1A67A

Chicken egg white cystatin wildtype, nmr, 16 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
108
structure length
108
Chain Sequence
b'GAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN
publication title The structures of native phosphorylated chicken cystatin and of a recombinant unphosphorylated variant in solution.
pubmed doi rcsb
molecule tags Proteinase inhibitor
total genus 13
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1998-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1a67A00
3L0RA 4N6MA 5ELJA 1A67A 3PXMA 2KXGA 3NX0A 3K9MC 1LXEA 1PFPA 1CEWI 4N6TA 1IV7A 2CH9A 4N6OB 4CCVA 5LC6A 1YVBI 1WNHA 3UL6A 4N6LA 4N6NB 1RN7A 5A0OB 3GAXA 2O9UX 3QRDA 1IV9A 1N5PA 2OCTA 1N9JA 4ZM8A 5EQLA 3S67A 5ELUA 3MWZA 1M9GA 4TX4A 1CYVA 1MNLA 3UL5A 1GD4A 1STFI 1EQKA 3PYJA 1DVDA 3IMAB 4N6V0 1FUWA 3Q2PA 2W9PA 1MOLA 4EYCA 5LC7A 1NB3I 1CYUA 4LZIA 3KFQC 1TIJA 3SVAA 2BO9B 3PS8A 1FA3A 1DVCA 4N6UA 1A90A 3KSED 4IT7A 1KWIA 1N5HA 3LH4A 1R4CA 1G96A 1ROAA 1GD3A 2W9QA 1NB5I
chains in the Genus database with same CATH superfamily
1SPUA 1RMSA 2GXFA 3H3HA 4HJLB 4K61A 4KFFA 4R9LA 1LVNA 2OQEC 1UUWB 4FMCA 3B7CA 2P05A 5ELJA 1A67A 2STDA 3SX1A 1VQO3 3GSPA 2FGTA 2F99A 2OWPA 3EHCA 3IPTA 5AIIA 1JZOA 3WR2A 1O7HB 3PGBA 5D83A 3AMOA 1B3SA 2F86B 1BRHA 3NBRA 1WMOA 1LOXA 3CCQ3 1CEWI 2C10A 6RNTA 5KP4A 2FXTA 4N6TA 1M904 1IV7A 3UJMA 1F8NA 1NO3A 2H0IA 2CH9A 3CNXA 3NV0B 1RGKA 5LC6A 4LGQA 3X41A 2BU4A 3N8BA 2F4YA 1VQ93 3LTAA 1RN7A 3OWYA 3D4AA 2KF3A 1Q7HA 1OCVA 3EBYA 3LTCA 1ULJB 1BSEA 3ECFA 1OPYA 3K7CA 3QRDA 2XEPA 1YGWA 1LQGC 3NQZA 4I5QA 5M1AA 1RGCA 3U97A 3WOEB 1BNIA 4H3UA 4K1VA 1Q40B 2A15A 3AGOA 5IW9A 2W56A 4J5KA 3H51A 3V99A 1KD14 2BMQB 1FGQA 2XFTA 2KF5A 3OXAA 1TUHA 1T3BA 2CG1A 3X3YA 1A2PA 1VQ63 1RTUA 3KKGA 2W6JH 3LXUX 4CJNA 1FUSA 2XGLA 4I4KA 7RNTA 1MWRA 2Z7AA 5IEPA 4HM7B 4OUQA 1BRIA 1SJWA 4RBNA 3CMA3 2ZHXB 4KFDA 2RSXA 2Z6BA 5TGNA 3Q1CA 1VQ53 2W04A 1Y4KA 3MG1A 3BU4A 3T8NA 1T2HA 5G1LA 2HMOB 5AIGA 4FR9A 5I97A 1B2UA 1UI8A 1RCKA 1N9EA 1STFI 2M7OA 1EQKA 2H0HA 5D82A 2E2TA 5G1KA 3ZG5A 4R80A 3G713 2HOHA 1MOLA 1D6ZA 4EYCA 2W03A 1IQYA 3UNLA 4HBRA 3K0ZA 1N8QA 1YVSA 4MJDA 3X42A 1CYUA 1HYFA 1QAKA 4IPBA 4KZ1A 5CF2A 3SYUA 1Q42A 1K9M4 2F56A 4L8OA 3AGNA 3MYTA 4LSOA 1LOWA 4N3VA 3B4PA 1FYSA 3PZWA 4GL6A 5STDA 3URPA 1OACA 1U5OA 4RNYA 1DVCA 1W5ZA 3M8CA 2YX9A 3HOHA 4GHOA 5HOHA 3D5IA 3MG2A 3A76A 3WHOA 1RSNA 3CCR3 1S723 3CC43 3EBTA 3FF2A 8RNTA 4LYLB 2R41A 4IT7A 1LQMB 3HIIA 1IT8A 3I0YA 3LZAA 1W00A 4GB5A 2IY2A 4R4KA 4AEQA 3LH4A 4EV2A 3T8UA 3OV4A 2GU1A 1X1YA 1OF5A 2ZA4A 4ORLA 1G96A 1IT7A 7GSPA 1K41A 2F5WA 4LEHA 3KCHA 1Q9EA 1LOVA 4BTWA 1BSBA 3KZTA 3SXXA 1UI7A 3FGYA 3J7Yd 1N8R4 1BNRA 1I3FA 1I70A 2IA7A 3MPHA 3FSDA 2QGUA 1TTOA 2WGOA 1Q814 3Q3FA 1JKGB 1IQ8A 2P0MA 3PCRA 3OW22 3GZBA 3BNDA 2GEXA 4H61A 3RNTA 3JUNA 2KCDA 5CXOA 2P38A 3HZPA 1K28A 4O3VA 3NM2A 5KP1A 3DGLA 1QVG2 3MKIA 3UB1A 2XSOB 1I0XA 1V74A 1FGOA 1T2IA 3CD63 1S5AA 2RFRA 1BOXA 3HI7A 2CIUA 5AIFA 2MC8A 1RLSA 1BAOA 1YGEA 3DGYA 3F14A 4WWUC 1ROVA 3G6E3 3GRDA 1OGXA 1B2ZA 3A5EA 1YJ93 2I9WA 1W01A 1GS3A 3F40A 3UL6A 1PU4A 1TRPA 2LQVA 4GSPA 1GY7A 1U8CB 3GZXB 5A0OB 1BVIA 3NHXA 3FLJA 1K8A4 3ROBA 3DGMA 3GAXA 1BRGA 1IVXA 2OOVC 3FZWA 4RNZA 2CFKA 2IUJA 1BNEA 5AEUB 1IV9A 3D3LA 5DREA 2ML6A 2W0QA 3CME3 2OQEA 3DGNA 2D1WA 3O8YA 1OH0A 1TJDA 3IJEB 4HZBB 3WOFB 1MWSA 3B4OA 4XBTA 3NV0A 2OTL3 1IQXA 4BTXA 5CLKA 3OWUA 5M18A 3BB9A 3CCJ3 1Q864 1BRJA 2E2UA 4FMAA 1JN5A 1DE3A 1M1XB 1LRAA 2WGQA 1WQLB 1RGEA 2CX1A 1JN5B 1DMNA 3UL5A 5D81A 4R9KA 3LT9A 5AI1A 4FMDA 5JBSA 3VGNA 4MMYB 4DKIA 1Q40A 2HMJB 4WHAA 4BL2A 3CCE3 3AHSA 2IYJA 3BNEA 3IMAB 1VQK3 4N6V0 1FUWA 3NXJA 1RCLA 1AY7A 2SARA 3CPOA 3SOYA 5LC7A 3NBBA 1DYUA 5HGRA 5BVBA 3S29A 1I8VA 3QK9A 3CPW2 1GOYA 5IG5A 1IYYA 3G16A 4LZIA 5EEOA 1TIJA 4AKYA 3SVAA 1IVWA 2GBXB 4KT3B 2IMJA 3D5GA 1RGHA 1QMAA 1BU4A 1MGWA 4FCMA 3V92A 2WO0A 3DMCA 1VQP3 2YFLB 3K63A 1EUIC 3KSPA 5GSPA 3CCU3 1C7HA 1UCKA 5IF6A 1PY3A 2B24B 3G8ZA 1JB5A 1OHOA 4HM6B 1OHSA 1KWIA 5BXQA 4J5GA 3CCS3 1VQM3 2OTJ3 1UUVB 4L8PA 1GMQA 1EEJA 3FKAA 2AAEA 4HYZA 4XBYA 1RN4A 1ASKA 1ROAA 3NBJA 1GD3A 1NWWA 5BU4A 3SEDA 1BNGA 1US1A 1YIT3 1WMNA 1NB5I 3CU3A 3L0RA 4HKVB 2P0XA 3MHEA 1FGTA 3D79A 2Z76A 4N6MA 1AV4A 4MEIA 3G0KA 4G1MB 4HZ9B 4HM0B 3EX9A 4FCZA 1ZGXA 1E3VA 3PXMA 2BMRB 3ZFZA 3I553 2CFGA 1BSDA 2KXGA 8CHOA 3S28A 1X1UA 3DH2A 1DMMA 3JUQA 3LT8A 1RGGA 6GSPA 1BUQA 3DXOA 1IVVA 4EV5A 1KSIA 4CPKA 1MWUA 1W4NA 2RBIA 2RCDA 1SIIA 2UGIA 1BRKA 1GSPA 1CQSA 2XGNA 2XRXB 3GZYB 3LMLA 3CC23 1GY5A 5FGOA 1KC84 2O3OA 3F7SA 4WYKA 1PYLA 2AADA 4N6OB 2PNCA 3KE7A 1UCLA 2QEX3 2F98A 4WYKB 1YVBI 1X1WA 1A2VA 1JKGA 1TRQA 1ULIB 2CFDA 3FG4A 1QAFA 2W2CA 4N6LA 3VSYA 4QWTA 4EXRA 1SIHA 4O02B 4HM1B 1TFKA 1BANA 4KVHA 2YFJB 3ZG0A 1STDA 2XSHB 2O9UX 1UUGB 1SARA 1RNBA 3CXC2 2OCTA 4HM8B 1BSCA 1BIRA 5DRVA 3LOYA 3OWSA 3GWRA 3S5CA 3EB8A 3N9HA 1VQL3 3EJVA 2V1LA 2WOFA 1N9JA 1B2SA 2J8XB 1B20A 3G4S3 1RRLA 1O7WB 2CKFB 4ZM8A 1K734 2CFLA 1IVUA 3MWZA 1GYBA 2CWUA 4K90B 5AIHA 1M9GA 3BIRA 4HOHA 1W02A 2R4IA 4TX4A 1CYVA 1B27A 5IG3A 1Q824 4RNTA 2Q07A 4NPBA 3BLZA 4HM3B 1RGAA 1KQS2 3ER7A 4Q53A 1W6YA 1VQQA 4NHFA 3HIGA 2GBWB 1YJN3 1FUTA 2ZDJA 2HMLB 3I563 1AVLA 5EVHA 3E99A 3X40A 2CWTA 1GMPA 3JUMA 3Q2PA 4BTYA 5JPPA 1NNVA 2W9PA 2XH9A 5KP3A 1ZS7A 4RZMA 2H0GA 2OOVA 2INXA 1EG9B 2HMNB 2QIYA 1NB3I 3PCSA 3WDGB 1J2BA 1JB4A 2P09A 3F7XA 1B21A 3MSOA 1AQZA 3KFQC 4R1KA 2BO9B 3PS8A 3LYGA 3WMDA 3F8HA 1WTHA 1IDPA 3STDA 4HM4B 1RNTA 1B2XA 4XB5A 1FW7A 2QA43 1RJOA 2RNTA 2SBLA 5AEWB 4N6UA 1AR0A 1BNSA 3X3XA 3WA3A 1A90A 1BSAA 3DM8A 2XR8B 3KSED 1O7PB 3CC73 4OK0A 3B8LA 3EE1A 2KF6A 1DETA 1EA2A 1GY6A 4MMXB 2Y74A 4JF8A 2BT3A 2F5MA 1NU3A 1NDOB 4J9AA 1AVKA 3DZLA 1NJI4 3AMOB 5BIRA 3Q90A 5JPUA 1E97A 1R4CA 2LYXA 1QVF2 4WP5A 2JDIH 1OGZA 1DMQA 1I2FA 2CG0A 2ML5A 4JRFA 1X1XA 2CFWA 3EN1B 5IENA 1VQ73 4XDVA 1G0TA 3NUVA 2K3DA 4EBGA 1I2EA 3CNMA 1JJ22 2BIRA 3JVCA 2CHCA 1LNIA 5IERA 4AKZA 1JBSA 1RGFA 2UX0A 1YIJ3 3KN4A 3JUOA 5IG0A 3NX0A 1MGRA 1VZZA 2GSPA 3D9RA 3U1WA 4EC6A 1MWTA 2UUGC 1BGSA 4STDA 3K9MC 2JQ5A 1GOUA 1LXEA 1O7NB 1VQN3 1TFOA 1UDII 3FG3A 1PFPA 2GU3A 3LTDA 4XM4A 1G02A 2RGQA 1RRHA 2C4BA 1BUJA 2W56B 3ALAA 3V98A 1O7MB 4HAAA 1BRNL 4K1UA 1I3IA 4X2OA 1CH0A 2L1SA 3LTBA 4EW5A 2KRTA 4CCVA 2CX0A 4KFEA 3CCM3 3GZRA 3SOAA 1WNHA 3BNCA 4FMBA 4HM2B 3T0UA 1VQ83 1T5YA 3DGOA 2E2VA 2MF7A 1LNHA 4N6NB 4BU4A 7STDA 2B1XB 2CC3A 4NREA 3EQQB 5M19A 5RNTA 2BHMA 2Y73A 2YFIB 3VF1A 1JV2B 3EN8A 1BNFA 1E3RA 3FG1A 3MG3A 3RGRA 1N5PA 4BL3A 3DUKA 1YNVX 2KAAA 5CK6A 3X3ZA 1WMPA 1Q7Y4 1C54A 1I2GA 4BIRA 1UCJA 5IEOA 3S27A 1R4YA 2K0MA 1V57A 4O8SA 1RGLA 2CK3H 1Z1SA 3DY5A 5CF1A 1D6YA 2C11A 5EQLA 6STDA 5G2GA 1UGIA 3S67A 1YI23 4FCJA 5ELUA 1OHPA 5FW5A 1LOYA 1VQ43 2ZL8A 1ISKA 5IG4A 1TP6A 1I0VA 3K5TA 3NM7A 3JUPA 1HKXA 1RHLA 1MNLA 4O2HA 1B2MA 2GEYA 3NQYA 2XFSA 1GOVA 2BMOB 3BNBA 1UGHI 1RKYA 1RDSA 1GD4A 1RN1A 4IIAA 1SQWA 3FH1A 3FCSB 3TDGA 4CDLA 2Z77A 1IU7A 3PYJA 3CCL3 1DVDA 1V58A 1ZO2A 3KIIA 1ZX2A 4L7KA 3WA2X 1FGMA 3HX8A 2CW9A 1YJW3 1HZ1A 1OF5B 2WOHA 1O7GB 9RNTA 1UCIA 3FF0A 2PZVA 3EC9A 3N54B 4OVMA 2CWVA 1OUNA 3HK4A 1FA3A 3EF8A 1W6CA 1L5GB 2D42A 1W7CA 2HMMB 1BNJA 2K54A 4J8TA 3AHWA 4MMZB 4PEJA 1YHQ3 1FGRA 5AYRB 2IUKA 1GMRA 4XBXA 3RGAA 5AYSC 2FNQA 4LMIA 1JBRA 1FZUA 3SLUA 2L4VA 3WODG 3CCV3 1W2B2 1BRSA 1IK3A 2HMKB 4HM5B 4WFOA 1N5HA 1TU5A 3RDEA 1D6UA 1JRQA 3F9SA 4XDWA 4U13A 3OX9A 1HU9A 1W2ZA 4X2HA 3F8XA 1JNQA 4HVNA 1W6GA 1JZDA 2XF3A 1QJGA 2KF4A 1UW1A 1M1K4 4ILFA 1QALA 1A2KA 1EKMA 1JBTA 2W9QA 1JB2A 2BNGA
chains in the Genus database with same CATH topology
1SPUA 4K61A 2GXFA 3H3HA 4HJLB 4KFFA 4R9LA 1LVNA 2OQEC 1UUWB 4FMCA 3B7CA 2P05A 5ELJA 1A67A 2STDA 3SX1A 1VQO3 2FGTA 2F99A 2OWPA 3EHCA 3IPTA 5AIIA 1O7HB 3PGBA 5D83A 3AMOA 2F86B 3NBRA 1LOXA 1WMOA 3CCQ3 1CEWI 2C10A 5KP4A 2FXTA 4N6TA 1M904 1IV7A 3UJMA 1F8NA 1NO3A 2CH9A 3CNXA 3NV0B 5LC6A 4LGQA 3X41A 3N8BA 1VQ93 3LTAA 1RN7A 3OWYA 1OCVA 3EBYA 3LTCA 1ULJB 3ECFA 1OPYA 3K7CA 3QRDA 2XEPA 3NQZA 3U97A 3WOEB 4H3UA 4K1VA 1Q40B 2A15A 5IW9A 2W56A 3H51A 3V99A 1KD14 2BMQB 1FGQA 2XFTA 3OXAA 1TUHA 2CG1A 3X3YA 1VQ63 3KKGA 2W6JH 3LXUX 4I4KA 2XGLA 2Z7AA 5IEPA 4HM7B 4OUQA 3CMA3 1SJWA 4RBNA 4KFDA 2RSXA 2Z6BA 5TGNA 3Q1CA 1VQ53 2W04A 1Y4KA 3MG1A 3T8NA 2HMOB 5AIGA 4FR9A 5I97A 1UI8A 1N9EA 1STFI 2M7OA 1EQKA 5D82A 2E2TA 3G713 4R80A 1MOLA 1D6ZA 4EYCA 2W03A 1IQYA 3UNLA 4HBRA 3K0ZA 1N8QA 1CYUA 4MJDA 3X42A 1QAKA 5CF2A 4IPBA 4KZ1A 1Q42A 1K9M4 4L8OA 3MYTA 4LSOA 4N3VA 3B4PA 4GL6A 3PZWA 5STDA 1OACA 1U5OA 4RNYA 1DVCA 1W5ZA 3M8CA 2YX9A 3MG2A 3A76A 3CCR3 1S723 3CC43 3EBTA 3FF2A 4IT7A 3I0YA 3HIIA 1IT8A 3LZAA 1W00A 4GB5A 4R4KA 4AEQA 4EV2A 3LH4A 3T8UA 3OV4A 2GU1A 1OF5A 4ORLA 1G96A 1IT7A 1K41A 4LEHA 4BTWA 3KZTA 3SXXA 1UI7A 3FGYA 3J7Yd 1N8R4 2IA7A 3MPHA 3FSDA 2QGUA 2WGOA 1Q814 3OW22 1JKGB 1IQ8A 2P0MA 3PCRA 3GZBA 3BNDA 2GEXA 4H61A 3JUNA 2KCDA 5CXOA 2P38A 3HZPA 1K28A 4O3VA 3NM2A 5KP1A 3DGLA 1QVG2 3MKIA 3UB1A 2XSOB 1V74A 1FGOA 3CD63 1S5AA 2RFRA 3HI7A 2MC8A 2CIUA 5AIFA 1YGEA 3F14A 4WWUC 1ROVA 3G6E3 3GRDA 1OGXA 1YJ93 2I9WA 1W01A 1GS3A 3F40A 3UL6A 1PU4A 2LQVA 1GY7A 1U8CB 3GZXB 5A0OB 3NHXA 1K8A4 3FLJA 3ROBA 3DGMA 3GAXA 1IVXA 2OOVC 3FZWA 4RNZA 2CFKA 2IUJA 5AEUB 1IV9A 3D3LA 5DREA 2ML6A 2W0QA 3CME3 2OQEA 3DGNA 2D1WA 3O8YA 1OH0A 3IJEB 4HZBB 3WOFB 3B4OA 4XBTA 3NV0A 2OTL3 1IQXA 4BTXA 5CLKA 3OWUA 3BB9A 3CCJ3 1Q864 4FMAA 2E2UA 1JN5A 1M1XB 2WGQA 1WQLB 1JN5B 1DMNA 3UL5A 5D81A 4R9KA 3LT9A 5AI1A 4FMDA 5JBSA 3VGNA 4MMYB 1Q40A 2HMJB 4WHAA 3CCE3 3BNEA 3IMAB 1VQK3 4N6V0 1FUWA 3NXJA 3CPOA 3SOYA 5LC7A 3NBBA 1DYUA 5HGRA 5BVBA 3S29A 3QK9A 3CPW2 5IG5A 3G16A 4LZIA 5EEOA 1TIJA 4AKYA 3SVAA 1IVWA 2GBXB 2IMJA 1QMAA 4FCMA 3V92A 2WO0A 3DMCA 1VQP3 2YFLB 3K63A 3KSPA 3CCU3 1C7HA 5IF6A 2B24B 3G8ZA 1JB5A 1OHOA 4HM6B 1OHSA 1KWIA 5BXQA 3CCS3 1VQM3 2OTJ3 1UUVB 4L8PA 3FKAA 4HYZA 4XBYA 1ROAA 1ASKA 3NBJA 1GD3A 1NWWA 3SEDA 1YIT3 1US1A 1WMNA 1NB5I 3CU3A 3L0RA 4HKVB 2P0XA 3MHEA 1FGTA 4N6MA 2Z76A 1AV4A 4MEIA 3G0KA 4G1MB 4HZ9B 4HM0B 3EX9A 4FCZA 1E3VA 3PXMA 2BMRB 3I553 2CFGA 2KXGA 8CHOA 3S28A 3JUQA 1DMMA 3LT8A 1BUQA 3DXOA 1IVVA 4EV5A 1KSIA 1W4NA 2RCDA 1SIIA 3GZYB 1CQSA 2XGNA 2XRXB 3LMLA 3CC23 1GY5A 5FGOA 1KC84 2O3OA 3F7SA 4WYKA 4N6OB 2PNCA 3KE7A 2QEX3 2F98A 4WYKB 1YVBI 1A2VA 1JKGA 1ULIB 2CFDA 3FG4A 4N6LA 1QAFA 2W2CA 3VSYA 4EXRA 4QWTA 1SIHA 4O02B 4HM1B 1TFKA 4KVHA 2YFJB 1STDA 2XSHB 2O9UX 3CXC2 2OCTA 4HM8B 5DRVA 3LOYA 3OWSA 3GWRA 3S5CA 3EB8A 3N9HA 1VQL3 3EJVA 2V1LA 2WOFA 1N9JA 3G4S3 1RRLA 1O7WB 2CKFB 4ZM8A 1K734 2CFLA 1IVUA 3MWZA 1GYBA 2CWUA 4K90B 5AIHA 1M9GA 1W02A 2R4IA 4TX4A 1CYVA 5IG3A 1Q824 2Q07A 3BLZA 4HM3B 1KQS2 3ER7A 4Q53A 1W6YA 4NHFA 3HIGA 2GBWB 1YJN3 2ZDJA 2HMLB 3I563 1AVLA 5EVHA 3E99A 3X40A 2CWTA 3JUMA 3Q2PA 4BTYA 5JPPA 2W9PA 2XH9A 5KP3A 4RZMA 2OOVA 2INXA 1EG9B 2HMNB 2QIYA 1NB3I 3PCSA 3WDGB 1J2BA 1JB4A 2P09A 3F7XA 3MSOA 3KFQC 4R1KA 2BO9B 3PS8A 3LYGA 3WMDA 3F8HA 1WTHA 1IDPA 3STDA 4HM4B 4XB5A 2QA43 1RJOA 2SBLA 5AEWB 3WA3A 4N6UA 1AR0A 3X3XA 1A90A 3DM8A 2XR8B 3KSED 1O7PB 3CC73 4OK0A 3B8LA 3EE1A 1EA2A 1GY6A 4MMXB 2Y74A 4JF8A 2BT3A 1NU3A 1NDOB 4J9AA 1AVKA 3DZLA 1NJI4 3AMOB 3Q90A 5JPUA 1E97A 1R4CA 2LYXA 1QVF2 4WP5A 2JDIH 1OGZA 1DMQA 2ML5A 2CG0A 4JRFA 2CFWA 3EN1B 5IENA 1VQ73 4XDVA 3NUVA 4EBGA 3CNMA 1JJ22 3JVCA 2CHCA 5IERA 4AKZA 2UX0A 1YIJ3 3KN4A 3JUOA 5IG0A 3NX0A 1VZZA 3D9RA 4EC6A 3U1WA 4STDA 3K9MC 2JQ5A 1LXEA 1O7NB 1VQN3 1TFOA 3FG3A 1PFPA 2GU3A 3LTDA 4XM4A 2RGQA 1RRHA 2W56B 3ALAA 3V98A 1O7MB 4K1UA 4X2OA 3LTBA 2KRTA 4CCVA 4KFEA 3CCM3 3GZRA 3SOAA 1WNHA 3BNCA 4FMBA 4HM2B 3T0UA 1VQ83 1T5YA 3DGOA 2E2VA 2MF7A 1LNHA 4N6NB 7STDA 2B1XB 2CC3A 4NREA 3EQQB 2BHMA 2Y73A 2YFIB 3VF1A 1JV2B 3EN8A 1E3RA 3FG1A 3MG3A 3RGRA 1N5PA 3DUKA 3X3ZA 5CK6A 1Q7Y4 1WMPA 5IEOA 3S27A 2K0MA 4O8SA 2CK3H 1Z1SA 3DY5A 5CF1A 1D6YA 2C11A 5EQLA 6STDA 5G2GA 3S67A 1YI23 4FCJA 5ELUA 1OHPA 5FW5A 1VQ43 2ZL8A 1ISKA 5IG4A 1TP6A 3K5TA 3NM7A 3JUPA 1HKXA 4O2HA 1MNLA 2GEYA 3NQYA 2XFSA 2BMOB 3BNBA 1RKYA 4IIAA 1GD4A 3TDGA 1SQWA 3FH1A 3FCSB 4CDLA 2Z77A 1IU7A 3PYJA 3CCL3 1DVDA 1ZO2A 3KIIA 1ZX2A 4L7KA 3WA2X 1FGMA 3HX8A 2CW9A 1YJW3 1OF5B 2WOHA 1O7GB 3FF0A 2PZVA 3EC9A 3N54B 4OVMA 2CWVA 1OUNA 3HK4A 1FA3A 3EF8A 1W6CA 1L5GB 2D42A 1W7CA 2HMMB 2K54A 4J8TA 4MMZB 4PEJA 1YHQ3 1FGRA 5AYRB 2IUKA 3RGAA 4XBXA 5AYSC 2FNQA 4LMIA 1W2B2 3SLUA 2L4VA 3WODG 3CCV3 1IK3A 2HMKB 4HM5B 4WFOA 1N5HA 1TU5A 3RDEA 1D6UA 1JRQA 3F9SA 4XDWA 4U13A 3OX9A 1HU9A 1W2ZA 4X2HA 3F8XA 1JNQA 4HVNA 1W6GA 2XF3A 1QJGA 1UW1A 1M1K4 1QALA 1A2KA 1EKMA 2W9QA 1JB2A 2BNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0R A;  4N6M A;  5ELJ A;  1A67 A;  3PXM A;  2KXG A;  3NX0 A;  3K9M C;  1LXE A;  1PFP A;  1CEW I;  4N6T A;  1IV7 A;  2CH9 A;  4N6O B;  4CCV A;  5LC6 A;  1YVB I;  1WNH A;  3UL6 A;  4N6L A;  4N6N B;  1RN7 A;  5A0O B;  3GAX A;  2O9U X;  3QRD A;  1IV9 A;  1N5P A;  2OCT A;  1N9J A;  4ZM8 A;  5EQL A;  3S67 A;  5ELU A;  3MWZ A;  1M9G A;  4TX4 A;  1CYV A;  1MNL A;  3UL5 A;  1GD4 A;  1STF I;  1EQK A;  3PYJ A;  1DVD A;  3IMA B;  4N6V 0;  1FUW A;  3Q2P A;  2W9P A;  1MOL A;  4EYC A;  5LC7 A;  1NB3 I;  1CYU A;  4LZI A;  3KFQ C;  1TIJ A;  3SVA A;  2BO9 B;  3PS8 A;  1FA3 A;  1DVC A;  4N6U A;  1A90 A;  3KSE D;  4IT7 A;  1KWI A;  1N5H A;  3LH4 A;  1R4C A;  1G96 A;  1ROA A;  1GD3 A;  2W9Q A;  1NB5 I; 
#chains in the Genus database with same CATH topology
 1SPU A;  1RMS A;  2GXF A;  3H3H A;  4HJL B;  4K61 A;  4KFF A;  4R9L A;  1LVN A;  2OQE C;  1UUW B;  4FMC A;  3B7C A;  2P05 A;  5ELJ A;  1A67 A;  2STD A;  3SX1 A;  1VQO 3;  3GSP A;  2FGT A;  2F99 A;  2OWP A;  3EHC A;  3IPT A;  5AII A;  1JZO A;  3WR2 A;  1O7H B;  3PGB A;  5D83 A;  3AMO A;  1B3S A;  2F86 B;  1BRH A;  3NBR A;  1WMO A;  1LOX A;  3CCQ 3;  1CEW I;  2C10 A;  6RNT A;  5KP4 A;  2FXT A;  4N6T A;  1M90 4;  1IV7 A;  3UJM A;  1F8N A;  1NO3 A;  2H0I A;  2CH9 A;  3CNX A;  3NV0 B;  1RGK A;  5LC6 A;  4LGQ A;  3X41 A;  2BU4 A;  3N8B A;  2F4Y A;  1VQ9 3;  3LTA A;  1RN7 A;  3OWY A;  3D4A A;  2KF3 A;  1Q7H A;  1OCV A;  3EBY A;  3LTC A;  1ULJ B;  1BSE A;  3ECF A;  1OPY A;  3K7C A;  3QRD A;  2XEP A;  1YGW A;  1LQG C;  3NQZ A;  4I5Q A;  5M1A A;  1RGC A;  3U97 A;  3WOE B;  1BNI A;  4H3U A;  4K1V A;  1Q40 B;  2A15 A;  3AGO A;  5IW9 A;  2W56 A;  4J5K A;  3H51 A;  3V99 A;  1KD1 4;  2BMQ B;  1FGQ A;  2XFT A;  2KF5 A;  3OXA A;  1TUH A;  1T3B A;  2CG1 A;  3X3Y A;  1A2P A;  1VQ6 3;  1RTU A;  3KKG A;  2W6J H;  3LXU X;  4CJN A;  1FUS A;  2XGL A;  4I4K A;  7RNT A;  1MWR A;  2Z7A A;  5IEP A;  4HM7 B;  4OUQ A;  1BRI A;  1SJW A;  4RBN A;  3CMA 3;  2ZHX B;  4KFD A;  2RSX A;  2Z6B A;  5TGN A;  3Q1C A;  1VQ5 3;  2W04 A;  1Y4K A;  3MG1 A;  3BU4 A;  3T8N A;  1T2H A;  5G1L A;  2HMO B;  5AIG A;  4FR9 A;  5I97 A;  1B2U A;  1UI8 A;  1RCK A;  1N9E A;  1STF I;  2M7O A;  1EQK A;  2H0H A;  5D82 A;  2E2T A;  5G1K A;  3ZG5 A;  4R80 A;  3G71 3;  2HOH A;  1MOL A;  1D6Z A;  4EYC A;  2W03 A;  1IQY A;  3UNL A;  4HBR A;  3K0Z A;  1N8Q A;  1YVS A;  4MJD A;  3X42 A;  1CYU A;  1HYF A;  1QAK A;  4IPB A;  4KZ1 A;  5CF2 A;  3SYU A;  1Q42 A;  1K9M 4;  2F56 A;  4L8O A;  3AGN A;  3MYT A;  4LSO A;  1LOW A;  4N3V A;  3B4P A;  1FYS A;  3PZW A;  4GL6 A;  5STD A;  3URP A;  1OAC A;  1U5O A;  4RNY A;  1DVC A;  1W5Z A;  3M8C A;  2YX9 A;  3HOH A;  4GHO A;  5HOH A;  3D5I A;  3MG2 A;  3A76 A;  3WHO A;  1RSN A;  3CCR 3;  1S72 3;  3CC4 3;  3EBT A;  3FF2 A;  8RNT A;  4LYL B;  2R41 A;  4IT7 A;  1LQM B;  3HII A;  1IT8 A;  3I0Y A;  3LZA A;  1W00 A;  4GB5 A;  2IY2 A;  4R4K A;  4AEQ A;  3LH4 A;  4EV2 A;  3T8U A;  3OV4 A;  2GU1 A;  1X1Y A;  1OF5 A;  2ZA4 A;  4ORL A;  1G96 A;  1IT7 A;  7GSP A;  1K41 A;  2F5W A;  4LEH A;  3KCH A;  1Q9E A;  1LOV A;  4BTW A;  1BSB A;  3KZT A;  3SXX A;  1UI7 A;  3FGY A;  3J7Y d;  1N8R 4;  1BNR A;  1I3F A;  1I70 A;  2IA7 A;  3MPH A;  3FSD A;  2QGU A;  1TTO A;  2WGO A;  1Q81 4;  3Q3F A;  1JKG B;  1IQ8 A;  2P0M A;  3PCR A;  3OW2 2;  3GZB A;  3BND A;  2GEX A;  4H61 A;  3RNT A;  3JUN A;  2KCD A;  5CXO A;  2P38 A;  3HZP A;  1K28 A;  4O3V A;  3NM2 A;  5KP1 A;  3DGL A;  1QVG 2;  3MKI A;  3UB1 A;  2XSO B;  1I0X A;  1V74 A;  1FGO A;  1T2I A;  3CD6 3;  1S5A A;  2RFR A;  1BOX A;  3HI7 A;  2CIU A;  5AIF A;  2MC8 A;  1RLS A;  1BAO A;  1YGE A;  3DGY A;  3F14 A;  4WWU C;  1ROV A;  3G6E 3;  3GRD A;  1OGX A;  1B2Z A;  3A5E A;  1YJ9 3;  2I9W A;  1W01 A;  1GS3 A;  3F40 A;  3UL6 A;  1PU4 A;  1TRP A;  2LQV A;  4GSP A;  1GY7 A;  1U8C B;  3GZX B;  5A0O B;  1BVI A;  3NHX A;  3FLJ A;  1K8A 4;  3ROB A;  3DGM A;  3GAX A;  1BRG A;  1IVX A;  2OOV C;  3FZW A;  4RNZ A;  2CFK A;  2IUJ A;  1BNE A;  5AEU B;  1IV9 A;  3D3L A;  5DRE A;  2ML6 A;  2W0Q A;  3CME 3;  2OQE A;  3DGN A;  2D1W A;  3O8Y A;  1OH0 A;  1TJD A;  3IJE B;  4HZB B;  3WOF B;  1MWS A;  3B4O A;  4XBT A;  3NV0 A;  2OTL 3;  1IQX A;  4BTX A;  5CLK A;  3OWU A;  5M18 A;  3BB9 A;  3CCJ 3;  1Q86 4;  1BRJ A;  2E2U A;  4FMA A;  1JN5 A;  1DE3 A;  1M1X B;  1LRA A;  2WGQ A;  1WQL B;  1RGE A;  2CX1 A;  1JN5 B;  1DMN A;  3UL5 A;  5D81 A;  4R9K A;  3LT9 A;  5AI1 A;  4FMD A;  5JBS A;  3VGN A;  4MMY B;  4DKI A;  1Q40 A;  2HMJ B;  4WHA A;  4BL2 A;  3CCE 3;  3AHS A;  2IYJ A;  3BNE A;  3IMA B;  1VQK 3;  4N6V 0;  1FUW A;  3NXJ A;  1RCL A;  1AY7 A;  2SAR A;  3CPO A;  3SOY A;  5LC7 A;  3NBB A;  1DYU A;  5HGR A;  5BVB A;  3S29 A;  1I8V A;  3QK9 A;  3CPW 2;  1GOY A;  5IG5 A;  1IYY A;  3G16 A;  4LZI A;  5EEO A;  1TIJ A;  4AKY A;  3SVA A;  1IVW A;  2GBX B;  4KT3 B;  2IMJ A;  3D5G A;  1RGH A;  1QMA A;  1BU4 A;  1MGW A;  4FCM A;  3V92 A;  2WO0 A;  3DMC A;  1VQP 3;  2YFL B;  3K63 A;  1EUI C;  3KSP A;  5GSP A;  3CCU 3;  1C7H A;  1UCK A;  5IF6 A;  1PY3 A;  2B24 B;  3G8Z A;  1JB5 A;  1OHO A;  4HM6 B;  1OHS A;  1KWI A;  5BXQ A;  4J5G A;  3CCS 3;  1VQM 3;  2OTJ 3;  1UUV B;  4L8P A;  1GMQ A;  1EEJ A;  3FKA A;  2AAE A;  4HYZ A;  4XBY A;  1RN4 A;  1ASK A;  1ROA A;  3NBJ A;  1GD3 A;  1NWW A;  5BU4 A;  3SED A;  1BNG A;  1US1 A;  1YIT 3;  1WMN A;  1NB5 I;  3CU3 A;  3L0R A;  4HKV B;  2P0X A;  3MHE A;  1FGT A;  3D79 A;  2Z76 A;  4N6M A;  1AV4 A;  4MEI A;  3G0K A;  4G1M B;  4HZ9 B;  4HM0 B;  3EX9 A;  4FCZ A;  1ZGX A;  1E3V A;  3PXM A;  2BMR B;  3ZFZ A;  3I55 3;  2CFG A;  1BSD A;  2KXG A;  8CHO A;  3S28 A;  1X1U A;  3DH2 A;  1DMM A;  3JUQ A;  3LT8 A;  1RGG A;  6GSP A;  1BUQ A;  3DXO A;  1IVV A;  4EV5 A;  1KSI A;  4CPK A;  1MWU A;  1W4N A;  2RBI A;  2RCD A;  1SII A;  2UGI A;  1BRK A;  1GSP A;  1CQS A;  2XGN A;  2XRX B;  3GZY B;  3LML A;  3CC2 3;  1GY5 A;  5FGO A;  1KC8 4;  2O3O A;  3F7S A;  4WYK A;  1PYL A;  2AAD A;  4N6O B;  2PNC A;  3KE7 A;  1UCL A;  2QEX 3;  2F98 A;  4WYK B;  1YVB I;  1X1W A;  1A2V A;  1JKG A;  1TRQ A;  1ULI B;  2CFD A;  3FG4 A;  1QAF A;  2W2C A;  4N6L A;  3VSY A;  4QWT A;  4EXR A;  1SIH A;  4O02 B;  4HM1 B;  1TFK A;  1BAN A;  4KVH A;  2YFJ B;  3ZG0 A;  1STD A;  2XSH B;  2O9U X;  1UUG B;  1SAR A;  1RNB A;  3CXC 2;  2OCT A;  4HM8 B;  1BSC A;  1BIR A;  5DRV A;  3LOY A;  3OWS A;  3GWR A;  3S5C A;  3EB8 A;  3N9H A;  1VQL 3;  3EJV A;  2V1L A;  2WOF A;  1N9J A;  1B2S A;  2J8X B;  1B20 A;  3G4S 3;  1RRL A;  1O7W B;  2CKF B;  4ZM8 A;  1K73 4;  2CFL A;  1IVU A;  3MWZ A;  1GYB A;  2CWU A;  4K90 B;  5AIH A;  1M9G A;  3BIR A;  4HOH A;  1W02 A;  2R4I A;  4TX4 A;  1CYV A;  1B27 A;  5IG3 A;  1Q82 4;  4RNT A;  2Q07 A;  4NPB A;  3BLZ A;  4HM3 B;  1RGA A;  1KQS 2;  3ER7 A;  4Q53 A;  1W6Y A;  1VQQ A;  4NHF A;  3HIG A;  2GBW B;  1YJN 3;  1FUT A;  2ZDJ A;  2HML B;  3I56 3;  1AVL A;  5EVH A;  3E99 A;  3X40 A;  2CWT A;  1GMP A;  3JUM A;  3Q2P A;  4BTY A;  5JPP A;  1NNV A;  2W9P A;  2XH9 A;  5KP3 A;  1ZS7 A;  4RZM A;  2H0G A;  2OOV A;  2INX A;  1EG9 B;  2HMN B;  2QIY A;  1NB3 I;  3PCS A;  3WDG B;  1J2B A;  1JB4 A;  2P09 A;  3F7X A;  1B21 A;  3MSO A;  1AQZ A;  3KFQ C;  4R1K A;  2BO9 B;  3PS8 A;  3LYG A;  3WMD A;  3F8H A;  1WTH A;  1IDP A;  3STD A;  4HM4 B;  1RNT A;  1B2X A;  4XB5 A;  1FW7 A;  2QA4 3;  1RJO A;  2RNT A;  2SBL A;  5AEW B;  4N6U A;  1AR0 A;  1BNS A;  3X3X A;  3WA3 A;  1A90 A;  1BSA A;  3DM8 A;  2XR8 B;  3KSE D;  1O7P B;  3CC7 3;  4OK0 A;  3B8L A;  3EE1 A;  2KF6 A;  1DET A;  1EA2 A;  1GY6 A;  4MMX B;  2Y74 A;  4JF8 A;  2BT3 A;  2F5M A;  1NU3 A;  1NDO B;  4J9A A;  1AVK A;  3DZL A;  1NJI 4;  3AMO B;  5BIR A;  3Q90 A;  5JPU A;  1E97 A;  1R4C A;  2LYX A;  1QVF 2;  4WP5 A;  2JDI H;  1OGZ A;  1DMQ A;  1I2F A;  2CG0 A;  2ML5 A;  4JRF A;  1X1X A;  2CFW A;  3EN1 B;  5IEN A;  1VQ7 3;  4XDV A;  1G0T A;  3NUV A;  2K3D A;  4EBG A;  1I2E A;  3CNM A;  1JJ2 2;  2BIR A;  3JVC A;  2CHC A;  1LNI A;  5IER A;  4AKZ A;  1JBS A;  1RGF A;  2UX0 A;  1YIJ 3;  3KN4 A;  3JUO A;  5IG0 A;  3NX0 A;  1MGR A;  1VZZ A;  2GSP A;  3D9R A;  3U1W A;  4EC6 A;  1MWT A;  2UUG C;  1BGS A;  4STD A;  3K9M C;  2JQ5 A;  1GOU A;  1LXE A;  1O7N B;  1VQN 3;  1TFO A;  1UDI I;  3FG3 A;  1PFP A;  2GU3 A;  3LTD A;  4XM4 A;  1G02 A;  2RGQ A;  1RRH A;  2C4B A;  1BUJ A;  2W56 B;  3ALA A;  3V98 A;  1O7M B;  4HAA A;  1BRN L;  4K1U A;  1I3I A;  4X2O A;  1CH0 A;  2L1S A;  3LTB A;  4EW5 A;  2KRT A;  4CCV A;  2CX0 A;  4KFE A;  3CCM 3;  3GZR A;  3SOA A;  1WNH A;  3BNC A;  4FMB A;  4HM2 B;  3T0U A;  1VQ8 3;  1T5Y A;  3DGO A;  2E2V A;  2MF7 A;  1LNH A;  4N6N B;  4BU4 A;  7STD A;  2B1X B;  2CC3 A;  4NRE A;  3EQQ B;  5M19 A;  5RNT A;  2BHM A;  2Y73 A;  2YFI B;  3VF1 A;  1JV2 B;  3EN8 A;  1BNF A;  1E3R A;  3FG1 A;  3MG3 A;  3RGR A;  1N5P A;  4BL3 A;  3DUK A;  1YNV X;  2KAA A;  5CK6 A;  3X3Z A;  1WMP A;  1Q7Y 4;  1C54 A;  1I2G A;  4BIR A;  1UCJ A;  5IEO A;  3S27 A;  1R4Y A;  2K0M A;  1V57 A;  4O8S A;  1RGL A;  2CK3 H;  1Z1S A;  3DY5 A;  5CF1 A;  1D6Y A;  2C11 A;  5EQL A;  6STD A;  5G2G A;  1UGI A;  3S67 A;  1YI2 3;  4FCJ A;  5ELU A;  1OHP A;  5FW5 A;  1LOY A;  1VQ4 3;  2ZL8 A;  1ISK A;  5IG4 A;  1TP6 A;  1I0V A;  3K5T A;  3NM7 A;  3JUP A;  1HKX A;  1RHL A;  1MNL A;  4O2H A;  1B2M A;  2GEY A;  3NQY A;  2XFS A;  1GOV A;  2BMO B;  3BNB A;  1UGH I;  1RKY A;  1RDS A;  1GD4 A;  1RN1 A;  4IIA A;  1SQW A;  3FH1 A;  3FCS B;  3TDG A;  4CDL A;  2Z77 A;  1IU7 A;  3PYJ A;  3CCL 3;  1DVD A;  1V58 A;  1ZO2 A;  3KII A;  1ZX2 A;  4L7K A;  3WA2 X;  1FGM A;  3HX8 A;  2CW9 A;  1YJW 3;  1HZ1 A;  1OF5 B;  2WOH A;  1O7G B;  9RNT A;  1UCI A;  3FF0 A;  2PZV A;  3EC9 A;  3N54 B;  4OVM A;  2CWV A;  1OUN A;  3HK4 A;  1FA3 A;  3EF8 A;  1W6C A;  1L5G B;  2D42 A;  1W7C A;  2HMM B;  1BNJ A;  2K54 A;  4J8T A;  3AHW A;  4MMZ B;  4PEJ A;  1YHQ 3;  1FGR A;  5AYR B;  2IUK A;  1GMR A;  4XBX A;  3RGA A;  5AYS C;  2FNQ A;  4LMI A;  1JBR A;  1FZU A;  3SLU A;  2L4V A;  3WOD G;  3CCV 3;  1W2B 2;  1BRS A;  1IK3 A;  2HMK B;  4HM5 B;  4WFO A;  1N5H A;  1TU5 A;  3RDE A;  1D6U A;  1JRQ A;  3F9S A;  4XDW A;  4U13 A;  3OX9 A;  1HU9 A;  1W2Z A;  4X2H A;  3F8X A;  1JNQ A;  4HVN A;  1W6G A;  1JZD A;  2XF3 A;  1QJG A;  2KF4 A;  1UW1 A;  1M1K 4;  4ILF A;  1QAL A;  1A2K A;  1EKM A;  1JBT A;  2W9Q A;  1JB2 A;  2BNG A; 
#chains in the Genus database with same CATH homology
 1SPU A;  4K61 A;  2GXF A;  3H3H A;  4HJL B;  4KFF A;  4R9L A;  1LVN A;  2OQE C;  1UUW B;  4FMC A;  3B7C A;  2P05 A;  5ELJ A;  1A67 A;  2STD A;  3SX1 A;  1VQO 3;  2FGT A;  2F99 A;  2OWP A;  3EHC A;  3IPT A;  5AII A;  1O7H B;  3PGB A;  5D83 A;  3AMO A;  2F86 B;  3NBR A;  1LOX A;  1WMO A;  3CCQ 3;  1CEW I;  2C10 A;  5KP4 A;  2FXT A;  4N6T A;  1M90 4;  1IV7 A;  3UJM A;  1F8N A;  1NO3 A;  2CH9 A;  3CNX A;  3NV0 B;  5LC6 A;  4LGQ A;  3X41 A;  3N8B A;  1VQ9 3;  3LTA A;  1RN7 A;  3OWY A;  1OCV A;  3EBY A;  3LTC A;  1ULJ B;  3ECF A;  1OPY A;  3K7C A;  3QRD A;  2XEP A;  3NQZ A;  3U97 A;  3WOE B;  4H3U A;  4K1V A;  1Q40 B;  2A15 A;  5IW9 A;  2W56 A;  3H51 A;  3V99 A;  1KD1 4;  2BMQ B;  1FGQ A;  2XFT A;  3OXA A;  1TUH A;  2CG1 A;  3X3Y A;  1VQ6 3;  3KKG A;  2W6J H;  3LXU X;  4I4K A;  2XGL A;  2Z7A A;  5IEP A;  4HM7 B;  4OUQ A;  3CMA 3;  1SJW A;  4RBN A;  4KFD A;  2RSX A;  2Z6B A;  5TGN A;  3Q1C A;  1VQ5 3;  2W04 A;  1Y4K A;  3MG1 A;  3T8N A;  2HMO B;  5AIG A;  4FR9 A;  5I97 A;  1UI8 A;  1N9E A;  1STF I;  2M7O A;  1EQK A;  5D82 A;  2E2T A;  3G71 3;  4R80 A;  1MOL A;  1D6Z A;  4EYC A;  2W03 A;  1IQY A;  3UNL A;  4HBR A;  3K0Z A;  1N8Q A;  1CYU A;  4MJD A;  3X42 A;  1QAK A;  5CF2 A;  4IPB A;  4KZ1 A;  1Q42 A;  1K9M 4;  4L8O A;  3MYT A;  4LSO A;  4N3V A;  3B4P A;  4GL6 A;  3PZW A;  5STD A;  1OAC A;  1U5O A;  4RNY A;  1DVC A;  1W5Z A;  3M8C A;  2YX9 A;  3MG2 A;  3A76 A;  3CCR 3;  1S72 3;  3CC4 3;  3EBT A;  3FF2 A;  4IT7 A;  3I0Y A;  3HII A;  1IT8 A;  3LZA A;  1W00 A;  4GB5 A;  4R4K A;  4AEQ A;  4EV2 A;  3LH4 A;  3T8U A;  3OV4 A;  2GU1 A;  1OF5 A;  4ORL A;  1G96 A;  1IT7 A;  1K41 A;  4LEH A;  4BTW A;  3KZT A;  3SXX A;  1UI7 A;  3FGY A;  3J7Y d;  1N8R 4;  2IA7 A;  3MPH A;  3FSD A;  2QGU A;  2WGO A;  1Q81 4;  3OW2 2;  1JKG B;  1IQ8 A;  2P0M A;  3PCR A;  3GZB A;  3BND A;  2GEX A;  4H61 A;  3JUN A;  2KCD A;  5CXO A;  2P38 A;  3HZP A;  1K28 A;  4O3V A;  3NM2 A;  5KP1 A;  3DGL A;  1QVG 2;  3MKI A;  3UB1 A;  2XSO B;  1V74 A;  1FGO A;  3CD6 3;  1S5A A;  2RFR A;  3HI7 A;  2MC8 A;  2CIU A;  5AIF A;  1YGE A;  3F14 A;  4WWU C;  1ROV A;  3G6E 3;  3GRD A;  1OGX A;  1YJ9 3;  2I9W A;  1W01 A;  1GS3 A;  3F40 A;  3UL6 A;  1PU4 A;  2LQV A;  1GY7 A;  1U8C B;  3GZX B;  5A0O B;  3NHX A;  1K8A 4;  3FLJ A;  3ROB A;  3DGM A;  3GAX A;  1IVX A;  2OOV C;  3FZW A;  4RNZ A;  2CFK A;  2IUJ A;  5AEU B;  1IV9 A;  3D3L A;  5DRE A;  2ML6 A;  2W0Q A;  3CME 3;  2OQE A;  3DGN A;  2D1W A;  3O8Y A;  1OH0 A;  3IJE B;  4HZB B;  3WOF B;  3B4O A;  4XBT A;  3NV0 A;  2OTL 3;  1IQX A;  4BTX A;  5CLK A;  3OWU A;  3BB9 A;  3CCJ 3;  1Q86 4;  4FMA A;  2E2U A;  1JN5 A;  1M1X B;  2WGQ A;  1WQL B;  1JN5 B;  1DMN A;  3UL5 A;  5D81 A;  4R9K A;  3LT9 A;  5AI1 A;  4FMD A;  5JBS A;  3VGN A;  4MMY B;  1Q40 A;  2HMJ B;  4WHA A;  3CCE 3;  3BNE A;  3IMA B;  1VQK 3;  4N6V 0;  1FUW A;  3NXJ A;  3CPO A;  3SOY A;  5LC7 A;  3NBB A;  1DYU A;  5HGR A;  5BVB A;  3S29 A;  3QK9 A;  3CPW 2;  5IG5 A;  3G16 A;  4LZI A;  5EEO A;  1TIJ A;  4AKY A;  3SVA A;  1IVW A;  2GBX B;  2IMJ A;  1QMA A;  4FCM A;  3V92 A;  2WO0 A;  3DMC A;  1VQP 3;  2YFL B;  3K63 A;  3KSP A;  3CCU 3;  1C7H A;  5IF6 A;  2B24 B;  3G8Z A;  1JB5 A;  1OHO A;  4HM6 B;  1OHS A;  1KWI A;  5BXQ A;  3CCS 3;  1VQM 3;  2OTJ 3;  1UUV B;  4L8P A;  3FKA A;  4HYZ A;  4XBY A;  1ROA A;  1ASK A;  3NBJ A;  1GD3 A;  1NWW A;  3SED A;  1YIT 3;  1US1 A;  1WMN A;  1NB5 I;  3CU3 A;  3L0R A;  4HKV B;  2P0X A;  3MHE A;  1FGT A;  4N6M A;  2Z76 A;  1AV4 A;  4MEI A;  3G0K A;  4G1M B;  4HZ9 B;  4HM0 B;  3EX9 A;  4FCZ A;  1E3V A;  3PXM A;  2BMR B;  3I55 3;  2CFG A;  2KXG A;  8CHO A;  3S28 A;  3JUQ A;  1DMM A;  3LT8 A;  1BUQ A;  3DXO A;  1IVV A;  4EV5 A;  1KSI A;  1W4N A;  2RCD A;  1SII A;  3GZY B;  1CQS A;  2XGN A;  2XRX B;  3LML A;  3CC2 3;  1GY5 A;  5FGO A;  1KC8 4;  2O3O A;  3F7S A;  4WYK A;  4N6O B;  2PNC A;  3KE7 A;  2QEX 3;  2F98 A;  4WYK B;  1YVB I;  1A2V A;  1JKG A;  1ULI B;  2CFD A;  3FG4 A;  4N6L A;  1QAF A;  2W2C A;  3VSY A;  4EXR A;  4QWT A;  1SIH A;  4O02 B;  4HM1 B;  1TFK A;  4KVH A;  2YFJ B;  1STD A;  2XSH B;  2O9U X;  3CXC 2;  2OCT A;  4HM8 B;  5DRV A;  3LOY A;  3OWS A;  3GWR A;  3S5C A;  3EB8 A;  3N9H A;  1VQL 3;  3EJV A;  2V1L A;  2WOF A;  1N9J A;  3G4S 3;  1RRL A;  1O7W B;  2CKF B;  4ZM8 A;  1K73 4;  2CFL A;  1IVU A;  3MWZ A;  1GYB A;  2CWU A;  4K90 B;  5AIH A;  1M9G A;  1W02 A;  2R4I A;  4TX4 A;  1CYV A;  5IG3 A;  1Q82 4;  2Q07 A;  3BLZ A;  4HM3 B;  1KQS 2;  3ER7 A;  4Q53 A;  1W6Y A;  4NHF A;  3HIG A;  2GBW B;  1YJN 3;  2ZDJ A;  2HML B;  3I56 3;  1AVL A;  5EVH A;  3E99 A;  3X40 A;  2CWT A;  3JUM A;  3Q2P A;  4BTY A;  5JPP A;  2W9P A;  2XH9 A;  5KP3 A;  4RZM A;  2OOV A;  2INX A;  1EG9 B;  2HMN B;  2QIY A;  1NB3 I;  3PCS A;  3WDG B;  1J2B A;  1JB4 A;  2P09 A;  3F7X A;  3MSO A;  3KFQ C;  4R1K A;  2BO9 B;  3PS8 A;  3LYG A;  3WMD A;  3F8H A;  1WTH A;  1IDP A;  3STD A;  4HM4 B;  4XB5 A;  2QA4 3;  1RJO A;  2SBL A;  5AEW B;  3WA3 A;  4N6U A;  1AR0 A;  3X3X A;  1A90 A;  3DM8 A;  2XR8 B;  3KSE D;  1O7P B;  3CC7 3;  4OK0 A;  3B8L A;  3EE1 A;  1EA2 A;  1GY6 A;  4MMX B;  2Y74 A;  4JF8 A;  2BT3 A;  1NU3 A;  1NDO B;  4J9A A;  1AVK A;  3DZL A;  1NJI 4;  3AMO B;  3Q90 A;  5JPU A;  1E97 A;  1R4C A;  2LYX A;  1QVF 2;  4WP5 A;  2JDI H;  1OGZ A;  1DMQ A;  2ML5 A;  2CG0 A;  4JRF A;  2CFW A;  3EN1 B;  5IEN A;  1VQ7 3;  4XDV A;  3NUV A;  4EBG A;  3CNM A;  1JJ2 2;  3JVC A;  2CHC A;  5IER A;  4AKZ A;  2UX0 A;  1YIJ 3;  3KN4 A;  3JUO A;  5IG0 A;  3NX0 A;  1VZZ A;  3D9R A;  4EC6 A;  3U1W A;  4STD A;  3K9M C;  2JQ5 A;  1LXE A;  1O7N B;  1VQN 3;  1TFO A;  3FG3 A;  1PFP A;  2GU3 A;  3LTD A;  4XM4 A;  2RGQ A;  1RRH A;  2W56 B;  3ALA A;  3V98 A;  1O7M B;  4K1U A;  4X2O A;  3LTB A;  2KRT A;  4CCV A;  4KFE A;  3CCM 3;  3GZR A;  3SOA A;  1WNH A;  3BNC A;  4FMB A;  4HM2 B;  3T0U A;  1VQ8 3;  1T5Y A;  3DGO A;  2E2V A;  2MF7 A;  1LNH A;  4N6N B;  7STD A;  2B1X B;  2CC3 A;  4NRE A;  3EQQ B;  2BHM A;  2Y73 A;  2YFI B;  3VF1 A;  1JV2 B;  3EN8 A;  1E3R A;  3FG1 A;  3MG3 A;  3RGR A;  1N5P A;  3DUK A;  3X3Z A;  5CK6 A;  1Q7Y 4;  1WMP A;  5IEO A;  3S27 A;  2K0M A;  4O8S A;  2CK3 H;  1Z1S A;  3DY5 A;  5CF1 A;  1D6Y A;  2C11 A;  5EQL A;  6STD A;  5G2G A;  3S67 A;  1YI2 3;  4FCJ A;  5ELU A;  1OHP A;  5FW5 A;  1VQ4 3;  2ZL8 A;  1ISK A;  5IG4 A;  1TP6 A;  3K5T A;  3NM7 A;  3JUP A;  1HKX A;  4O2H A;  1MNL A;  2GEY A;  3NQY A;  2XFS A;  2BMO B;  3BNB A;  1RKY A;  4IIA A;  1GD4 A;  3TDG A;  1SQW A;  3FH1 A;  3FCS B;  4CDL A;  2Z77 A;  1IU7 A;  3PYJ A;  3CCL 3;  1DVD A;  1ZO2 A;  3KII A;  1ZX2 A;  4L7K A;  3WA2 X;  1FGM A;  3HX8 A;  2CW9 A;  1YJW 3;  1OF5 B;  2WOH A;  1O7G B;  3FF0 A;  2PZV A;  3EC9 A;  3N54 B;  4OVM A;  2CWV A;  1OUN A;  3HK4 A;  1FA3 A;  3EF8 A;  1W6C A;  1L5G B;  2D42 A;  1W7C A;  2HMM B;  2K54 A;  4J8T A;  4MMZ B;  4PEJ A;  1YHQ 3;  1FGR A;  5AYR B;  2IUK A;  3RGA A;  4XBX A;  5AYS C;  2FNQ A;  4LMI A;  1W2B 2;  3SLU A;  2L4V A;  3WOD G;  3CCV 3;  1IK3 A;  2HMK B;  4HM5 B;  4WFO A;  1N5H A;  1TU5 A;  3RDE A;  1D6U A;  1JRQ A;  3F9S A;  4XDW A;  4U13 A;  3OX9 A;  1HU9 A;  1W2Z A;  4X2H A;  3F8X A;  1JNQ A;  4HVN A;  1W6G A;  2XF3 A;  1QJG A;  1UW1 A;  1M1K 4;  1QAL A;  1A2K A;  1EKM A;  2W9Q A;  1JB2 A;  2BNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...