J2F A;  1AW9 A;  5JCU A;  4MCU A;  1Z6N A;  1WPI A;  4ZL8 A;  1F6M C;  3H93 A;  4AGS A;  2H70 A;  1GUM A;  1ACV A;  1W4V A;  4JBB A;  3W6G A;  1XW6 A;  5IMV A;  5CRE A;  1TP9 A;  1SJI A;  1N2A A;  1EGR A;  1ZOF A;  5ECN B;  3O3T A;  1K3Y A;  4PNF A;  4TXO A;  5HFI A;  2X8H A;  1GRX A;  1I5G A;  2X8C A;  3LXT A;  2DSA A;  1BQ7 A;  2H6Z A;  3IC4 A;  2J23 A;  3F63 A;  4RI6 A;  4WF4 A;  3KEB A;  1YDK A;  2YZU A;  3EMP A;  2CAQ A;  3HA9 A;  1SL0 B;  13GS A;  1QFN A;  3F4T A;  4WKW A;  2GSS A;  3P7X A;  3US3 A;  2A4V A;  2DIZ A;  5CYY A;  5J5N A;  1LJR A;  2I1U A;  2TRX A;  3PR8 A;  3ZML A;  2VLT A;  4K0N A;  5E59 A;  1PD2 1;  4IVF A;  2GSR A;  3RAZ A;  2CT6 A;  2MBT A;  1OKT A;  2H6Y A;  5F06 A;  2PPT A;  2HSY A;  4MPG A;  3IXR A;  2C0F A;  1RW1 A;  1Z5Y E;  3VPQ A;  2ZCT A;  1QQ2 A;  2IMI A;  4L0U A;  5HFG A;  2YOI A;  3BJ5 A;  2CQ9 A;  3FR3 A;  3FK8 A;  4OFN A;  2I9H A;  2IL3 A;  2V6O A;  2R2J A;  5GST A;  1O8X A;  2YV7 A;  3LYK A;  1M2B A;  4ILF A;  3FR9 A;  3TJG A;  2L6C A;  1Z6M A;  4TR4 A;  4ML6 A;  3F6D A;  3D22 A;  2GDR A;  3CBU A;  2C3N A;  1GUL A;  1UVZ A;  2OAD A;  5AIS A;  1V2A A;  2H1D A;  2VCV A;  2LJK A;  2LUS A;  3KH9 A;  4KH7 A;  4NV5 A;  3M0F A;  1HQO A;  4JR4 A;  6GST A;  4YAP A;  1J08 A;  1G7O A;  5ELA A;  3M9K A;  2B7K A;  3ME7 A;  4OCF A;  2C4J A;  3WT1 A;  1B9Y C;  2XHF A;  5DBQ A;  4ZBD A;  2V32 A;  3TCO A;  3UAP A;  4OD7 A;  14GS A;  3TRX A;  1SD9 A;  3FY7 A;  2EIQ A;  4NAX A;  4DSQ A;  4TN8 A;  4X43 A;  1PX6 A;  2CV4 A;  4MJE A;  2JAD A;  2C80 A;  5H5S A;  5DJL A;  4AF2 A;  4GQC A;  1T7P B;  2F51 A;  2FY6 A;  3DWV A;  4PUF C;  1URM A;  1WP0 A;  4MAB A;  18GS A;  3KP8 A;  4KDX A;  5G5F A;  3MWH A;  3GTU B;  1BJX A;  2N5A A;  2L57 A;  2LS5 A;  2KP1 A;  1AC1 A;  1T3B A;  1TK5 B;  1XOB A;  2YNX A;  4ULX A;  5CRG A;  1TRV A;  2X99 A;  1SYR A;  5D93 A;  1O81 A;  3IAM 2;  1JFU A;  3SBC A;  3FYG A;  1X9M B;  4PUR A;  1JLV A;  4OMV A;  3F9U A;  3DEX A;  3A2V A;  4WF5 A;  1Y6E A;  4PUA A;  1TJD A;  2XPD A;  6GSW A;  1SL2 B;  1SK1 A;  2LTK A;  1EZK A;  2GZP A;  4FYU A;  2M80 A;  1CQH A;  1TRU A;  5DVB A;  4IN0 A;  2LKU A;  2WJU A;  1ERT A;  4ECI A;  1VF3 A;  2C3Q A;  1PQN A;  1XWC A;  2OBI A;  3GX8 A;  1O73 A;  5B6M A;  3F8U A;  1X5D A;  3FZ5 A;  4PX1 A;  1WE0 A;  1E6B A;  1TK8 B;  4HU7 A;  5CRW A;  3VI7 A;  4LL4 B;  2HYX A;  1Y25 A;  3MSZ A;  4QL9 A;  4AJ8 A;  2GST A;  1X5E A;  4IP6 A;  1R4W A;  4X0X A;  5D73 A;  2H8L A;  1H75 A;  1XXU A;  4N10 A;  3W8S A;  4KW6 A;  4K0G A;  5HR2 A;  2VCZ A;  1YEX A;  2ON5 A;  2VD0 A;  3O6T A;  2ALB A;  3NOF A;  1MDJ A;  3Q18 A;  5DCH A;  1GSE A;  1K0C A;  3E9J B;  3TJF A;  4DSR A;  3ZYW A;  1ZZY A;  5DQS A;  3UVH A;  3VWU A;  4JED A;  2IMK A;  3OR5 A;  5KN1 A;  2VO4 A;  2FUG 2;  3GKX A;  1M0U A;  2WRT A;  1R7H A;  5IMF A;  4NXI A;  4HQS A;  3ZLP A;  3QR6 A;  5ECS A;  2B7J A;  2QC7 A;  2HE3 A;  1ZYQ B;  5HFK A;  1YF1 A;  2HSH A;  4XIH A;  5KN3 A;  3LYP A;  1X9W B;  3LEF A;  4IQA A;  2EIR A;  3IR4 A;  2PBJ A;  4Q5N A;  3HDC A;  1ILO A;  4N0Z A;  1E2Y A;  3KMO A;  4I6X A;  1WJK A;  4POM A;  4BWQ A;  3VWX A;  2LJR A;  4K1F A;  3ZFL A;  3UL3 A;  5ECQ B;  2AHE A;  2G0F A;  3GST A;  2CZ3 A;  4HJM A;  3FRC A;  1AAZ A;  4KGI A;  4EL1 A;  1PRX A;  4MDC A;  3GV1 A;  1QXH A;  3D5J A;  3WGX A;  5AIX A;  4MPF A;  1GTA A;  2GT5 A;  4F03 A;  1VF2 A;  3EUR A;  4O32 A;  3MDK A;  5IOW A;  5IMD A;  2K6V A;  1GSD A;  2FWH A;  5HR3 A;  3QDN A;  4FYC A;  3FR6 A;  3QFB C;  4QL7 A;  3RPP A;  4OO4 A;  4WBR D;  3J7Y b;  5CNW A;  3R2Q A;  2LEG A;  2V1M A;  1MD3 A;  4ACS A;  4IP1 A;  1B48 A;  1V40 A;  3VPT A;  4BA7 A;  4TRX A;  1WIK A;  3L78 A;  2C1Y A;  4BVX A;  1THX A;  5B8B A;  5KN0 A;  2DJ2 A;  2QGV A;  4IEL A;  4HEA 2;  3HVX A;  1ZMA A;  3QAV A;  3IE3 A;  2L4Q A;  1USB A;  5IQY A;  4LMW A;  3TJK A;  3KM6 A;  4ECJ A;  1THO A;  3APS A;  4EDY A;  3BOA A;  2I3Y A;  2YWO A;  2PER A;  4MLY A;  3M3M A;  3FZ4 A;  2JSY A;  2CVK A;  2VD1 A;  3EU4 A;  1AIU A;  5ECO B;  3P8W A;  2MMZ A;  1OC9 B;  4RUV A;  2VCW A;  4HS1 A;  1EV4 A;  1MDI A;  2XBI A;  4HZ2 A;  2HZE B;  2YZH A;  4EO3 A;  2ES7 A;  3EMX A;  1GTU A;  1K0D A;  2C0G A;  3CXG A;  1OKD A;  2P31 A;  3C71 A;  2MMA A;  5DAK B;  3L9S A;  3DXB A;  4WET A;  2LST A;  1RK4 A;  1FB6 A;  2RUF A;  3HZ4 A;  2MMN A;  3QAW A;  1M9A A;  2H1A A;  3U5R E;  2F9S A;  2V6K A;  2YJH A;  3TRP A;  3UAR A;  2VL2 C;  2C0E A;  1AQV A;  4KB3 A;  3NIV A;  2H66 A;  2PGT A;  1XOA A;  2LRC A;  2K9F A;  4KDY A;  2E7P A;  3LWA A;  3TKQ A;  1FAA A;  4JRR A;  4XCS A;  1W89 A;  3DML A;  1GSY A;  2FNO A;  1CQG A;  4I8B A;  4G2E A;  4TW5 A;  5AIV A;  1XCC A;  3H1N A;  1EP7 A;  2G2Q A;  4KND A;  2H0G A;  2YAN A;  3EIN A;  1MTC A;  2YP6 A;  5B8A A;  2LQQ A;  3HY2 A;  4K7I A;  4ZB8 A;  1YKC A;  2H71 A;  2BTO T;  4CW9 A;  1PSQ A;  1FO5 A;  1OVN A;  3MAK A;  3Q6O A;  2P5R A;  1SYX A;  3TRQ A;  2AUV A;  3Q19 A;  3QAG A;  6GSX A;  2GQK A;  2HLS A;  1A2L A;  3LXZ A;  2X64 A;  1EOH A;  1TU7 A;  3EWL A;  2H6X A;  1DSB A;  1K0M A;  2VOC A;  4I2T A;  1K3O A;  2C0D A;  4K7N A;  4L0W A;  1LU4 A;  2GZZ A;  1M2D A;  3HJO A;  2O87 A;  1TOF A;  4ECC A;  5G31 A;  3H8Q A;  3RPN A;  1ST9 A;  2B5Y A;  3GHA A;  3IA1 A;  5C00 A;  2VCQ A;  1Z3E A;  3ZTL A;  3UBL A;  2PUK C;  3HCZ A;  4XRA A;  3N5O A;  2AJQ B;  2V2G A;  3I69 A;  1OC9 A;  2WCI A;  4WR5 A;  3LFL A;  4TR0 A;  3CRT A;  5ECR B;  1F2E A;  4KA0 A;  3UJ1 A;  2HZE A;  1KNG A;  1J9B A;  3VLN A;  4MJB A;  1KBN A;  2B6M A;  1SJZ A;  5DAK A;  2VLV A;  5LNK e;  1VF1 A;  2IN3 A;  4RQR A;  3IDV A;  1N8J A;  1F37 A;  4MMM A;  4YQU A;  3LJR A;  2H0H A;  4NPB A;  4NV2 A;  2NPB A;  5ENU A;  4RQX A;  3EE2 A;  5D9W A;  3GN3 A;  2MYG A;  2YV9 A;  1K0O A;  4IGJ A;  3FZA A;  4O5R A;  5CRH A;  1NHY A;  4MK3 A;  1EEM A;  3PH9 A;  1MEK A;  4GCI A;  3G7Y A;  3IV4 A;  3HYP A;  1NW2 A;  1YQ1 A;  3IK7 A;  1AQX A;  1FW1 A;  2RLI A;  2F8F A;  5KN2 A;  3KCM A;  8GSS A;  1FVK A;  16GS A;  1K0N A;  1T00 A;  2IME A;  2TIR A;  3GIX A;  1K0A A;  2YWN A;  1EP8 A;  2F3M A;  1M2A A;  1K3L A;  4DSS B;  3FW2 A;  3P2A A;  1OC3 A;  3J7Y k;  3UBK A;  5ECM B;  5ECP B;  2GQL A;  4XS6 A;  6GSY A;  1X9S B;  2B3S A;  2VL2 A;  1ERV A;  2OJL A;  3APO A;  1FG4 A;  1FHE A;  5D96 A;  2VM1 A;  3U6V A;  1GUH A;  1V58 A;  1U87 A;  1SD8 A;  2JU5 A;  2KOK A;  4OO5 A;  5E4W A;  5IPH A;  2Z9S A;  5FT3 A;  4WXT A;  2B1K A;  1GP1 A;  2H75 A;  2BJX A;  1R26 A;  5DJM A;  3UEM A;  1YJ6 A;  2L5O A;  1OC8 A;  2EIO A;  3CRU A;  3M8N A;  5EVO A;  5ECK B;  1WWJ A;  5ECH B;  19GS A;  4NHZ A;  1PX7 A;  2REM A;  1XPV A;  2E0Q A;  4G9H A;  2D2Z A;  2IJY A;  1HYU A;  2WUL A;  3IBH A;  4XTS A;  4KX4 A;  3HJM A;  4AJ7 A;  3CSI A;  1A0F A;  1WOU A;  2JZS A;  1G7E A;  4Q5F A;  4D73 B;  3VFI A;  1HD2 A;  2DJK A;  5J9B A;  4MF5 A;  5A5K A;  2LQO A;  1GNE A;  3EC3 A;  3O76 A;  3VK9 A;  5H5R A;  4ZIJ A;  2VM2 A;  2DIY A;  3VWW A;  2VAF A;  2FA4 A;  3GKM A;  3KJY A;  4HDE A;  1B4Q A;  2N5F A;  2LRN A;  2FD3 A;  5J4U A;  1JLW A;  4JE1 A;  1TRS A;  3CTG A;  2EC4 A;  2K8V A;  2ZUP A;  4O92 A;  1XIY A;  4MA9 A;  1JHB A;  1JZO A;  4FYB A;  3KGK A;  4F0B A;  4HI7 A;  1ZL9 A;  4MF6 A;  1TI3 A;  3WGD A;  1F9M A;  2NDO A;  1A2J A;  4LA1 A;  5ID2 B;  2LJA A;  2LNS A;  4GLT A;  4EXJ A;  4DSS A;  3DVW A;  3IRA A;  1EWX A;  1XW5 A;  2IFQ B;  3DVX A;  1QGV A;  1DE1 A;  3UOM A;  5G5E A;  1T4Y A;  4E8E A;  4I2U A;  1B9X C;  2AAW A;  4TVE A;  2R6K A;  4MJC A;  5GAN D;  3D4M A;  1ZGN A;  4XS4 B;  3TOT A;  5EY6 A;  5GAP D;  2MZC A;  1O6J A;  5INY A;  5IPG A;  1TK0 B;  3BCK A;  2O7K A;  3G7I A;  3TKR A;  3KTB A;  2VIM A;  1VRS D;  5GSS A;  1WMJ A;  2PN8 A;  3RHC A;  1EEJ A;  5HR1 A;  3HVS A;  2CVB A;  4N0V A;  4GQF A;  3A5W A;  20GS A;  3E3E A;  3ZVJ D;  4KCA A;  3TUE A;  3GKN A;  3TKS E;  1F3A A;  4JU5 A;  2YWM A;  2B5X A;  1XWA A;  3QMX A;  1U6T A;  3G9B A;  5H5Q A;  4BPY A;  1BX9 A;  3MNG A;  3L0H A;  2CX4 A;  4IQ1 A;  2DC5 A;  4D73 A;  2KP2 A;  3HKR A;  1GLP A;  2IIY A;  3PGT A;  2VCX A;  4FIW A;  3HHV A;  4FO5 A;  1A2M A;  2OKA A;  3HD5 A;  1OE8 A;  2O85 A;  4Q5R A;  2V41 A;  5J3R A;  1AQW A;  5IMZ A;  4O7H A;  1EV9 A;  2OBK A;  3CSH A;  2P0G A;  4LLR A;  1GNW A;  1GUK A;  4OFM A;  4KSM A;  4IBP A;  3ME8 A;  2YN1 A;  1YEP A;  1GTI A;  2F8A A;  2QSI A;  2FWF A;  4WBJ A;  5EPF A;  1Q98 A;  5ELG A;  4V2N A;  4TR1 B;  3FHK A;  3F3Q A;  5ID2 A;  1XZO A;  4PNG A;  1O85 A;  4ID0 A;  4PXO A;  3BD2 A;  2GZY A;  1GL8 A;  2K18 A;  3SWL A;  3HZ8 A;  1ZYE A;  2IFQ A;  5JCW A;  5F8B A;  1X0R A;  1F3B A;  4IW9 A;  1MDK A;  3NZN A;  4Z7X A;  1ERU A;  4NMU A;  4ZB6 A;  2H30 A;  2MMO A;  2BMX A;  1XWK A;  1NM3 A;  4MP4 A;  4KAE A;  2GTU A;  4XS4 A;  4KE3 A;  1DUG A;  1RQM A;  2H74 A;  3H4K A;  3ZZX A;  3HXS A;  2PVQ A;  4K8M A;  2GSQ A;  4KUN A;  4IJ3 A;  1A8Y A;  2L6D A;  4TKY A;  1BAY A;  1SK0 A;  5ABR A;  3M9J A;  3ERG A;  3GX0 A;  2FA8 A;  3LSZ A;  1NSW A;  5G1L A;  3IPZ A;  2HI7 A;  3A2X A;  1TI1 A;  2VL3 A;  4TXV A;  4XS1 A;  4YAV A;  1OAZ A;  1Z7R A;  1OE7 A;  2NTO A;  3C7M A;  1LBK A;  4J56 E;  3TB2 A;  1TXX A;  4LL1 B;  2YJ7 A;  3DYR A;  4J57 E;  5G2Z A;  1UC7 A;  6GSU A;  3TJJ A;  1YKA A;  3C1R A; 
#chains in the Genus database with same CATH topology
 3LG6 A;  3W8J A;  5IMA A;  2RII A;  2OA7 A;  2FLS A;  5D8I A;  4GF0 A;  2I81 A;  1GTB A;  2H72 A;  3GYK A;  3CMI A;  2WDU A;  3KP9 A;  2R3X A;  2I4A A;  2ZNM A;  1SU9 A;  1T1V A;  5CRD A;  4GWR A;  5J41 A;  1U88 A;  3V1W A;  2XBQ A;  4WR4 A;  5D9T A;  1ZYP A;  4I97 A;  1A0R P;  2UZ8 A;  3A3T A;  1TU8 A;  3L9V A;  5F05 A;  3GL5 A;  2A2R A;  4V1A g;  5IO0 A;  3QD9 A;  5BMU A;  1EGO A;  2R0P A;  1FOH A;  5JCG A;  2LNT A;  3GH9 A;  4HOJ A;  5IMC A;  3QFA C;  4NHW A;  4TR1 A;  2MBS A;  3ISO A;  1YZX A;  2HT9 A;  1AUC A;  4Z2T A;  4CHS A;  2GS3 A;  3QCP A;  2DJJ A;  1VF4 A;  2FCH A;  2K8S A;  4EVM A;  1J0F A;  3EU3 A;  5KOW A;  1TW9 A;  2XC2 A;  1GSF A;  3FMW A;  4PTS A;  4XHM A;  4QQ7 A;  4JZQ A;  2B1L A;  1BED A;  4YH2 A;  2FHE A;  3AY8 A;  4RI7 A;  4KDU A;  3CYN A;  3F6F A;  2P5Q A;  1I9D A;  3DGQ A;  4F0C A;  2J9H A;  4Q5Q A;  1G6Y A;  4EDZ A;  2DJ1 A;  4Z2R A;  4JR6 A;  3WD6 A;  1QK8 A;  1S3C A;  2DBC A;  1UN2 A;  5B7C A;  4HQZ A;  2AB6 A;  1WRY A;  4X1U A;  3VUR A;  4K9Z A;  2CVD A;  4L5L A;  1SKS B;  5J9C A;  1PMT A;  2ON7 A;  1B4P A;  1GWC A;  2JL4 A;  4BWS A;  2CX3 A;  2AYT A;  5FWG A;  2YCD A;  3ZVJ A;  1SKR B;  1ZCP A;  2PVO C;  4K2X A;  2H1G A;  3TGZ A;  1XFL A;  4E8H A;  1XWG A;  1PA3 A;  1TTZ A;  3C8E A;  3PIN A;  2HXK A;  3N9J A;  1SL1 B;  1YF0 A;  3KZQ A;  3GRX A;  4ECB A;  1JZW A;  1M7T A;  2H1B A;  1SEN A;  4DVC A;  4ZBA A;  1UA5 A;  2GGT A;  3D21 A;  2HZF A;  4EE0 A;  3UIW A;  3TJB A;  3BBY A;  5L71 A;  3TKP A;  2X4A A;  2GT6 A;  1PKZ A;  2KLX A;  3UVT A;  1TRW A;  1FB0 A;  2GVP A;  1JZD A;  2HSM A;  5IIZ A;  1U3A A;  2GLR A;  4POL A;  4V1A p;  3A2W A;  4V2L A;  4F9Z A;  1JZR A;  1QMV A;  5IOX A;  3FZ9 A;  4ZXG A;  4G10 A;  4ZB9 A;  3F4S A;  2O89 A;  5KEJ A;  2B5E A;  3IHG A;  3WT2 A;  1SK2 A;  4BVY A;  4N11 A;  3M1G A;  4Z2U A;  3GMF A;  1S3A A;  4I5Q A;  4PQI A;  5ECI B;  4EKZ A;  4P3Y B;  4K6X A;  3VI5 A;  3L4N A;  1A23 A;  1V9W A;  4HJ2 A;  5LD0 A;  2DML A;  3D6I A;  3TKS C;  2WGR A;  2H76 A;  3FEU A;  3G7J A;  6GSV A;  1S3D A;  2IMF A;  3C1S A;  1T4Z A;  3ZIV A;  3HVV A;  4MZW A;  3ZIT A;  2H0I A;  3EVI A;  1G0T A;  4ZL9 A;  2WZ9 A;  1XBS A;  2TRC P;  4IS0 A;  4NWY A;  1HNC A;  5IO2 A;  5DAL B;  4ZL7 A;  3I6A A;  1FVJ A;  2FWG A;  3LQ7 A;  3LGC A;  2HFD A;  1K0B A;  1PL1 A;  1PN9 A;  1QUW A;  3ZMK A;  3F3R A;  3RBT A;  4MJA A;  3ZFB A;  3R3E A;  4IJI A;  5D9V A;  2NBS A;  1AXD A;  4FQU A;  5JWR B;  3WYW A;  3LOR A;  3QPM A;  4MH2 A;  2FGX A;  1ABA A;  2R5G A;  4DEJ A;  1Z7P A;  1PFO A;  3BCI A;  4FH8 A;  4GSN A;  1SJ6 A;  2JSZ A;  3IAS 2;  2A2S A;  3KIJ A;  2DMM A;  4YQV A;  5F0G A;  17GS A;  5JWQ B;  4H86 A;  2YWI A;  1T8E B;  2LV3 A;  3E0U A;  4GRF A;  2GQM A;  1X5C A;  3EPT A;  2PMT A;  5DCG A;  2IMD A;  4WEY A;  2QKE A;  2OE1 A;  1Z9H A;  5HQP A;  3ZIJ A;  4EC0 A;  3I9V 2;  5JWO B;  5G30 A;  3GSS A;  1GSS A;  1R5A A;  2L59 A;  1XVQ A;  6GSS A;  3C73 A;  3ERW A;  1VGL A;  4EUY A;  3MYD A;  2KUC A;  1DE2 A;  5FHI A;  1DBY A;  5B6N A;  1ML6 A;  3CSJ A;  4ZBB A;  4GSS A;  1EOG A;  2VCT A;  1GSU A;  5DDL A;  2R37 A;  3TDG A;  4OFT A;  1B8X A;  1Q4J A;  4TR3 A;  4AJ6 A;  4V2M A;  2A2P A;  1O8W A;  2HNL A;  1H4O A;  1IYI A;  3IHQ A;  1IYH A;  2XPE A;  4K7O A;  4YQM A;  2OE0 A;  12GS A;  2RM6 A;  4POK A;  5A4V A;  3PPU A;  1TDI A;  3DD3 A;  3GL3 A;  2L4C A;  5CAX A;  1XVW A;  3K8N A;  3IOS A;  5A4U A;  3GTU A;  3IK9 A;  3DRN A;  1KTE A;  2M46 A;  3APQ A;  1HNA A;  1ZYN A;  2WFC A;  3UMA A;  1TKD B;  4CDO A;  2NVL A;  3EYT A;  3KH7 A;  3ZL5 A;  3S9F A;  5DAL A;  5GZZ B;  3H79 A;  4BL7 B;  2CAI A;  1XWB A;  2OE3 A;  2QA2 A;  5CO3 A;  5LCZ A;  5A4W A;  3F4R A;  3MIX A;  5F07 A;  1HNB A;  4ZIL A;  1A8L A;  4GST A;  4PQ1 A;  3DIE A;  2IPA A;  3D0Z A;  3GFK A;  2JAC A;  3GA4 A;  3GUR A;  4KCE A;  5IM9 A;  2DLX A;  2WS2 A;  5EL8 A;  2YPM A;  1V57 A;  1MD4 A;  2N5B A;  2JZR A;  1GH2 A;  2HRN A;  1M9B A;  2DJ0 A;  1ON4 A;  4LMV A;  4TOP A;  2X8G A;  1NHO A;  5DQY A;  2L5L A;  1GLQ A;  3TKS A;  2RM5 A;  1OYJ A;  4K2D A;  3L9U A;  22GS A;  2VLU A;  1U3I A;  3ZRE A;  1SKW B;  3JCM L;  1PKW A;  2E2M A;  4GXZ A;  4MZC A;  10GS A;  1FOV A;  2DJ3 A;  4EF0 A;  2KHP A;  3ED3 A;  5D9X A;  4OWY A;  3VWV A;  4TXO B;  2C8U A;  5C04 A;  3ZRD A;  1V98 A;  4GTU A;  4IHU A;  1C72 A;  2CZ2 A;  4MH3 A;  1R5P A;  2E2G A;  5AN1 A;  2H19 A;  5ECL B;  4XRD A;  3QOU A;  2JZT A;  9GSS A;  4F82 A;  3FKF A;  4HZ4 A;  1XG8 A;  2R4V A;  3Q74 A;  4ISD A;  1KEB A;  1M99 A;  2H01 A;  4IKH A;  3GUS A;  2O8V B;  2OAC A;  3F0I A;  1PL2 A;  3I43 A;  3P90 A;  1PGT A;  4MZB A;  2HRK A;  3DKS A;  2HRF A;  1A24 A;  4MF7 A;  3CTF A;  1BG5 A;  4N30 A;  2FWE A;  3D4T A;  4L8E A;  2IWT A;  2AV4 A;  1XW9 A;  4PGT A;  2RUE A;  5HR0 A;  4PQH A;  2M72 A;  4L5O A;  2LRT A;  3GNJ A;  3KXO A;  4POB A;  5CP1 A;  7GSS A;  3KD0 A;  4F2I A;  2CA8 A;  4BL7 A;  11GS A;  4G19 A;  2QA1 A;  5G1K A;  5AGY A;  2PWJ A;  3ERF A;  4EIQ A;  3HJP A;  1O7U A;  2VL9 A;  3KTL A;  4OCE A;  2WB9 A;  4HUA A;  1BYE A;  4USS A;  1G6W A;  4HU9 A;  2DKH A;  2PU9 C;  3GH6 A;  3RDW A;  1GSQ A;  3WGE A;  3KMN A;  2C3T A;  3TOU A;  3RHB A;  1YY7 A;  4CY6 A;  5COH A;  4ML1 A;  4KSO A;  1ERW A;  2H73 A;  2VUP A;  3GKK A;  4J2F A;  1AW9 A;  5JCU A;  4MCU A;  1Z6N A;  1WPI A;  4ZL8 A;  1F6M C;  3H93 A;  4AGS A;  2H70 A;  1GUM A;  1ACV A;  1W4V A;  4JBB A;  4BVY B;  3W6G A;  1XW6 A;  5IMV A;  5CRE A;  1TP9 A;  1SJI A;  1N2A A;  1EGR A;  1ZOF A;  5ECN B;  3O3T A;  1K3Y A;  4PNF A;  4TXO A;  5HFI A;  2X8H A;  1GRX A;  1I5G A;  2X8C A;  3LXT A;  2DSA A;  1BQ7 A;  2H6Z A;  3IC4 A;  2J23 A;  3F63 A;  4RI6 A;  4WF4 A;  3KEB A;  1YDK A;  2YZU A;  3EMP A;  2CAQ A;  3HA9 A;  1SL0 B;  13GS A;  1QFN A;  3F4T A;  4WKW A;  2GSS A;  3P7X A;  3US3 A;  2A4V A;  2DIZ A;  5CYY A;  5J5N A;  1LJR A;  2I1U A;  2TRX A;  3PR8 A;  3ZML A;  2VLT A;  4K0N A;  5E59 A;  1PD2 1;  4IVF A;  2GSR A;  3RAZ A;  2CT6 A;  2MBT A;  1OKT A;  2H6Y A;  5F06 A;  2PPT A;  2HSY A;  4MPG A;  2A4H A;  3IXR A;  2C0F A;  3CQF A;  1RW1 A;  1Z5Y E;  3VPQ A;  2ZCT A;  1QQ2 A;  2IMI A;  4L0U A;  5HFG A;  4G0K A;  2YOI A;  3BJ5 A;  2CQ9 A;  3FR3 A;  3FK8 A;  4OFN A;  2I9H A;  2IL3 A;  2V6O A;  2R2J A;  5GST A;  1O8X A;  2YV7 A;  3LYK A;  1M2B A;  4ILF A;  3FR9 A;  3TJG A;  2L6C A;  1Z6M A;  4TR4 A;  4ML6 A;  3F6D A;  3D22 A;  2GDR A;  3CBU A;  2C3N A;  1GUL A;  1UVZ A;  2OAD A;  5AIS A;  1V2A A;  2H1D A;  2VCV A;  2LJK A;  2LUS A;  3KH9 A;  4KH7 A;  4NV5 A;  4ICY A;  3M0F A;  1HQO A;  4JR4 A;  6GST A;  4YAP A;  1J08 A;  1G7O A;  5ELA A;  3M9K A;  2B7K A;  3ME7 A;  4OCF A;  2C4J A;  3WT1 A;  1B9Y C;  2XHF A;  5DBQ A;  4ZBD A;  2V32 A;  3TCO A;  3UAP A;  4OD7 A;  14GS A;  3TRX A;  1SD9 A;  3FY7 A;  2EIQ A;  4NAX A;  4DSQ A;  4TN8 A;  4X43 A;  1PX6 A;  2CV4 A;  4MJE A;  2X49 A;  2JAD A;  2C80 A;  5H5S A;  5DJL A;  4AF2 A;  4GQC A;  1T7P B;  2F51 A;  2FY6 A;  3DWV A;  4PUF C;  1URM A;  1WP0 A;  4MAB A;  18GS A;  3KP8 A;  4KDX A;  5G5F A;  3MWH A;  3GTU B;  1BJX A;  2N5A A;  2L57 A;  2LS5 A;  4X4J A;  2KP1 A;  1AC1 A;  4G0L A;  1T3B A;  1TK5 B;  1XOB A;  2YNX A;  4ULX A;  5CRG A;  1TRV A;  2X99 A;  1SYR A;  5D93 A;  1O81 A;  3IAM 2;  1JFU A;  3SBC A;  3FYG A;  1X9M B;  4PUR A;  1JLV A;  4OMV A;  3F9U A;  3DEX A;  3A2V A;  4WF5 A;  1Y6E A;  4PUA A;  1TJD A;  2XPD A;  6GSW A;  1SL2 B;  1SK1 A;  2LTK A;  1EZK A;  2GZP A;  4FYU A;  2M80 A;  1CQH A;  1TRU A;  5DVB A;  4IN0 A;  2LKU A;  2WJU A;  1ERT A;  4ECI A;  1VF3 A;  2C3Q A;  1PQN A;  1XWC A;  2OBI A;  3GX8 A;  1O73 A;  5B6M A;  3F8U A;  1X5D A;  3FZ5 A;  4PX1 A;  1WE0 A;  1E6B A;  1TK8 B;  4HU7 A;  5CRW A;  3VI7 A;  4LL4 B;  2HYX A;  1Y25 A;  3MSZ A;  4QL9 A;  4AJ8 A;  4CY8 A;  2GST A;  1X5E A;  4IP6 A;  1R4W A;  4X0X A;  5D73 A;  2H8L A;  1H75 A;  1XXU A;  4N10 A;  3W8S A;  4KW6 A;  4KF9 A;  4K0G A;  5HR2 A;  2VCZ A;  1YEX A;  2ON5 A;  2VD0 A;  4A5P A;  4EIP A;  3O6T A;  2ALB A;  3NOF A;  1MDJ A;  3Q18 A;  5DCH A;  1GSE A;  1K0C A;  3E9J B;  3TJF A;  4DSR A;  3ZYW A;  1ZZY A;  5DQS A;  3UVH A;  3VWU A;  4JED A;  2IMK A;  3OR5 A;  5KN1 A;  2VO4 A;  2FUG 2;  3GKX A;  1M0U A;  2WRT A;  1R7H A;  5IMF A;  4NXI A;  4HQS A;  3ZLP A;  3QR6 A;  5ECS A;  2B7J A;  2QC7 A;  2HE3 A;  1ZYQ B;  5HFK A;  1YF1 A;  2HSH A;  4XIH A;  5KN3 A;  3LYP A;  1X9W B;  3LEF A;  4IQA A;  2EIR A;  3IR4 A;  2PBJ A;  4Q5N A;  3HDC A;  1ILO A;  4N0Z A;  1E2Y A;  3KMO A;  4I6X A;  1WJK A;  4POM A;  4BWQ A;  3VWX A;  2LJR A;  4K1F A;  3ZFL A;  3UL3 A;  5ECQ B;  2AHE A;  2G0F A;  3GST A;  2CZ3 A;  4HJM A;  3FRC A;  1AAZ A;  4KGI A;  4EL1 A;  1PRX A;  4MDC A;  3GV1 A;  1QXH A;  3D5J A;  3WGX A;  5AIX A;  4MPF A;  1GTA A;  2DKI A;  2GT5 A;  4F03 A;  1VF2 A;  3EUR A;  4O32 A;  3MDK A;  5IOW A;  5IMD A;  2K6V A;  1GSD A;  2FWH A;  5HR3 A;  3QDN A;  4FYC A;  3FR6 A;  3QFB C;  4QL7 A;  3RPP A;  4OO4 A;  4WBR D;  3J7Y b;  5CNW A;  3R2Q A;  2LEG A;  2V1M A;  1MD3 A;  4ACS A;  4IP1 A;  1B48 A;  1V40 A;  3VPT A;  4BA7 A;  4TRX A;  1WIK A;  3L78 A;  4O5Q A;  2C1Y A;  4BVX A;  1THX A;  1M3J A;  5B8B A;  5KN0 A;  2DJ2 A;  2QGV A;  4IEL A;  3HVN A;  4HEA 2;  3HVX A;  1ZMA A;  3QAV A;  3IE3 A;  2L4Q A;  1USB A;  5IQY A;  4LMW A;  3TJK A;  3KM6 A;  4ECJ A;  1THO A;  3APS A;  4EDY A;  3BOA A;  2I3Y A;  2YWO A;  4K5R A;  2PER A;  4MLY A;  3M3M A;  3FZ4 A;  2JSY A;  2CVK A;  2VD1 A;  3EU4 A;  1AIU A;  5ECO B;  3P8W A;  5BRT A;  2MMZ A;  1OC9 B;  4RUV A;  3IC8 A;  2VCW A;  4HS1 A;  1EV4 A;  1MDI A;  2XBI A;  4HZ2 A;  2HZE B;  2YZH A;  4EO3 A;  2ES7 A;  3EMX A;  1GTU A;  1K0D A;  2C0G A;  3CXG A;  1OKD A;  2P31 A;  3C71 A;  2MMA A;  5DAK B;  3L9S A;  3DXB A;  4WET A;  2LST A;  1RK4 A;  1FB6 A;  2RUF A;  3HZ4 A;  2MMN A;  3QAW A;  1M9A A;  2H1A A;  3U5R E;  2F9S A;  2V6K A;  2YJH A;  2HRA A;  3TRP A;  3UAR A;  2VL2 C;  2C0E A;  1AQV A;  4KB3 A;  3NIV A;  2H66 A;  2PGT A;  1XOA A;  2LRC A;  2K9F A;  2R0G A;  4KDY A;  2E7P A;  3LWA A;  3TKQ A;  1FAA A;  4JRR A;  4O5U A;  4XCS A;  1W89 A;  3DML A;  1GSY A;  1PN0 A;  2FNO A;  1CQG A;  4I8B A;  4G2E A;  4TW5 A;  5AIV A;  1XCC A;  3H1N A;  1EP7 A;  2G2Q A;  4KND A;  2H0G A;  2YAN A;  3EIN A;  1MTC A;  2YP6 A;  3A5I A;  5B8A A;  2LQQ A;  3HY2 A;  4K7I A;  4ZB8 A;  1YKC A;  2H71 A;  2BTO T;  4CW9 A;  1PSQ A;  1FO5 A;  1OVN A;  3MAK A;  3Q6O A;  2P5R A;  1SYX A;  3TRQ A;  2AUV A;  3Q19 A;  3QAG A;  6GSX A;  2GQK A;  2HLS A;  1A2L A;  3LXZ A;  2X64 A;  1EOH A;  1TU7 A;  3EWL A;  2H6X A;  1DSB A;  1K0M A;  2VOC A;  4BIK A;  4K5S A;  4I2T A;  1K3O A;  2C0D A;  4K7N A;  4L0W A;  1LU4 A;  2GZZ A;  1M2D A;  3HJO A;  2O87 A;  1TOF A;  4ECC A;  5G31 A;  3H8Q A;  3RPN A;  1ST9 A;  2B5Y A;  3GHA A;  3IA1 A;  5C00 A;  2VCQ A;  1Z3E A;  3ZTL A;  3UBL A;  2PUK C;  3HCZ A;  4XRA A;  3N5O A;  2AJQ B;  2V2G A;  3I69 A;  1OC9 A;  2WCI A;  4WR5 A;  3LFL A;  4TR0 A;  3CRT A;  5ECR B;  1F2E A;  4KA0 A;  3UJ1 A;  2HZE A;  1KNG A;  1J9B A;  3VLN A;  4MJB A;  1KBN A;  2B6M A;  1SJZ A;  5DAK A;  2VLV A;  5LNK e;  1VF1 A;  2IN3 A;  4RQR A;  3IDV A;  1N8J A;  1F37 A;  4MMM A;  4YQU A;  3LJR A;  2H0H A;  4NPB A;  4NV2 A;  2NPB A;  5ENU A;  4RQX A;  3EE2 A;  5D9W A;  3GN3 A;  2MYG A;  2YV9 A;  1K0O A;  4IGJ A;  3FZA A;  4O5R A;  5CRH A;  1NHY A;  4MK3 A;  1EEM A;  3PH9 A;  1MEK A;  4GCI A;  3G7Y A;  3IV4 A;  3HYP A;  1NW2 A;  1YQ1 A;  3IK7 A;  1AQX A;  1FW1 A;  2RLI A;  2F8F A;  5KN2 A;  3KCM A;  8GSS A;  1FVK A;  16GS A;  1K0N A;  1T00 A;  2IME A;  2TIR A;  3GIX A;  4MNN A;  1K0A A;  2YWN A;  1EP8 A;  2F3M A;  1M2A A;  1K3L A;  5KOX A;  4DSS B;  3FW2 A;  3P2A A;  1OC3 A;  3J7Y k;  3UBK A;  5ECM B;  5ECP B;  2GQL A;  4XS6 A;  6GSY A;  1X9S B;  2B3S A;  2VL2 A;  1ERV A;  2OJL A;  3APO A;  1FG4 A;  1FHE A;  5D96 A;  2VM1 A;  3U6V A;  1GUH A;  3LW9 A;  1V58 A;  1U87 A;  1SD8 A;  2JU5 A;  2KOK A;  4OO5 A;  5E4W A;  5IPH A;  2Z9S A;  5FT3 A;  4WXT A;  2B1K A;  1GP1 A;  2H75 A;  2BJX A;  1R26 A;  4YKF A;  5DJM A;  3UEM A;  1YJ6 A;  2L5O A;  1OC8 A;  2EIO A;  3CRU A;  3M8N A;  5EVO A;  5ECK B;  1WWJ A;  5ECH B;  19GS A;  4NHZ A;  1PX7 A;  2REM A;  1XPV A;  2E0Q A;  4G9H A;  2D2Z A;  2IJY A;  1HYU A;  2WUL A;  3IBH A;  4XTS A;  4KX4 A;  3HJM A;  4AJ7 A;  3CSI A;  1A0F A;  1WOU A;  4HSC X;  2JZS A;  1G7E A;  4Q5F A;  4BVX B;  4D73 B;  3VFI A;  1HD2 A;  2DJK A;  5J9B A;  4MF5 A;  5A5K A;  2LQO A;  1GNE A;  3EC3 A;  3O76 A;  3VK9 A;  5H5R A;  4ZIJ A;  2VM2 A;  2DIY A;  3VWW A;  2VAF A;  2FA4 A;  2R0C A;  3GKM A;  3KJY A;  4HDE A;  1B4Q A;  2N5F A;  2LRN A;  2FD3 A;  5J4U A;  1JLW A;  4JE1 A;  1TRS A;  3CTG A;  2EC4 A;  2K8V A;  2ZUP A;  4O92 A;  1XIY A;  4MA9 A;  1JHB A;  1JZO A;  4FYB A;  3KGK A;  4F0B A;  4HI7 A;  1ZL9 A;  4MF6 A;  1TI3 A;  3WGD A;  1F9M A;  2NDO A;  1A2J A;  4LA1 A;  5ID2 B;  2LJA A;  2LNS A;  4GLT A;  4EXJ A;  4DSS A;  3DVW A;  3IRA A;  1EWX A;  1XW5 A;  2IFQ B;  3DVX A;  1QGV A;  1DE1 A;  3UOM A;  4YKG A;  5G5E A;  1T4Y A;  1S3R A;  4E8E A;  4I2U A;  1B9X C;  2AAW A;  4TVE A;  2R6K A;  4MJC A;  5GAN D;  3D4M A;  1ZGN A;  4XS4 B;  3TOT A;  5EY6 A;  5GAP D;  2MZC A;  1O6J A;  5INY A;  5IPG A;  1TK0 B;  3BCK A;  2O7K A;  3G7I A;  3TKR A;  3KTB A;  2VIM A;  1VRS D;  5GSS A;  1WMJ A;  2PN8 A;  3RHC A;  1EEJ A;  5HR1 A;  3HVS A;  2CVB A;  4N0V A;  4GQF A;  3A5W A;  20GS A;  3E3E A;  3ZVJ D;  4KCA A;  3TUE A;  3GKN A;  3TKS E;  1F3A A;  4JU5 A;  2YWM A;  2B5X A;  1XWA A;  3QMX A;  1U6T A;  3G9B A;  5H5Q A;  4BPY A;  1BX9 A;  3MNG A;  3L0H A;  2CX4 A;  4IQ1 A;  2DC5 A;  4D73 A;  2KP2 A;  3HKR A;  1GLP A;  2IIY A;  3PGT A;  2VCX A;  4FIW A;  3HHV A;  4FO5 A;  1A2M A;  2OKA A;  3HD5 A;  1OE8 A;  2O85 A;  4Q5R A;  2V41 A;  5J3R A;  1AQW A;  5IMZ A;  4O7H A;  1EV9 A;  2OBK A;  1M3I A;  3CSH A;  2P0G A;  4LLR A;  1GNW A;  1GUK A;  4OFM A;  4KSM A;  4IBP A;  3ME8 A;  2YN1 A;  1YEP A;  1GTI A;  2F8A A;  2QSI A;  2FWF A;  4WBJ A;  5EPF A;  1Q98 A;  5ELG A;  4V2N A;  4TR1 B;  3FHK A;  3F3Q A;  5ID2 A;  1XZO A;  4PNG A;  1O85 A;  4ID0 A;  4PXO A;  3BD2 A;  2GZY A;  1GL8 A;  2K18 A;  3SWL A;  3HZ8 A;  1ZYE A;  2IFQ A;  5JCW A;  5F8B A;  1X0R A;  1F3B A;  4IW9 A;  1MDK A;  3NZN A;  4Z7X A;  1ERU A;  4NMU A;  4ZB6 A;  2H30 A;  2MMO A;  2BMX A;  1XWK A;  1NM3 A;  4MP4 A;  4KAE A;  2GTU A;  4XS4 A;  4KE3 A;  1DUG A;  1RQM A;  2H74 A;  3H4K A;  3ZZX A;  3HXS A;  2PVQ A;  4K8M A;  2GSQ A;  4KUN A;  4IJ3 A;  1A8Y A;  2L6D A;  4TKY A;  1BAY A;  1SK0 A;  5ABR A;  3M9J A;  3ERG A;  3GX0 A;  2FA8 A;  3LSZ A;  1NSW A;  5G1L A;  3IPZ A;  2HI7 A;  3A2X A;  1TI1 A;  2VL3 A;  4TXV A;  4XS1 A;  4YAV A;  1OAZ A;  1Z7R A;  1OE7 A;  2NTO A;  3C7M A;  1LBK A;  4J56 E;  3TB2 A;  1TXX A;  4LL1 B;  2YJ7 A;  3DYR A;  4J57 E;  5G2Z A;  1UC7 A;  4G0I A;  6GSU A;  3TJJ A;  1YKA A;  3C1R A; 
#chains in the Genus database with same CATH homology
 3LG6 A;  3W8J A;  5IMA A;  2RII A;  2OA7 A;  2FLS A;  5D8I A;  4GF0 A;  2I81 A;  1GTB A;  2H72 A;  3GYK A;  3CMI A;  2WDU A;  3KP9 A;  2R3X A;  2I4A A;  2ZNM A;  1SU9 A;  1T1V A;  5CRD A;  4GWR A;  5J41 A;  1U88 A;  3V1W A;  2XBQ A;  4WR4 A;  5D9T A;  1ZYP A;  4I97 A;  1A0R P;  2UZ8 A;  3A3T A;  1TU8 A;  3L9V A;  5F05 A;  3GL5 A;  2A2R A;  4V1A g;  5IO0 A;  3QD9 A;  5BMU A;  1EGO A;  2R0P A;  1FOH A;  5JCG A;  2LNT A;  3GH9 A;  4HOJ A;  5IMC A;  3QFA C;  4NHW A;  4TR1 A;  2MBS A;  3ISO A;  1YZX A;  2HT9 A;  1AUC A;  4Z2T A;  4CHS A;  2GS3 A;  3QCP A;  2DJJ A;  1VF4 A;  2FCH A;  2K8S A;  4EVM A;  1J0F A;  3EU3 A;  5KOW A;  1TW9 A;  2XC2 A;  1GSF A;  3FMW A;  4PTS A;  4XHM A;  4QQ7 A;  4JZQ A;  2B1L A;  1BED A;  4YH2 A;  2FHE A;  3AY8 A;  4RI7 A;  4KDU A;  3CYN A;  3F6F A;  2P5Q A;  1I9D A;  3DGQ A;  4F0C A;  2J9H A;  4Q5Q A;  1G6Y A;  4EDZ A;  2DJ1 A;  4Z2R A;  4JR6 A;  3WD6 A;  1QK8 A;  1S3C A;  2DBC A;  1UN2 A;  5B7C A;  4HQZ A;  2AB6 A;  1WRY A;  4X1U A;  3VUR A;  4K9Z A;  2CVD A;  4L5L A;  1SKS B;  5J9C A;  1PMT A;  2ON7 A;  1B4P A;  1GWC A;  2JL4 A;  4BWS A;  2CX3 A;  2AYT A;  5FWG A;  2YCD A;  3ZVJ A;  1SKR B;  1ZCP A;  2PVO C;  4K2X A;  2H1G A;  3TGZ A;  1XFL A;  4E8H A;  1XWG A;  1PA3 A;  1TTZ A;  3C8E A;  3PIN A;  2HXK A;  3N9J A;  1SL1 B;  1YF0 A;  3KZQ A;  3GRX A;  4ECB A;  1JZW A;  1M7T A;  2H1B A;  1SEN A;  4DVC A;  4ZBA A;  1UA5 A;  2GGT A;  3D21 A;  2HZF A;  4EE0 A;  3UIW A;  3TJB A;  3BBY A;  5L71 A;  3TKP A;  2X4A A;  2GT6 A;  1PKZ A;  2KLX A;  3UVT A;  1TRW A;  1FB0 A;  2GVP A;  1JZD A;  2HSM A;  5IIZ A;  1U3A A;  2GLR A;  4POL A;  4V1A p;  3A2W A;  4V2L A;  4F9Z A;  1JZR A;  1QMV A;  5IOX A;  3FZ9 A;  4ZXG A;  4G10 A;  4ZB9 A;  3F4S A;  2O89 A;  5KEJ A;  2B5E A;  3IHG A;  3WT2 A;  1SK2 A;  4BVY A;  4N11 A;  3M1G A;  4Z2U A;  3GMF A;  1S3A A;  4I5Q A;  4PQI A;  5ECI B;  4EKZ A;  4P3Y B;  4K6X A;  3VI5 A;  3L4N A;  1A23 A;  1V9W A;  4HJ2 A;  5LD0 A;  2DML A;  3D6I A;  3TKS C;  2WGR A;  2H76 A;  3FEU A;  3G7J A;  6GSV A;  1S3D A;  2IMF A;  3C1S A;  1T4Z A;  3ZIV A;  3HVV A;  4MZW A;  3ZIT A;  2H0I A;  3EVI A;  1G0T A;  4ZL9 A;  2WZ9 A;  1XBS A;  2TRC P;  4IS0 A;  4NWY A;  1HNC A;  5IO2 A;  5DAL B;  4ZL7 A;  3I6A A;  1FVJ A;  2FWG A;  3LQ7 A;  3LGC A;  2HFD A;  1K0B A;  1PL1 A;  1PN9 A;  1QUW A;  3ZMK A;  3F3R A;  3RBT A;  4MJA A;  3ZFB A;  3R3E A;  4IJI A;  5D9V A;  2NBS A;  1AXD A;  4FQU A;  5JWR B;  3WYW A;  3LOR A;  3QPM A;  4MH2 A;  2FGX A;  1ABA A;  2R5G A;  4DEJ A;  1Z7P A;  3BCI A;  4FH8 A;  4GSN A;  1SJ6 A;  2JSZ A;  3IAS 2;  2A2S A;  3KIJ A;  2DMM A;  4YQV A;  5F0G A;  17GS A;  5JWQ B;  4H86 A;  2YWI A;  1T8E B;  2LV3 A;  3E0U A;  4GRF A;  2GQM A;  1X5C A;  3EPT A;  2PMT A;  5DCG A;  2IMD A;  4WEY A;  2QKE A;  2OE1 A;  1Z9H A;  5HQP A;  3ZIJ A;  4EC0 A;  3I9V 2;  5JWO B;  5G30 A;  3GSS A;  1GSS A;  1R5A A;  2L59 A;  1XVQ A;  6GSS A;  3C73 A;  3ERW A;  1VGL A;  4EUY A;  3MYD A;  2KUC A;  1DE2 A;  5FHI A;  1DBY A;  5B6N A;  1ML6 A;  3CSJ A;  4ZBB A;  4GSS A;  1EOG A;  2VCT A;  1GSU A;  5DDL A;  2R37 A;  3TDG A;  4OFT A;  1B8X A;  1Q4J A;  4TR3 A;  4AJ6 A;  4V2M A;  2A2P A;  1O8W A;  2HNL A;  1H4O A;  1IYI A;  3IHQ A;  1IYH A;  2XPE A;  4K7O A;  4YQM A;  2OE0 A;  12GS A;  2RM6 A;  4POK A;  5A4V A;  3PPU A;  1TDI A;  3DD3 A;  3GL3 A;  2L4C A;  5CAX A;  1XVW A;  3K8N A;  3IOS A;  5A4U A;  3GTU A;  3IK9 A;  3DRN A;  1KTE A;  2M46 A;  3APQ A;  1HNA A;  1ZYN A;  2WFC A;  3UMA A;  1TKD B;  4CDO A;  2NVL A;  3EYT A;  3KH7 A;  3ZL5 A;  3S9F A;  5DAL A;  5GZZ B;  3H79 A;  4BL7 B;  2CAI A;  1XWB A;  2OE3 A;  2QA2 A;  5CO3 A;  5LCZ A;  5A4W A;  3F4R A;  3MIX A;  5F07 A;  1HNB A;  4ZIL A;  1A8L A;  4GST A;  4PQ1 A;  3DIE A;  2IPA A;  3D0Z A;  3GFK A;  2JAC A;  3GA4 A;  3GUR A;  4KCE A;  5IM9 A;  2DLX A;  2WS2 A;  5EL8 A;  2YPM A;  1V57 A;  1MD4 A;  2N5B A;  2JZR A;  1GH2 A;  2HRN A;  1M9B A;  2DJ0 A;  1ON4 A;  4LMV A;  4TOP A;  2X8G A;  1NHO A;  5DQY A;  2L5L A;  1GLQ A;  3TKS A;  2RM5 A;  1OYJ A;  4K2D A;  3L9U A;  22GS A;  2VLU A;  1U3I A;  3ZRE A;  1SKW B;  3JCM L;  1PKW A;  2E2M A;  4GXZ A;  4MZC A;  10GS A;  1FOV A;  2DJ3 A;  4EF0 A;  2KHP A;  3ED3 A;  5D9X A;  4OWY A;  3VWV A;  4TXO B;  2C8U A;  5C04 A;  3ZRD A;  1V98 A;  4GTU A;  4IHU A;  1C72 A;  2CZ2 A;  4MH3 A;  1R5P A;  2E2G A;  5AN1 A;  2H19 A;  5ECL B;  4XRD A;  3QOU A;  2JZT A;  9GSS A;  4F82 A;  3FKF A;  4HZ4 A;  2R4V A;  3Q74 A;  4ISD A;  1KEB A;  1M99 A;  2H01 A;  4IKH A;  3GUS A;  2O8V B;  2OAC A;  3F0I A;  1PL2 A;  3I43 A;  3P90 A;  1PGT A;  4MZB A;  2HRK A;  3DKS A;  2HRF A;  1A24 A;  4MF7 A;  3CTF A;  1BG5 A;  4N30 A;  2FWE A;  3D4T A;  4L8E A;  2IWT A;  2AV4 A;  1XW9 A;  4PGT A;  2RUE A;  5HR0 A;  4PQH A;  2M72 A;  4L5O A;  2LRT A;  3GNJ A;  3KXO A;  4POB A;  5CP1 A;  7GSS A;  3KD0 A;  4F2I A;  2CA8 A;  4BL7 A;  11GS A;  4G19 A;  2QA1 A;  5G1K A;  5AGY A;  2PWJ A;  3ERF A;  4EIQ A;  3HJP A;  1O7U A;  2VL9 A;  3KTL A;  4OCE A;  2WB9 A;  4HUA A;  1BYE A;  4USS A;  1G6W A;  4HU9 A;  2DKH A;  2PU9 C;  3GH6 A;  3RDW A;  1GSQ A;  3WGE A;  3KMN A;  2C3T A;  3TOU A;  3RHB A;  1YY7 A;  4CY6 A;  5COH A;  4ML1 A;  4KSO A;  1ERW A;  2H73 A;  2VUP A;  3GKK A;  4J2F A;  1AW9 A;  5JCU A;  4MCU A;  1Z6N A;  1WPI A;  4ZL8 A;  1F6M C;  3H93 A;  4AGS A;  2H70 A;  1GUM A;  1ACV A;  1W4V A;  4JBB A;  4BVY B;  3W6G A;  1XW6 A;  5IMV A;  5CRE A;  1TP9 A;  1SJI A;  1N2A A;  1EGR A;  1ZOF A;  5ECN B;  3O3T A;  1K3Y A;  4PNF A;  4TXO A;  5HFI A;  2X8H A;  1GRX A;  1I5G A;  2X8C A;  3LXT A;  2DSA A;  1BQ7 A;  2H6Z A;  3IC4 A;  2J23 A;  3F63 A;  4RI6 A;  4WF4 A;  3KEB A;  1YDK A;  2YZU A;  3EMP A;  2CAQ A;  3HA9 A;  1SL0 B;  13GS A;  1QFN A;  3F4T A;  4WKW A;  2GSS A;  3P7X A;  3US3 A;  2A4V A;  2DIZ A;  5CYY A;  5J5N A;  1LJR A;  2I1U A;  2TRX A;  3PR8 A;  3ZML A;  2VLT A;  4K0N A;  5E59 A;  1PD2 1;  4IVF A;  2GSR A;  3RAZ A;  2CT6 A;  2MBT A;  1OKT A;  2H6Y A;  5F06 A;  2PPT A;  2HSY A;  4MPG A;  2A4H A;  3IXR A;  2C0F A;  1RW1 A;  1Z5Y E;  3VPQ A;  2ZCT A;  1QQ2 A;  2IMI A;  4L0U A;  5HFG A;  4G0K A;  2YOI A;  3BJ5 A;  2CQ9 A;  3FR3 A;  3FK8 A;  4OFN A;  2I9H A;  2IL3 A;  2V6O A;  2R2J A;  5GST A;  1O8X A;  2YV7 A;  3LYK A;  1M2B A;  4ILF A;  3FR9 A;  3TJG A;  2L6C A;  1Z6M A;  4TR4 A;  4ML6 A;  3F6D A;  3D22 A;  2GDR A;  3CBU A;  2C3N A;  1GUL A;  1UVZ A;  2OAD A;  5AIS A;  1V2A A;  2H1D A;  2VCV A;  2LJK A;  2LUS A;  3KH9 A;  4KH7 A;  4NV5 A;  4ICY A;  3M0F A;  1HQO A;  4JR4 A;  6GST A;  4YAP A;  1J08 A;  1G7O A;  5ELA A;  3M9K A;  2B7K A;  3ME7 A;  4OCF A;  2C4J A;  3WT1 A;  1B9Y C;  2XHF A;  5DBQ A;  4ZBD A;  2V32 A;  3TCO A;  3UAP A;  4OD7 A;  14GS A;  3TRX A;  1SD9 A;  3FY7 A;  2EIQ A;  4NAX A;  4DSQ A;  4TN8 A;  4X43 A;  1PX6 A;  2CV4 A;  4MJE A;  2X49 A;  2JAD A;  2C80 A;  5H5S A;  5DJL A;  4AF2 A;  4GQC A;  1T7P B;  2F51 A;  2FY6 A;  3DWV A;  4PUF C;  1URM A;  1WP0 A;  4MAB A;  18GS A;  3KP8 A;  4KDX A;  5G5F A;  3MWH A;  3GTU B;  1BJX A;  2N5A A;  2L57 A;  2LS5 A;  4X4J A;  2KP1 A;  1AC1 A;  4G0L A;  1T3B A;  1TK5 B;  1XOB A;  2YNX A;  4ULX A;  5CRG A;  1TRV A;  2X99 A;  1SYR A;  5D93 A;  1O81 A;  3IAM 2;  1JFU A;  3SBC A;  3FYG A;  1X9M B;  4PUR A;  1JLV A;  4OMV A;  3F9U A;  3DEX A;  3A2V A;  4WF5 A;  1Y6E A;  4PUA A;  1TJD A;  2XPD A;  6GSW A;  1SL2 B;  1SK1 A;  2LTK A;  1EZK A;  2GZP A;  4FYU A;  2M80 A;  1CQH A;  1TRU A;  5DVB A;  4IN0 A;  2LKU A;  2WJU A;  1ERT A;  4ECI A;  1VF3 A;  2C3Q A;  1PQN A;  1XWC A;  2OBI A;  3GX8 A;  1O73 A;  5B6M A;  3F8U A;  1X5D A;  3FZ5 A;  4PX1 A;  1WE0 A;  1E6B A;  1TK8 B;  4HU7 A;  5CRW A;  3VI7 A;  4LL4 B;  2HYX A;  1Y25 A;  3MSZ A;  4QL9 A;  4AJ8 A;  4CY8 A;  2GST A;  1X5E A;  4IP6 A;  1R4W A;  4X0X A;  5D73 A;  2H8L A;  1H75 A;  1XXU A;  4N10 A;  3W8S A;  4KW6 A;  4KF9 A;  4K0G A;  5HR2 A;  2VCZ A;  1YEX A;  2ON5 A;  2VD0 A;  4A5P A;  4EIP A;  3O6T A;  2ALB A;  3NOF A;  1MDJ A;  3Q18 A;  5DCH A;  1GSE A;  1K0C A;  3E9J B;  3TJF A;  4DSR A;  3ZYW A;  1ZZY A;  5DQS A;  3UVH A;  3VWU A;  4JED A;  2IMK A;  3OR5 A;  5KN1 A;  2VO4 A;  2FUG 2;  3GKX A;  1M0U A;  2WRT A;  1R7H A;  5IMF A;  4NXI A;  4HQS A;  3ZLP A;  3QR6 A;  5ECS A;  2B7J A;  2QC7 A;  2HE3 A;  1ZYQ B;  5HFK A;  1YF1 A;  2HSH A;  4XIH A;  5KN3 A;  3LYP A;  1X9W B;  3LEF A;  4IQA A;  2EIR A;  3IR4 A;  2PBJ A;  4Q5N A;  3HDC A;  1ILO A;  4N0Z A;  1E2Y A;  3KMO A;  4I6X A;  1WJK A;  4POM A;  4BWQ A;  3VWX A;  2LJR A;  4K1F A;  3ZFL A;  3UL3 A;  5ECQ B;  2AHE A;  2G0F A;  3GST A;  2CZ3 A;  4HJM A;  3FRC A;  1AAZ A;  4KGI A;  4EL1 A;  1PRX A;  4MDC A;  3GV1 A;  1QXH A;  3D5J A;  3WGX A;  5AIX A;  4MPF A;  1GTA A;  2DKI A;  2GT5 A;  4F03 A;  1VF2 A;  3EUR A;  4O32 A;  3MDK A;  5IOW A;  5IMD A;  2K6V A;  1GSD A;  2FWH A;  5HR3 A;  3QDN A;  4FYC A;  3FR6 A;  3QFB C;  4QL7 A;  3RPP A;  4OO4 A;  4WBR D;  3J7Y b;  5CNW A;  3R2Q A;  2LEG A;  2V1M A;  1MD3 A;  4ACS A;  4IP1 A;  1B48 A;  1V40 A;  3VPT A;  4BA7 A;  4TRX A;  1WIK A;  3L78 A;  4O5Q A;  2C1Y A;  4BVX A;  1THX A;  5B8B A;  5KN0 A;  2DJ2 A;  2QGV A;  4IEL A;  4HEA 2;  3HVX A;  1ZMA A;  3QAV A;  3IE3 A;  2L4Q A;  1USB A;  5IQY A;  4LMW A;  3TJK A;  3KM6 A;  4ECJ A;  1THO A;  3APS A;  4EDY A;  3BOA A;  2I3Y A;  2YWO A;  4K5R A;  2PER A;  4MLY A;  3M3M A;  3FZ4 A;  2JSY A;  2CVK A;  2VD1 A;  3EU4 A;  1AIU A;  5ECO B;  3P8W A;  5BRT A;  2MMZ A;  1OC9 B;  4RUV A;  3IC8 A;  2VCW A;  4HS1 A;  1EV4 A;  1MDI A;  2XBI A;  4HZ2 A;  2HZE B;  2YZH A;  4EO3 A;  2ES7 A;  3EMX A;  1GTU A;  1K0D A;  2C0G A;  3CXG A;  1OKD A;  2P31 A;  3C71 A;  2MMA A;  5DAK B;  3L9S A;  3DXB A;  4WET A;  2LST A;  1RK4 A;  1FB6 A;  2RUF A;  3HZ4 A;  2MMN A;  3QAW A;  1M9A A;  2H1A A;  3U5R E;  2F9S A;  2V6K A;  2YJH A;  2HRA A;  3TRP A;  3UAR A;  2VL2 C;  2C0E A;  1AQV A;  4KB3 A;  3NIV A;  2H66 A;  2PGT A;  1XOA A;  2LRC A;  2K9F A;  2R0G A;  4KDY A;  2E7P A;  3LWA A;  3TKQ A;  1FAA A;  4JRR A;  4O5U A;  4XCS A;  1W89 A;  3DML A;  1GSY A;  1PN0 A;  2FNO A;  1CQG A;  4I8B A;  4G2E A;  4TW5 A;  5AIV A;  1XCC A;  3H1N A;  1EP7 A;  2G2Q A;  4KND A;  2H0G A;  2YAN A;  3EIN A;  1MTC A;  2YP6 A;  3A5I A;  5B8A A;  2LQQ A;  3HY2 A;  4K7I A;  4ZB8 A;  1YKC A;  2H71 A;  2BTO T;  4CW9 A;  1PSQ A;  1FO5 A;  1OVN A;  3MAK A;  3Q6O A;  2P5R A;  1SYX A;  3TRQ A;  2AUV A;  3Q19 A;  3QAG A;  6GSX A;  2GQK A;  2HLS A;  1A2L A;  3LXZ A;  2X64 A;  1EOH A;  1TU7 A;  3EWL A;  2H6X A;  1DSB A;  1K0M A;  2VOC A;  4K5S A;  4I2T A;  1K3O A;  2C0D A;  4K7N A;  4L0W A;  1LU4 A;  2GZZ A;  1M2D A;  3HJO A;  2O87 A;  1TOF A;  4ECC A;  5G31 A;  3H8Q A;  3RPN A;  1ST9 A;  2B5Y A;  3GHA A;  3IA1 A;  5C00 A;  2VCQ A;  1Z3E A;  3ZTL A;  3UBL A;  2PUK C;  3HCZ A;  4XRA A;  3N5O A;  2AJQ B;  2V2G A;  3I69 A;  1OC9 A;  2WCI A;  4WR5 A;  3LFL A;  4TR0 A;  3CRT A;  5ECR B;  1F2E A;  4KA0 A;  3UJ1 A;  2HZE A;  1KNG A;  1J9B A;  3VLN A;  4MJB A;  1KBN A;  2B6M A;  1SJZ A;  5DAK A;  2VLV A;  5LNK e;  1VF1 A;  2IN3 A;  4RQR A;  3IDV A;  1N8J A;  1F37 A;  4MMM A;  4YQU A;  3LJR A;  2H0H A;  4NPB A;  4NV2 A;  2NPB A;  5ENU A;  4RQX A;  3EE2 A;  5D9W A;  3GN3 A;  2MYG A;  2YV9 A;  1K0O A;  4IGJ A;  3FZA A;  4O5R A;  5CRH A;  1NHY A;  4MK3 A;  1EEM A;  3PH9 A;  1MEK A;  4GCI A;  3G7Y A;  3IV4 A;  3HYP A;  1NW2 A;  1YQ1 A;  3IK7 A;  1AQX A;  1FW1 A;  2RLI A;  2F8F A;  5KN2 A;  3KCM A;  8GSS A;  1FVK A;  16GS A;  1K0N A;  1T00 A;  2IME A;  2TIR A;  3GIX A;  4MNN A;  1K0A A;  2YWN A;  1EP8 A;  2F3M A;  1M2A A;  1K3L A;  5KOX A;  4DSS B;  3FW2 A;  3P2A A;  1OC3 A;  3J7Y k;  3UBK A;  5ECM B;  5ECP B;  2GQL A;  4XS6 A;  6GSY A;  1X9S B;  2B3S A;  2VL2 A;  1ERV A;  2OJL A;  3APO A;  1FG4 A;  1FHE A;  5D96 A;  2VM1 A;  3U6V A;  1GUH A;  3LW9 A;  1V58 A;  1U87 A;  1SD8 A;  2JU5 A;  2KOK A;  4OO5 A;  5E4W A;  5IPH A;  2Z9S A;  5FT3 A;  4WXT A;  2B1K A;  1GP1 A;  2H75 A;  2BJX A;  1R26 A;  4YKF A;  5DJM A;  3UEM A;  1YJ6 A;  2L5O A;  1OC8 A;  2EIO A;  3CRU A;  3M8N A;  5EVO A;  5ECK B;  1WWJ A;  5ECH B;  19GS A;  4NHZ A;  1PX7 A;  2REM A;  1XPV A;  2E0Q A;  4G9H A;  2D2Z A;  2IJY A;  1HYU A;  2WUL A;  3IBH A;  4XTS A;  4KX4 A;  3HJM A;  4AJ7 A;  3CSI A;  1A0F A;  1WOU A;  2JZS A;  1G7E A;  4Q5F A;  4BVX B;  4D73 B;  3VFI A;  1HD2 A;  2DJK A;  5J9B A;  4MF5 A;  5A5K A;  2LQO A;  1GNE A;  3EC3 A;  3O76 A;  3VK9 A;  5H5R A;  4ZIJ A;  2VM2 A;  2DIY A;  3VWW A;  2VAF A;  2FA4 A;  2R0C A;  3GKM A;  3KJY A;  4HDE A;  1B4Q A;  2N5F A;  2LRN A;  2FD3 A;  5J4U A;  1JLW A;  4JE1 A;  1TRS A;  3CTG A;  2EC4 A;  2K8V A;  2ZUP A;  4O92 A;  1XIY A;  4MA9 A;  1JHB A;  1JZO A;  4FYB A;  3KGK A;  4F0B A;  4HI7 A;  1ZL9 A;  4MF6 A;  1TI3 A;  3WGD A;  1F9M A;  2NDO A;  1A2J A;  4LA1 A;  5ID2 B;  2LJA A;  2LNS A;  4GLT A;  4EXJ A;  4DSS A;  3DVW A;  3IRA A;  1EWX A;  1XW5 A;  2IFQ B;  3DVX A;  1QGV A;  1DE1 A;  3UOM A;  4YKG A;  5G5E A;  1T4Y A;  4E8E A;  4I2U A;  1B9X C;  2AAW A;  4TVE A;  2R6K A;  4MJC A;  5GAN D;  3D4M A;  1ZGN A;  4XS4 B;  3TOT A;  5EY6 A;  5GAP D;  2MZC A;  1O6J A;  5INY A;  5IPG A;  1TK0 B;  3BCK A;  2O7K A;  3G7I A;  3TKR A;  3KTB A;  2VIM A;  1VRS D;  5GSS A;  1WMJ A;  2PN8 A;  3RHC A;  1EEJ A;  5HR1 A;  3HVS A;  2CVB A;  4N0V A;  4GQF A;  3A5W A;  20GS A;  3E3E A;  3ZVJ D;  4KCA A;  3TUE A;  3GKN A;  3TKS E;  1F3A A;  4JU5 A;  2YWM A;  2B5X A;  1XWA A;  3QMX A;  1U6T A;  3G9B A;  5H5Q A;  4BPY A;  1BX9 A;  3MNG A;  3L0H A;  2CX4 A;  4IQ1 A;  2DC5 A;  4D73 A;  2KP2 A;  3HKR A;  1GLP A;  2IIY A;  3PGT A;  2VCX A;  4FIW A;  3HHV A;  4FO5 A;  1A2M A;  2OKA A;  3HD5 A;  1OE8 A;  2O85 A;  4Q5R A;  2V41 A;  5J3R A;  1AQW A;  5IMZ A;  4O7H A;  1EV9 A;  2OBK A;  3CSH A;  2P0G A;  4LLR A;  1GNW A;  1GUK A;  4OFM A;  4KSM A;  4IBP A;  3ME8 A;  2YN1 A;  1YEP A;  1GTI A;  2F8A A;  2QSI A;  2FWF A;  4WBJ A;  5EPF A;  1Q98 A;  5ELG A;  4V2N A;  4TR1 B;  3FHK A;  3F3Q A;  5ID2 A;  1XZO A;  4PNG A;  1O85 A;  4ID0 A;  4PXO A;  3BD2 A;  2GZY A;  1GL8 A;  2K18 A;  3SWL A;  3HZ8 A;  1ZYE A;  2IFQ A;  5JCW A;  5F8B A;  1X0R A;  1F3B A;  4IW9 A;  1MDK A;  3NZN A;  4Z7X A;  1ERU A;  4NMU A;  4ZB6 A;  2H30 A;  2MMO A;  2BMX A;  1XWK A;  1NM3 A;  4MP4 A;  4KAE A;  2GTU A;  4XS4 A;  4KE3 A;  1DUG A;  1RQM A;  2H74 A;  3H4K A;  3ZZX A;  3HXS A;  2PVQ A;  4K8M A;  2GSQ A;  4KUN A;  4IJ3 A;  1A8Y A;  2L6D A;  4TKY A;  1BAY A;  1SK0 A;  5ABR A;  3M9J A;  3ERG A;  3GX0 A;  2FA8 A;  3LSZ A;  1NSW A;  5G1L A;  3IPZ A;  2HI7 A;  3A2X A;  1TI1 A;  2VL3 A;  4TXV A;  4XS1 A;  4YAV A;  1OAZ A;  1Z7R A;  1OE7 A;  2NTO A;  3C7M A;  1LBK A;  4J56 E;  3TB2 A;  1TXX A;  4LL1 B;  2YJ7 A;  3DYR A;  4J57 E;  5G2Z A;  1UC7 A;  4G0I A;  6GSU A;  3TJJ A;  1YKA A;  3C1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...