1A9NB

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
b'IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 25
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1a9nB00
3NNHA 3CCLS 4WFBQ 2CQHA 3CMAS 2A3JA 1S72S 1FJCA 5DDRC 2KI2A 2VODA 5GAEU 1JJHA 1L3KA 2RRBA 2KM8C 1XN9A 1X5TA 3BO3A 2MJUA 3TP2A 4P6QA 2DNGA 2M70A 1W2BR 5HO4A 1YIJS 2RQ4A 5DM6Q 3NNAA 2KT5A 2KU7A 3VF0B 1AUDA 1ZZNA 2KN4A 3CCUS 4W92B 1JJ4A 1UW4A 1FT8A 2LCWA 3D2WA 2SXLA 2CQ2A 4IUFA 2JRSA 3CMES 1Q82T 1D8ZA 4RU2A 2E5JA 1HA1A 2DGOA 3PIOQ 2AYEA 2CQCA 2G1DA 1QM9A 4F25A 2RVJA 2AYMA 2WBRA 2KXNB 2J76E 3J7ZT 1U1PA 1VQ4S 1WI6A 3CCES 3I56S 2F9JA 3HI9A 1WEXA 2I38A 2PE8A 1UFWA 2MQLA 2E5GA 4WFNQ 3LQVA 3MURP 3CUNA 1A9NB 1X4FA 1WTBA 1M5KC 2RS2A 1ZH5A 2GO9A 5EN1A 4WFAQ 1VC0A 3VAKA 2VOPA 3FEXB 1FO1A 2OTJS 2KFYA 3UCGA 2OIHA 2ADCA 2DNPA 2VOOA 2V94A 3SDEB 1X4DA 4TU9A 1H2TZ 2HGMA 1VBXA 1WF0A 2CQ4A 2FC9A 1VQ8S 1HD1A 4WF9Q 4YOEA 3IWNC 3RW7A 2LMIA 2D3OR 2MY7A 5GADU 2MQMA 2RRAA 2CQ0A 2DNNA 2CPIA 2DK2A 2CQ1A 4UQTA 5GAGU 2LA4A 3VAIA 5GMKa 2K3KA 3U1LA 1DBDA 5DDQC 3VAMA 2O3DA 2LEAA 2MZQA 3H2VE 3EX7B 1SJFA 2M88A 1SJ4P 4ZKAA 3PIPQ 5LSLA 2MMYA 2DB1A 3ULHA 1WHXA 3G8TA 1U2FA 3R1HA 4PRFA 2E44A 2KG1A 1OO0B 1K73T 3EGNA 4J5OA 2MGZA 3MI7X 3VAHA 4F02A 2YWKA 2UP1A 1S79A 2DGWA 4UY8T 1X0FA 2NZ4A 5CYJA 1OWXA 2EVZA 2DO4A 2DNRA 1X5SA 2MQQA 3G71S 1R8HA 2X1GA 1FNXH 1X4BA 3CCVS 2B0GA 2N3OA 3CULA 5CA5A 2MKKA 1VQOS 4TU7A 2XNQA 2DNLA 3P5TL 2DH8A 5FJ4A 2DGQA 5IM0B 3MXHP 4F26A 2MQNA 2MZJA 3L3CA 5JVHQ 2DNMA 3UE2A 2MB0B 5DDPC 2XS5A 3MUMP 2ZJQQ 2KG0A 2MKJA 1DHMA 2MKSA 1WHVA 1WG1A 2PEHA 2ADBA 2BOPA 1YWXA 2DIUA 1UP1A 5LJ3Y 5DM7Q 1U1NA 1URNA 2DHXA 1HL6A 2CJKA 1N8RT 4A8XA 5LJ5Y 2LA6A 1U1QA 2M2BA 2CQBA 2J0SD 1DRZA 2K8GA 4ED5A 1K9MT 5DDOC 2CPFA 2JX2A 2M0GB 3UD4P 3VAGA 2M9KA 2BZ2A 3CCQS 2CQ3A 3R27A 3CC7S 1KQSR 1VBZA 1U6FA 2CPYA 4CQ1A 4QQBA 1BY9A 2X1FA 1VQ5S 1OIAA 4FXVA 2LXIA 5IQQA 3MD1A 2FHOB 2KRRA 1VQPS 3Q2SC 2CQPA 1RKJA 3MUVP 1VQKS 3THPA 2DGXA 1QVFR 2JVRA 1SJQA 1D9AA 4LJMA 2RNEA 1YJNS 3BO2A 2DNKA 5LSOA 2DITA 2ERRA 1N54B 1Q81T 4IO9Q 2Q79A 4PKDB 4EGLA 4C4WA 1U1LA 2KVIA 2MYFA 1F9FA 2DGTA 2KYXA 2X1BA 4U67Q 2M4MA 1M5VC 1YJ9S 1YHQS 1NU4A 3US5A 2L41A 3S6EA 2X1AA 1Q86T 2LKZA 2XNRA 1M5OC 1M1KT 1JMTA 2JVOA 2DGVA 2QA4S 2DO0A 4LMZA 3CPWR 3P49B 1QVGR 2KM8B 1YTYA 1SJRA 1G2EA 3VAJA 1WEZA 4FXWA 1WWHA 1P27B 4TLQA 3SDEA 1DZ5A 1VQMS 2DIVA 1RK8A 2MKHA 2M7SA 1X4AA 1CVJA 2N3LA 5CXTA 3R1LA 1M5PC 2E5IA 3P3DA 2MQOA 3G96A 2AD9A 3K0JA 1Q7YT 1VQNS 4YUDA 1ZZFA 2LQ5A 3TO8A 2DGSA 2DH9A 4LIRA 2MHNA 2DNZA 1YJWS 1KOHA 3CF5Q 3SXLA 2CPHA 2QFJA 3VAFA 1N88A 2M8HA 2ZJRQ 3MD3A 2FY1A 3G9CA 5D77A 1WG5A 3EGZA 1NJIT 1X4EA 2YKAA 4IOAQ 1FJEB 2MSTA 4QPTA 5GVQA 3G8SA 1KC8T 4WIIA 4CIOA 2MSSA 2LEBA 3HHNB 3THTA 2M8DB 3S8SA 3IRWP 2VONA 2CPXA 1KD1T 3NNCA 1VQ6S 1U1KA 2LECA 3J7YU 2CPZA 2XS2A 1UAWA 4Y00A 3UWTA 2DNHA 2N82B 1OPIA 2HGNA 3BO4A 5IFMA 2F9DA 2MZSA 3TYTA 5MLCV 3FEYB 4V19X 2MJNA 2DHAA 1H6KX 1FXLA 2DHGA 4PR6A 4W90B 3UCUP 1WEYA 5DETA 5LXYA 1X5PA 1N52B 1X4HA 5H1SV 3S7RA 2XSFA 2YTCA 2DNYA 2MPUA 3CC2S 1H2VZ 5IM0A 3MUTP 2I2YA 3P6YC 2GHPA 2HGLA 5D78A 1U6BA 4TU8A 2LYVA 2RS8A 4QU7A 2RU3A 3MOJB 2XB2D 2U1AA 2RQCA 3CD6S 3MDFA 1SJ3P 3JB9k 2D9PA 2YH1A 1U1RA 1VQLS 1KOOA 3CCRS 4YB1P 2KH9A 2E5HA 3G4SS 2CQGA 1FHTA 1WF1A 1WHYA 1WI8A 1H2UX 2CPJA 1HD0A 3ZZZA 1R8PA 4C0OC 2MKIA 4QU6A 2MY8A 3BEGB 4OZ0A 2FC8A 2KXHA 4Z2XA 2L9WA 3RW6A 5BJRA 2XS7A 3CCSS 3OW2R 1WF2A 1WHWA 1WG4A 2KXFA 2RT3A 2MXYA 3CXCR 2RUGA 2AYGA 2U2FA 2N7CA 2HYIB 2CQIA 1X4GA 5JVGQ 2M52A 4C7QA 4WKRA 1P1TA 3V4MA 2G4BA 1PO6A 1VC6A 3DXBA 4ERDA 4Y0FA 3VALA 3DLLQ 3B4MA 2G0CA 2HVZA 3CTRA 1YI2S 3UD3P 3CCJS 2MZRA 1O0PA 2EK1A 3UCZP 2QEXS 3NMRA 5ITHA 2AYBA 5GAHU 1VQ7S 2CPDA 1SXLA 3NS6A 4OZ1A 2J0QD 1NO8A 3ZZYA 4BS2A 2MGZB 2NLWA 1B7FA 2DH7A 2L08A 3S01A 1IQTA 4CH1A 2KHCA 1X5OA 4WCEQ 2DHSA 1A7GE 3CC4S 3B4DA 2DNQA 2YH0A 3N9UC 1K8AT 2OJ3A 4IOCQ 3I55S 2J8AA 2OTLS 2D9OA 2MKCA 2EK6A 1PGZA 4CH0S 2MQPA 3H2UB 2LXUA 1VBYA 2DNOA 1U1MA 1X4CA 2OSQA 2OSRA 2ZJPQ 5LXRA 1U1OA 2KRBA 3SMZA 2MZ1A 3LPYA 1YITS 3NS5A 3U1MA 1JJ2R 2MZTA 2DGUA 1FJ7A 2CQDA 2F3JA 2DISA 2FPHX 3CCMS 2CPEA 4M5DB 3BS9A 1VC5A 1VQ9S 2HZCA 3Q2TC 1WELA 3G6ES 1M90T 5HL7Q 2JWNA
chains in the Genus database with same CATH superfamily
3F0NA 4WFBQ 2CQHA 3DDNA 4ES1A 2VZ9A 1TVRA 2V69A 2OELA 3KUGA 3RRGA 4U8YA 4N47A 2FJVA 2K1RA 3WX4A 5K8NA 4ZPWR 3IN5A 1XNQJ 3UNGC 4RNNA 2YWFA 3TANA 2LCWA 3MPWA 1Y5NB 4CT9A 2CKWA 1AROP 4U96A 3Q24A 3KNAA 1N6QA 3BKTA 3DRXA 3V6HA 3HD1A 4XK8C 3LP2B 4TY8B 4LFCF 3P4UB 3MURP 3MM9B 4H4MA 4N8NA 2RS2A 2Q6BA 4FF2A 1T0TV 4LF7J 1LFWA 4AFFA 2IBKA 4WKYA 1OY9A 1RTDB 4HHHA 1Q8KA 4G1QA 4YOEA 1UVKA 4N8OA 2J6TA 4C11A 2MQMA 4USHA 3T5KA 1H0HB 2DNNA 2DK2A 2B6AB 2FDNA 5HANA 4YN3B 4ITSA 2ZHBA 3C6TA 1S76D 2FZKB 3ULHA 4OLPA 5C42A 2KZZA 1RT5A 1NK4A 3M1VA 3EVMA 2ASDA 1SQGA 5LMNF 4E8UA 3M9MB 1WC5A 4NCGA 2UP1A 5KG0A 3BREA 3E01A 1FDNA 2QE5A 2HFUA 2VG5A 2C3MA 1X5SA 3R2DJ 1IR0A 4DQQA 4CM0A 2VC0A 1UA0A 3MXHP 1NK7A 1GX5A 2MZJA 1PILA 2GCFA 3WQPA 1T8EA 4NMLA 1GX6A 1E6VB 1R7IA 4ANDA 3CWJA 1YWXA 1LQ9A 1URNA 2ASYA 2DHXA 2R7XA 5J1EA 2JX2A 2VKRA 1FX2A 1SL1A 1GTHA 5KFMA 3KHHA 2HQGA 1U6FA 4MKYA 4WZQA 5I3UA 1R0CB 1VQPS 1RKJA 1J27A 2V67A 2JFDA 3OR2B 1HW9A 3UVJB 4P2XA 4F8RA 1HQEA 2DITA 1UJ6A 2A0FB 3MMAA 4ES3A 2R8JA 1Q53A 3DHXA 1X9SA 3MCSA 5BYQA 4ZHRA 4DHVA 1RTIA 2R2UA 4FPRA 2RKIA 2XNRA 2W2QP 4B3OA 3P8BB 2RUSA 1HBUA 1Y4ZB 3HX9A 4HR2A 1NK8A 4RUAA 3QT6A 1LW2B 3GYGA 1X4AA 1HWKA 5CXTA 5D4OA 1O51A 2IM2A 1P8GA 1FF2A 5D0HA 2RAQA 2CPHA 3UW1A 3D6HB 2YKAA 1HNVB 2VJVA 2RILA 4DR2F 3S8SA 1UWAA 1TKXA 2VU5A 1SV5A 4OI0A 3UDEA 2G13A 3TUZC 1N5VA 4N56A 4I2QA 2HK3A 2XHWA 1ACMB 3M4XA 2NREA 3TJ8A 1J5EJ 3KHGA 3HD2A 4G3IA 3S7RA 1IR2A 2DNYA 2DPJA 5IM0A 3MUTP 2I2YA 4CP5A 4AL7A 1PG5B 3BPDA 2RU3A 3B78A 3MDFA 5H9EK 1O6XA 1JLCA 1KKHA 2XLJA 1EKSA 3OR1A 3AQOA 2F1FA 4USWA 4WFYA 4B9TA 3H98A 1N36J 3E8OA 4WXWA 4Z2XA 1Q5YA 2VFVA 3AFGA 5A2QU 1ZS6A 2MXYA 5KFGA 3CXCR 2U2FA 3KK3A 4Z37A 1OYDA 3VALA 1U4BA 1JNZB 3FVYA 3W2VB 8RUCA 1SKWA 2HG4A 2A2CA 1TU0B 1U8SA 2GJ2A 3EXYA 5DG8A 1AYEA 5EX0A 1HMVA 1Q8BA 2EC2A 4USTA 2F4VF 4MIWA 2AJQA 3POTB 5E5NA 3EPGA 1X9WA 1A7GE 1REGX 4IFYA 3TA2A 4LF8F 2ZUAA 4IOCQ 3GV7B 4L75A 2VBWA 1VRTA 2MKCA 3C15A 2JC0A 3SMZA 1PBAA 5HROB 3OTOJ 4KBIA 1OMSA 2XZWA 3Q2TC 5CYMA 2L9DA 3CJ2A 1SL0A 3QJLA 2NCKL 2CJQA 1RT3B 5GAEU 1CC7A 1L3KA 1PC5A 1FX4A 3NRBA 5J2PA 2HQIA 5KFFA 3KLHB 2JZ5A 4ECZA 1RT1B 3VF0B 4OYPA 5HI7A 2KL8A 1T05A 4OZLA 1ZYQA 1QD1A 3D2WA 4OX6A 4RLEA 1NK9A 4IOBA 2E5JA 2W2NP 2V2KA 2DGOA 1WC6A 2QC3A 4F25A 1NJZA 2WBRA 2YWEA 3I56S 1H3DA 3H59A 1WOOA 1WTBA 1HARA 2UUAF 2AHOB 1FO1A 1LXNA 4NXMF 5LOQA 1WC1A 2HFNA 4LF6J 3UCGA 3M8QB 1TKZA 3I4PA 1PC4A 2EKNA 4Q2MA 1C2PA 3TARA 2NSBA 2GVZB 4JI1F 2WW8A 1QE1B 1KTVA 2LA4A 4JI3J 2XMMA 1AFIA 3IXQA 2UVUA 4X4VA 4JV2A 4DZ6A 3IS9A 2IRXA 3LP0A 3NAIA 3ENWA 2DT9A 3EGNA 1BQNA 2RDJA 3CIZA 1L5UA 2ZOGA 2YWKA 1DTQA 2CG4A 2XWYA 4PZVA 1X0FA 4PG7A 2NZ4A 3FJ2A 3TX8A 2HRTA 1OWXA 2I6WA 2ZH1A 4EO6A 1U25A 4O3NA 4DV1F 2LVWA 2VG6B 1V3ZA 4EYHB 3R2CJ 4CNZA 2IJFA 5HK4A 2B9WA 3BSNA 2ZZNA 4DR4F 4F4KA 2C3UA 5LJ3Y 2FQQB 1RHRB 4F4WA 3QJJA 1QDUB 4K2JA 2UUTA 1SQFA 4HHJA 5ETQA 2VUGA 4RUCA 4OYIA 3HVTA 1PJ6A 2VFUA 4OHYA 4LSZB 4KHPF 2UU9F 4CO1A 5HLFB 4JI8J 1IJFB 3W9JA 2L3MA 1HQUB 2PEBA 3TVYA 1N5QA 3DLKB 1YJNS 3CDUA 5GAGI 4NRTA 1RWUA 3DKDA 4GKJJ 3GG0A 1NU4A 2UV8A 3M32A 4FS2A 1Z2ZA 4KHMA 2KYZA 1VS3A 3ZZPA 3V2UC 1VLOA 5F8HA 4TVAB 4KKOA 3PRVA 4I67A 2DBBA 2KJWA 5J2MB 3OXGA 1S1XA 3MM6B 1R31A 5LMUF 4FF3A 2LU2A 2DGSA 2ZDOA 1VLYA 3FZ2A 2M8HA 4X64J 1T9UA 1S5ZA 2B3TB 4CI0B 4QPTA 3ZZOA 2ZVIA 2CYYA 5KFZA 4Q44A 2ZKTA 2HWIA 3OTBA 1FNMA 1RTHB 3CDBA 1KD1T 4JYAF 2LQ9A 2XS2A 4ZVQB 2W8KA 5A8KA 4X4TA 2Y1RI 4K2XA 3BO4A 5IFMA 2MJNA 2O66A 1S4EA 5KFSA 4ZJLA 2YKNB 3VZHA 5KG5A 1NUEA 3W5ZA 2V4RA 4Q7AA 3CVKA 2XO7A 3TW0A 2RS8A 4ZN3A 4I56A 4MKBA 2RQCA 1S77D 8ATCB 3SCJE 2BYCA 3BQ2A 1C1CB 3EGVA 4MJKA 2ZHAA 1IKYB 3H40A 2MY8A 4WJBA 2AJ0A 3K5PA 5BJRA 1S48A 3AAWB 2FJBB 4K4XA 3DLEA 4M5KA 1D3WA 1P1TA 3V4MA 4BLGA 2AF6A 2HW3A 3CTRA 4QZVB 4ZPAA 2MZRA 1RSCA 4CLTA 1SXLA 1R0AA 3GP9A 1VK8A 2R9LA 3I5CA 4CLZA 1IM6A 3T19A 3SSSA 3TZZA 2J7KA 2K3IA 2IDLA 1BQMA 3M8ZA 2B9EA 2MQPA 3WC0A 2LXUA 2DNOA 3JS9A 1X4CA 5IC4B 1EARA 3ELHA 1YRXA 3BDEA 4ICLB 4GKKF 1U02A 2VL1A 3RB6A 1QSSA 4RNFA 1PYTA 4DLGA 4C8YA 2IVYA 3RRKA 3J81j 4A8KA 2VODA 2H54B 2Q6CA 3ENAA 1F6TA 3MCMA 4QWEA 3W9HA 2OD6A 2C3OA 3HT3A 2M70A 2E9ZA 1ELOA 4WFXA 5L38A 5DM6Q 1HYSA 1JJ4A 1MROB 1UW9A 2WAQD 3PIOQ 2FGCA 3G82A 3BSOA 2IPOB 4H4OB 2AYMA 1WI6A 1FEEA 3D28A 4A46A 5CD4H 1RUSA 2W9BB 1EHWA 2YKMB 4O4GB 1YGYA 4I7FA 2KO1A 1RJJA 4ENOA 5IC6B 1ZH5A 2NYHA 4TXSA 3EE3A 3FEXB 5K20B 1YJTA 3A3OB 1U6ZA 2NPIA 2PO4A 4B9VA 3CJQA 1NJYA 1VK3A 4JV0A 4JI4J 2CQ1A 2VBZA 5BR8J 3NY0A 1ZETA 4Z7CA 4QYRA 5KOWA 3H2VE 5HVGA 3VVTA 5KFIA 4UOGA 3TAMB 2DB1A 4XPEA 1IJEB 3KLEA 3RB3A 3MEGB 1WC4A 3O1LA 4J5OA 4URGA 3A8IA 1KFSA 4ZLPA 4UY8T 3D3CJ 1BE4A 2EFVA 5L1KA 4ZP8A 4P7TA 2DO4A 4MTPA 1KQFB 2MQQA 4RU9A 2G0JA 2ROGA 2Q43A 2DGQA 5FLXU 4XPCA 3TA1A 3T9ZA 2MB0B 3VVUA 5SZTA 2PEHA 1C1BB 2LA6A 1U1QA 3KNGA 1E6YB 1HR0F 2V4JA 2R8IA 4NCAA 2ZBRA 1Q8LA 3HKWA 2YWGA 3QIPA 4EEYA 2EG2A 3UR3C 2OPRA 5HN0A 1FRLA 5E2QA 5IT9U 2NXCA 1DURA 3C2PA 4K0KJ 3QYYA 2PMZD 4R0EA 2OH2A 4DSEA 1WOPA 2X1AA 2C42A 2EEYA 5E33A 1S1VA 4JI6J 1DTTA 2YNIA 3FRYA 3CCWA 1BUXA 2W2OP 4LF7F 2B4OA 5RUBA 4B3TJ 3DGPB 1S1TA 2N3LA 4KSEB 2KDOA 4A8OA 4W4MA 1RABB 4O23A 2LQ5A 4FF1A 2DH9A 4NASA 2Y8WA 4CRJA 3PX0A 5D77A 4QCLA 1X4EA 1L3VA 2W2MP 2PFFB 2MSSA 3EDRB 4MH8A 1DJ0A 5FLXY 5CD4A 2BJDA 3MEKA 5D3GA 2Y0SD 2Y9HA 4TY9A 1HBNA 4C3LA 3GSDA 4OQJA 5A6PA 1SH3A 4FKYA 1IWGA 4ZMMA 3HXMA 4X4PA 5H1SV 3V6DA 3P6YC 3HHDA 3HMJG 2V34A 2O1PA 3GPAA 3SCKE 1W26A 4ATNA 1SI9A 2FZCB 1TK8A 2KH9A 2CZ9A 3FQKA 2FZGB 3I0SB 1JKHB 3MMJA 1K0TA 4DPUA 2D7SA 5CAAA 5DZ7A 4PQAA 3SIPB 5M2UA 1U0SA 4FN5A 2GIRA 3TVZA 1FFWB 3HCXA 4QIVA 2P2CB 3HLUA 2Y1IA 1VQYA 3ET6B 4CO5A 1YKWA 2JOQA 1WOSA 3IM8A 4IDKA 1HW8A 4M1KA 5HMYA 2W4PA 4CH1A 2KHCA 4X66J 1GK8A 1YLXA 4P74A 1NDKA 4AT1B 1S1UA 1YBUA 1WJ9A 3IRXB 5LXRA 2C2DA 2KRBA 2WSEC 1F5BA 1TAUA 3LPYA 2F3JA 4DS5A 3GZ7A 1P6TA 3BGFA 2CRLA 3PHTA 4DWIA 3RB0A 2BJ7A 1RP5A 3Q8YA 5DDRC 2KI2A 2XZTB 2HMIA 2BQ3A 4RW8B 2HQFA 4WWSA 3BKUA 2W9CA 2DNGA 3CJRA 3T1AA 3CDWA 3GFYA 1XERA 1SQEA 3C6UB 2OHDA 1LEOA 4ZPVR 1D09B 1RZMA 3QGPA 3S1TA 3U02A 2QG9B 2HVDA 1F3FA 3SSQA 4DEZA 4FBTA 2VKZG 4P10A 1QM9A 3RAXA 2J76E 3N79A 3MFIA 3IAM9 5D4LA 3LTOA 1J5EF 2IMWP 1V3RA 2MLZA 2YQ3A 1S0MA 3QO9A 2I8EA 4LF5J 5G0RB 3PM9A 2CJBA 4RKUC 3MMCB 2R8HA 4USUA 2WOMA 3SDEB 4TU9A 2FC9A 4K50A 3G8QA 2HHUA 1MSWD 3KK1A 2CJYB 3VGVA 3J80Y 2ZWPA 1NJWA 4OV6A 4K59A 2CDRB 1RBAA 2AGOA 1N34J 1GQEA 4KC5A 1N36F 5A0YA 2B56A 3KOAA 3VAMA 2BJ3A 2O3DA 1SJFA 1FE4A 1RTJB 2BQRA 3K5MA 3ETOA 5L46A 3G8TA 2XCPA 5I42A 3Q8QB 2UXCJ 2YNHB 3CJ4A 4JV1A 3C19A 2PFDA 3GWCA 1CSJA 4DOZA 1UWBA 1W2IA 3BBCA 5DLFA 3JSYA 5D6GA 1T9WA 1FNXH 1VQOS 4WFZA 1U2RA 1WDTA 1IBLF 3GONA 3QAUA 3WX8A 4J9RA 3M8WA 3GJTB 2N4CA 3OTOF 4DQIA 4F04B 1DHMA 2ZC3A 4IYQA 2QGFB 4A8XA 2J0SD 3RG6A 3OT9A 3I31A 2M9KA 5BXIA 2QZ8A 3CC7S 3H5SA 2Y8YA 2LU1A 4DX8H 4DBQA 1ZM2A 3HHEA 3SEOA 1VRUA 1PYOB 2CQPA 3GJQB 5ETMA 1S0OA 2V8PA 4N7TA 5E3PA 2V8VA 3AB2B 1SPBP 4DR1F 3KG1A 4DV5J 2V50A 1HHTP 1REVA 1F2HA 1AW0A 2Q79A 4PKDB 1R0BG 3NWGA 4URSA 4J9KA 3L09A 3MCNA 1YJ9S 2L41A 2UV8G 2J8SA 4NLXA 2H4WB 3K7RA 2FJAB 3QGGA 1TV6A 4FXWA 1MNEA 1MMNA 2Z58B 4DQRA 2MKHA 3AJ2A 4LF6F 1U2CA 4KAIA 3BH7B 4C3KA 2XZDB 1HNZJ 4KO0B 2BANB 1M5PC 4DU8A 3P3DA 2HHHJ 4E98A 3DC2A 3WZ0A 3K0JA 4J9OA 1B0VA 1NH7A 1ZTWA 2QA1A 3RB4A 1MWZA 2BRKA 2IAJA 3EGZA 1FK9B 2MSTA 2AJFE 5J2QB 2CNLB 2BJ1A 1Y00A 3BGRB 1HBOB 4ZVTB 2VONA 1T11A 1VQ6S 1UAWA 3GV5B 4WU2A 3KMSA 4PAAA 1VJWA 4GRSA 4AQYJ 3MM8B 4NPOA 1HHQA 2HZAA 3Q0AA 2XMAA 3TZYA 1XR5A 2BJ9A 1IBMJ 3ISNC 2CVIA 5LXYA 5F0WA 4FF4A 2JH3A 3WIUA 2A6MA 1QLNA 2GHPA 3FBCA 4C8OA 2BA9A 4M5IA 2W7AA 1O8BA 2C2ZB 3CD6S 1TP7A 4QR2A 3PYDA 3PZPA 2QA2A 4U7UK 1RHJB 3NBPB 3O5TB 4DFMA 3MF5A 1S9GB 1R8PA 2EI5A 3BZQA 3DOKB 4RW7A 4A8MP 1QSYA 1IKVA 3MM7B 3M30B 1WF2A 2YWHA 2RT3A 3NGSA 1X4GA 2G4BA 3I0RB 4QYZK 3DI6A 2G0CA 1HQ2A 4OYZA 3VV2B 1DLOA 3OUYA 1HPZA 4ZVOB 4DU7A 3HHLD 1NHKL 3S01A 2IRYA 1VCTA 1X5OA 4H4KA 1JLEA 2PI5A 3OHBA 1JLQA 3N9UC 3HFKA 3M6VA 5CZXA 3EZUA 2J8AA 2D9OA 2EK6A 1JNRB 1C0UB 3FZBA 1T03A 1VBYA 2XC9A 2J0XA 1S0VA 4CLSA 2V68A 4FDFA 1T9TA 1H38A 3T1HJ 2YBVA 3FC9A 4J9UE 4LSLB 4QIFA 3T5JA 4U7CA 5L39A 1MW7A 3CMAS 5H9FK 2RJZA 1BQXA 2NUUG 1OQ6A 2AX0A 4NLGA 3NGDA 1WTFA 2HS3A 2GJIA 2V8GA 1TL1B 2B4PA 2UUBF 3I87A 3IR6B 2PDAA 2ZBPA 1Q82T 3RTVA 3ETMA 3GCWP 1G3OA 2YNFA 1OSDA 1GT8A 4GVBB 1JLAA 2RVJA 1LNQA 3RBXA 5KFUA 2N4DA 2I38A 2G2YA 2PE8A 1U26A 1FKOA 4NLVA 3C16A 2W24A 4IO1A 2GS8A 1M5KC 3GB0A 4ES2A 1RAIB 4DCOB 2ADCA 2WCXA 2DNPA 2JFKA 4IQXA 1X4DA 1C0TA 4DV7J 1R8BA 1WKJA 1MWYA 3HSJA 2G9OA 3M2RA 4HT5A 3SQGB 2CZVC 3PFEA 1UMJA 4P7VA 4Q0BA 5GAGU 4K8RA 2HIQA 4I64A 2OFHX 4DL5A 4PG4A 4LVOP 1B0TA 2LDIA 1S9EA 1SJ4P 2XWXA 1T94A 2VG7A 3R1HA 2PGCA 1JXVA 3SV3A 1F9HA 1MU2A 3MI7X 3SCIE 2NXEA 3O3LA 1KP6A 5D15A 4AL6A 2J9DE 4HI1A 2H5EA 2DNRA 3G71S 3PYFA 5ETTA 2IDEA 3BH6B 1U7LA 1PAEX 2FGOA 2PMHA 1FKPB 2BBEA 4M95A 2DRDA 1TR0A 2OUGA 4M5DA 3PVXA 2GZOA 2B5JA 2MKSA 1AUSL 4O0NA 1HL6A 3D7SB 3BM7A 2A1BA 3ILOA 4LFCJ 4YQWA 4LBPA 1C4CA 1GEHA 3OFFA 2HIYA 1T3OA 4X62J 2HFOA 2QN6B 2WVEA 2EXUA 4RNHA 4TLRA 4ZPBA 3Q2SC 3MUVP 1KBRA 1H74A 2JVRA 5GADI 2HHQA 3ISND 3MTKA 1TQLA 1Q81T 4IO9Q 3KLGB 3E2EA 2GO8A 2NUHA 2X1BA 5CYQB 1N56A 2M4MA 2FVCA 5JUMA 4LBIA 4MYUA 3LP2A 1NSPA 3ZNJ1 4TY8A 2WTFA 4L3KA 1HLWA 2CJAA 2LDYA 3ZNUA 4LMZA 3MM9A 4OYOA 4OI2A 4X4RA 1VYAA 2FYXA 3OVAA 2VQEF 3C3LA 3TUPA 2QTWA 4USMA 2Z56B 2EG1A 2DIVA 1PKUA 5H9EJ 1CJKB 4ILLA 3MPVA 1RTDA 2AKWB 4WK3A 3BR8A 1VQNS 3TO8A 4UOCA 2B6AA 1F5AA 2F65A 2ZJRQ 1G1XA 4JI4F 3G9CA 4HYKA 3K8VA 4LRBA 2AJ1A 3PRBA 5F8NA 3NNCA 2EFQA 1UZDA 3IFEA 4Y00A 4MK9A 1S10A 3PJWA 2YWWA 3FRZA 1WEYA 2QT7A 4JUZA 3NXZA 2WSCC 2RE1A 3AA8A 4L3NA 4FYWB 3T6JA 1RBOB 3VZIA 4D3HA 3NAHA 3QRRA 4O3RA 2U1AA 1U47A 1E6VA 2YKPA 4ZN1A 3QRPA 2IM0A 2FJDB 3JB9k 3K5LA 1YJ7A 3LP1B 3G4SS 1IBCB 1EIYB 1RT6B 3HF5A 1K47A 2YX7A 3GCXP 4F2SA 3W60A 3KYLA 1B99A 3E3XA 1LV5A 2XMUA 4J37A 5I4MA 4C8ZA 3DXBA 3OR2A 2QL7B 3UVJA 4IRKA 4OZ1A 4J9VA 1B7FA 2VFSA 2VPWB 1KTQA 1RAAB 3PR5B 1GMVA 2VASA 4M5JA 1N0VC 2V63A 4F4AA 4YHHJ 3H7HB 5EUHA 1F1BB 1RYSA 2OMOA 3O6QA 2CXEA 4NLOA 2OSRA 5CABA 1LW2A 3HHLB 1N33J 1R8AA 4BBYA 2FPHX 4K4TA 1RT2B 3J81U 5E41A 4XO0A 3FFIB 2QV6A 3I5AA 3D6FB 1S4FA 1HNVA 4F3QA 4ZCLA 4PXCA 2MQ8A 5HO4A 5CHCB 2V8HA 2X3GA 2APOA 2WONB 1VIXA 4W92B 3L7PA 3H5UA 3K59A 4IUFA 3CMES 4RU2A 2XYHB 3OLBA 1NNDA 4ZA1A 2C2OB 3DRYA 3HZEA 1B7YB 7FDRA 3B8HA 2FLLA 4CH7A 1CJVB 3AODA 2C22A 3ZZ0A 3Q83A 5ETPA 2EWHA 2Q1LA 1RADB 2GO9A 4WFAQ 4DG1B 1U45A 3KKFA 4EMDA 2HGMA 1S9FA 1VBXA 4ELUA 2DY1A 3MAQA 1QUVA 4DXLA 2RRAA 1R27B 2YKOA 3QLHB 5EWEA 3U1NA 1UL3A 2PMWA 4PXDA 2XGQA 3VQSA 1ZM3A 4OFZA 4DDFA 3R5AA 3W2VA 5K9FA 4EYIB 2ZUGA 4XIUA 5KG2A 6AT1B 1UFLA 2GMJA 1RACB 3QMQA 4M5NA 4NYZA 4C9DA 3POTA 3KG4A 3QAEA 5HMWA 2JNJA 5CYJA 4X66F 3AA9A 2FJEB 2X1GA 1J2VA 1V6HA 2V0NA 4KPYA 2XNQA 1RI7A 1UVLA 2IVFB 2UXBJ 5HROA 2IM3A 1I3OB 2RMLA 4ZK7M 4PG5A 1IWAA 1T95A 2HQ3A 5FIIA 3L95X 2EC0A 1B4SA 2HRYA 1RT3A 3UD4P 4MIAA 3CCQS 4NXMJ 5KFHA 2BABA 3KLHA 1RT1A 1S97A 2F8MA 3D66A 3RAQA 3DLBA 1N54B 4FYXB 4ELVA 4OJGA 4C4WA 1U1LA 2VQFF 5DRKA 3IBWA 4AL5A 1PCAA 1M1KT 3W2WB 2IM1A 3W63A 5I3QA 3H5YA 2LFVA 4ED3A 2F7VA 1GFWB 4KJIA 1DY3A 3IAS9 3M8QA 3PJXA 1O5JA 1LWXA 2EKYA 2WB4A 2ASJA 5E7OB 2RU9A 1HI1A 2E5IA 2QYCA 2GVZA 4DR6J 1ZZFA 1FRHA 1QE1A 4DV1J 2J9CA 2QFJA 2H1YA 4I2QB 2FY1A 1N34F 4FYVB 2A10A 2OPSB 4KGKA 4DSJA 1TL7B 2HQDA 3HPOA 4DR4J 4HT7A 4DPYA 3T3FA 4AXIA 1X0PA 4B02A 1Z1ZA 4JI5F 4A47A 2E7VA 2YPZA 1KDNA 3SFGA 4KHPJ 3JTOA 2XQCA 4QW9A 5KOXA 4CYUB 3AJ1A 2XSFA 2VG6A 1TK0A 2HS4A 3DMJB 1AXQA 5C25B 2XGPA 2NXUA 3MOJB 4O4RA 2JC1A 4MK7A 4ZCIA 2D9PA 3ENQA 1UVJA 3DOLB 2L48A 1HI0P 4UOHA 1F9EB 4HACB 3DRRB 1H2UX 3HSGA 2DCLA 3BF4A 3OW2R 4NRUA 4MYTA 3W65A 5HLFA 2HYIB 5JJBA 3IC1A 1CQNA 1HQUA 4YR0A 4DF4A 3PO5A 3DLKA 3QZ7A 3WIVA 3D4JA 2QEXS 1YZ7A 4Y2IA 5GAHU 3JXOA 1NO8A 2VA3A 3CGIA 4KPCA 4Z7YA 4CDIA 2L08A 3NGKA 2WZ1A 1KLNA 2V9WA 2OLWA 1VFJA 4DLEA 3BYRA 4OYXA 5B0AA 1LWFB 1JLGB 1P9QC 4KGMA 4JYAJ 3DXSX 4OHZA 3FCWA 1U1OA 2KHDA 5J2MA 3K5NA 2BJEA 3U1MA 2EFPA 3EICA 3W5YA 1HIYA 1SBRA 1R3NA 3MM6A 4M94A 4KFBB 1GH8A 3DHWC 5KT7A 1HNZF 5MAOA 2GX8A 5C24B 4WYLA 3TRGA 3BO3A 3GJRB 2GQCA 1YIJS 1RTHA 3NNAA 3G6XA 1SJ1A 2KN4A 2BXJA 3H20A 4ZLNA 3MAHA 4O3QA 4YEAA 3RBDA 3KMQA 1RT4B 1G4CA 3OVBA 4DS4A 1CEZA 2CQCA 4KIAA 4AQYF 4U8VA 4LVNP 3MMBB 2YKNA 3TUJC 2WVFA 3HI9A 3MPDA 1IBMF 4ZVFA 1SIWB 3P5BP 4B17A 3THVA 5EN1A 2XI3A 1TK5A 1DFDA 3PKYA 2V94A 2PD1A 4DV4J 1H2TZ 3JAMY 1RU1A 1VQ8S 2IBOA 1C1CA 5DG9A 2XMWA 2X7IA 1IKYA 3U27A 2IFXA 1GXTA 3DRPB 2CQ0A 5KFVA 3AY0A 4QIGA 3PX4A 5DDQC 1W25A 4C3MA 2R7UA 1SB6A 2R7VA 4ECWA 4NYPA 4ZLLA 4HTIA 3T5LA 3NCQA 4K4SA 3O44A 2DD8S 4CNYA 2QYGA 3JSBA 5KFQA 3QNWB 5AXKA 1L3TA 1X4BA 2RDDA 3CULA 2B4UA 1Q4RA 1F0XA 3B82A 1TMMA 2C2KB 3OSNA 4DSFA 1XMQF 3L3CA 3KFWX 2I9SA 3EXCX 2BE2B 4ICLA 2FVQA 1XTZA 4FVCA 3NL0A 4PWWA 4LT6A 4MKVA 2RF2B 2BOPA 1RT7B 2GMLA 2K8GA 4OJHA 4WE1B 2VHGA 3I6PA 4KT0C 1KQSR 1SKUB 4CQ1A 3JSMB 4ZIWA 2X1FA 2GGPB 3D68A 4LFAF 1PSDA 1M5HA 1T02A 2HFZA 1SUQB 4RX6A 2IJRA 1CULB 1MROA 2JL9A 3MEEB 2HHPA 3IM9A 2CG8A 2XYPB 4I2PB 4H4OA 1NSKL 1SC3B 3US5A 4AYBD 3ZTRA 1FD2A 2VBXA 3NGTA 2W9BA 2YKMA 4O4GA 4IG3B 4ZP6A 2KM8B 2MEWA 3IGNA 5CCLA 4PUOB 1IXKA 2DKOB 2AEFA 5B7WA 4HTJA 2V8DA 5T7LB 3R1LA 5F8IA 3G96A 3HFZB 1D9DA 4KH0B 4K5RA 5EX3A 3HHNB 3TAMA 1KN6A 3THTA 1CJTB 4OYBA 3MEGA 1IKWB 2DXDA 2MKYA 3C8YA 1OPIA 3QT7A 2F9DA 3TYTA 4BCAA 2ZNZA 1HR0J 2J9DA 2R7OA 1IKXB 1WKKA 4W90B 4ALZA 4FPIA 4ZCMA 1JB0C 2HNDB 1LKZA 2W7OA 5GMDA 2AW0A 3MZIA 4C48A 2JEJA 4Y34A 1FD8A 4ANEA 3OFHA 2YH1A 1SKSA 1C1BA 1FVSA 2XHCA 5KFBA 4DV0J 2P8IA 4ER8A 1JJCB 1E6YA 4P52A 5B0DA 3R6GB 3OPKA 4ZPTR 4X62F 2P9CA 3VGSA 1Y7PA 6FD1A 2IC3A 1S1WB 3CCJS 3W9IA 1TTHB 4NA3A 2J0QD 2UVVA 4BS2A 2UUWA 3GR1A 4NZ7A 3FBFA 4ELTA 4NWBA 4EWTA 3PNIA 1C4AA 2O5DA 3KLFB 4YB5A 2ZBIA 4AXJA 4NXNJ 4KYZA 5EDWA 1TAQA 4RW6B 2F63A 3DGPA 2CPEA 4NLTA 2KT3A 4I6YA 4F7VA 1WELA 2DEJA 4DR3J 4ILRA 2FLNA 2JWNA 3NGRA 3BPSP 4H4KC 2XCAA 3D6TB 4Q5VA 2B9YA 2XG8A 5M2RA 3V6KA 2ROEA 2RQ4A 3R8YA 2KU7A 2HFVA 4LBHA 5KFYA 4DL2A 1J5OB 1NSAA 3BN4A 4QR0A 1UW4A 1K1SA 2CQ2A 3H2LA 3ZTPA 3R3TA 3HO1A 2D74B 2HHTA 3TUIC 3Q86A 3J7A1 2Y3YA 1R6VA 4V1Ak 1UFWA 5L8RC 4GMKA 5DO2A 3CUNA 5JMNA 1FTRA 2ZZMA 2BVZA 3SYZA 3MR3A 3GG1A 4Q8EA 2DTJA 5KG4A 2ZH3A 3I0SA 1JKHA 5GADU 2OGUA 3OQ2A 4UQTA 4J9NA 3CE8A 4DQSA 3CJ5A 3O2IA 3PV8A 1DARA 3N5BA 4C6AA 2GAHC 2R8GA 3OL8A 4OHVA 4MKAA 3ET6A 5LSLA 1JLFB 2CNOB 3AHPA 2E44A 1RCXB 4ED8A 3MPYA 3ZFVA 1HWJA 3V81B 3M8PB 2RRNA 1XK8A 1U24A 3UDVA 5F8JA 2YQ0A 2GW8A 3PYEA 4YHHF 4IG0B 2UVWA 3TX0A 3IRXA 1B64A 4Y65A 1NK0A 4GO7X 3MEDA 1N33F 1WHVA 3JQKA 3ZTQA 1PBUA 2OFGX 1DRZA 3TEHB 4RW8A 1AB8A 1CPZA 2CPYA 4QQBA 3H8YA 1VQ5S 2W4CA 2Z8QA 3MD1A 2OO4A 1NHUA 2OPQB 4NE9C 3C6UA 2HBZB 5KFAA 3BN7A 1K1QA 2NXNA 4LJMA 2RNEA 3FNNA 4DX6A 2QSWA 3UN5A 1QAXA 1S12A 2KYXA 1RAHB 3MGJA 5HVHA 3V4IA 3DGVA 3IR5B 1JLBB 4FYDA 1X8DA 2OI2A 1NLKL 1VBKA 1AA1B 2P6TA 2XSJB 1UFKA 4S0MA 1NRKA 5G0RA 3PX6A 3DFEA 3MMCA 4OV1A 1BXNA 5KFKA 4TLQA 1XMBA 4O0IA 3SDEA 4OL8A 1RK8A 2M7SA 2ZDPA 2AEMA 4J9LA 1IR1A 2D3UA 1YJWS 1NJXA 5DZ6A 1IBLJ 1WG5A 1ZAVA 1XIQA 3DDKA 4CIOA 1RTJA 3OSPA 4WIQA 5CCMA 4QYZJ 4BWJA 2YNHA 4DV6F 3GIJA 3GQCA 3ILIA 3A8KA 4NZ6A 2N82B 1UEVA 5MLCV 4RW4B 3UPFA 4DR5F 4NX9A 3KUHA 2YTCA 3ZXWA 1ROFA 2NPFA 1NB7A 4DR1J 3N6LA 3RU0A 3RAMA 2UXBF 1RLCL 5C5JA 4LREA 5KFTA 4KHRA 3SZ2A 1VQLS 3EVWA 4DZDA 4USIA 3RYLA 1UA1A 1LXJA 5H9FJ 3PYGA 3BEGB 2BW2A 1R89A 4DUZJ 5A2QY 5HQ8A 4LF2A 2KXFA 3F73A 5JVGQ 3HSDA 1TKTB 1UVIA 3UD3P 3KDOA 4DFJA 1U8WA 1RWVB 4GC7A 3G6YA 1TFWA 1EETB 2MGZB 3VGUA 3VGTA 2ZH4A 2QLJB 4YMEA 4PQUB 5B08A 2IHR1 4PYAA 2DNQA 5HJYA 2OTLS 4UZCA 2XY6A 1NBEB 4HLBA 2NXJA 4O3PA 4KGVB 3CJ0A 3PW5A 4C8KA 3H4BA 5A76A 1Q7LB 3BS9A 2HSEB 1TL4A 4KO0A 2BANA 3G6ES 4XDDA 1U48A 2BACA 4LRDA 1S72S 4DR6F 2HHXA 1QUPA 1JJHA 3IG1B 4G1PA 1FK9A 1RCOB 1RWPB 2MJUA 2BW7A 5J2QA 4HH1A 1LK5A 3BGRA 1W2BR 1HBOA 4RBUA 4A48A 1S59A 3CCUS 1H7XA 5KFOA 3GV8B 2NQPA 4KQZA 3MM8A 3FSIA 3Q23A 4K4ZA 3FCHA 1B70B 3MR7A 3K5OA 4DCPB 5KTQA 3PXGa 1S6QB 2VOPA 3LANA 5K8OA 2OTJS 2KFYA 4UW2A 4ZITA 5DQHA 4OZ2A 3DDIA 2PC6A 5AE1A 2QA4G 5EWFA 1NK6A 4CTAB 2CQ4A 3LH2S 3NBPA 3IWNC 4DL0C 1WKLA 1S9GA 3DOKA 3T9NA 5KFDA 1NMEB 1HFEL 4MK8A 3MM7A 3M30A 2B43A 3IGVA 1DBDA 1T9XA 1EKRA 4WP8A 3I0RA 2R2TA 2M88A 3IA0A 2E66A 4BWMA 1WHXA 5A6WA 2HNZB 5FD1A 4F02A 1S79A 2Z2MA 3U7JA 3Q8SB 2XI2A 3KK2B 4GVLA 7FD1A 2ZM6F 2UUBJ 3Q8UA 2H3EB 1KVKA 5F8LA 3PDNA 1C0UA 2A6OA 4FS1A 3UFCX 3ZZUA 3MM5B 4IH6A 5JVHQ 4F4ZA 5B0BA 1S6OA 3UE2A 2GQQA 5DDPC 2ACYA 4LSLA 2MKJA 2XMVA 1RISA 1Y9OA 2ADBA 1NDPA 1UP1A 1S57A 1K9MT 2YPYA 2BX6A 3TQ1A 4J9SA 1ULRA 1S6PB 1TL1A 4P2SA 4YS2A 2ILYA 1G6BA 3BGLA 3IBFB 4PWDB 3HJVA 5LSOA 1HBMB 4WPAA 1BHNA 4KV8B 4GVBA 1Q16B 2ROPA 3EWGA 1KHWA 2K2PA 1M5OC 4V19J 3SSRA 4DX5A 1KEKA 1HHSA 1WEZA 4LR7A 5AJ3J 2IY5B 4M5HA 1Q8IA 4QIWD 4L72B 5IZHA 3SQGA 4DV4F 3M7VA 2FVRA 2NSCA 2OEKA 4ETXA 3CF5Q 2EFNA 3SXLA 3A1YG 4ZVPB 3BV8A 3GR0A 2I1RA 3C14B 3PTWA 3BBBA 4RL1A 4FBUA 4NEZA 4N5SA 4QIEA 4JI0F 1F3VA 4ID8A 1YJRA 4P73A 3FSXA 4B9SA 3GSIA 2CWKA 4V19X 2DHAA 3PW7A 4F36A 2OAUA 2VD3A 2P9EA 1OJ4A 4HL9A 3BJYA 3CC2S 2WB1D 3NEKA 2XYGB 3JYTB 2L9NA 1FKPA 3ADAC 1RLDA 4NL5A 2JEGA 1GMUA 2CA9A 4OZNA 4Y2KA 3QZ8A 2IVMA 1WF1A 1WHYA 1WI8A 2CPJA 4QU6A 3AJDA 4E2FB 2VQEJ 3WC2A 1TELA 2HWHA 4J7CA 1IM4A 4GC6A 3BB5A 3KLGA 3NS6A 2HAFA 1GXLA 4R8UB 2KVQE 5CYQA 1D0EA 3K89A 4PWUA 2GHWA 1FRMA 4LRAA 1TL3B 1S0NA 4LRFA 4CCHA 5IOLA 3J7Z5 1ZAWA 3TEGA 2FHKA 3T1YJ 1CS4B 1FJ7A 1CJKA 3OBIA 5FDLB 1LWCB 3NWRA 3WHIA 2YXLA 3SCLE 3R7NB 3NCPA 1CLFA 4YB7A 1RWXB 2NZCA 1M0SA 3ZZRA 2GVDB 2HVIA 2F8EX 1XN9A 3TP2A 5AE2A 3CEDA 2VFRA 3BSCA 3QWPA 2JDJA 1WSRA 1LK7A 3IWXA 4B08A 1ZA1B 1VGYA 2DXFA 3KLIB 3HM9A 3OL7A 3LWMA 1U09A 5G4DA 2AYEA 3VR1A 4DPXA 4I6AA 4C0HA 3OD2A 1GTEA 2KXNB 4B9NA 5KT4A 3LAKA 1FXRA 2F9JA 1WEXA 4CO4A 5KG7A 3ZTOA 3LGHA 2QLWA 4LSNB 3D67A 5J2NB 2GQ2A 3LP1A 2VOOA 3T5HA 2J7UA 5LSRA 1RT6A 2MY7A 5ETSA 2FVSA 4DV0F 2IYGA 4YDXA 3M2VB 4A4JA 2AU0A 2CDQA 3TA0A 1URRA 1N5TA 2B9XA 2HPUA 1FKAF 1V3SA 4TQSA 4RO0A 3PIPQ 4X84A 2FY8A 2RHSB 1SIZA 1OO0B 4KGXB 1OPZA 3UDLA 4ZDNA 2FHJD 4DL6A 5M2PA 2JLEA 1HNWJ 4U7UD 4Q2LA 4U6PA 3OJUA 2W9AA 4WZMA 3HKZD 2EVZA 4WTOB 4NLQA 1ZPVA 2VA2A 1F2GA 5CH7B 1X7VA 1LW0B 3I9V9 2EPIA 2DNLA 3CJ8A 2WVBA 2Y1LB 2MQNA 2ZH9A 3CD7A 4DCJB 4OYMA 4NXNF 3UR0A 3HHLA 3CO0P 1RT2A 4KH1B 2ZJQQ 4DUYJ 1KSPA 2ZH5A 2XULA 2QLXA 4NLSA 2PI4A 2P6SA 3FFIA 4RPFA 4DR3F 1TMJA 3TVKA 4QBUA 2PSZA 3JTNA 2YNGB 5DDOC 4QPXA 3VAGA 3ZZTA 3X3UA 4C8MA 2V6AA 2H65B 2F4FA 4KR0B 1WDDA 3VTIA 4X4OA 2D3ZA 2WONA 4NLWA 3GIMA 2E1CA 5IT9Y 2ZE2B 4ECQA 2FLPA 4LF9F 4U67Q 1CJVA 3H25A 1YHQS 4K7QA 3R7SB 4UT4A 3RBEA 1ZPWX 1KR4A 2VC1A 4B3SJ 2Z4PA 4EU0A 1SJRA 1XBWA 4DG1A 2ATCB 5F3TA 1WNEA 2QMXA 4K4WA 3ISZA 2ZD1B 1N5SA 1YSJA 1CVJA 4H54A 3QLHA 2QMWA 3CB4A 2G0IA 3GFHA 1NH8A 1RYRA 4QR1A 3MD3A 1SC1B 4LIWA 1VIOA 2NYIA 1X60A 2HAIA 1GXUA 4BDPA 1FESA 3NOCA 2ZVSA 1RGVA 1VR6A 2M8DB 5DQIA 3IRWP 3DN9A 1YBTA 3QJPA 4R5PB 1IQZA 3R6LB 9RUBA 3HFVA 1B3TA 3IWLA 1YG0A 4L73A 2LQJA 3FEYB 5F0UA 5HSPA 3T41A 4DR7J 3OFEA 4PR6A 4DL3A 1M5SA 1W7WA 1CBKA 1N52B 2IYIA 4OHXA 2QIFA 1Q95G 5F9NA 4KY3A 2HGLA 3I5BA 3TJAA 4JI2J 2VQFJ 1JX4A 4O44B 1U1RA 4YY3J 4DN9A 1XWLA 2BMBA 5IT0A 3ZZZA 4DL7A 5GAHI 3HK2A 1YQHA 2E1MC 1AZSB 2C2RA 4ZCKA 2E29A 4C97A 2HFSA 5EHHA 4C7QA 4WKRA 4ERDA 5KFEA 1OYEA 1RXOB 2HURA 1NKBA 3TAQA 3TNVA 2AYBA 1GAOA 4ZP9A 3KJFB 1IQTA 3Q8PB 3HZGA 3AD8C 2C28A 1JQGA 1VQSA 1NPPA 3W2WA 1EP4B 3J7YI 4I0WA 2GHVC 2QJ3A 1PGZA 3HDSA 4OIXA 1RA7A 1A0OB 2ZJPQ 4JI5J 3OXLA 2B8PA 4EBCA 1TUWA 3MWBA 4NI2B 4QJVA 5AE3A 3TZXA 5F9LA 3K8WA 2HZCA 3CCLS 2HNYB 5IV3A 1QTMA 3X1LB 3DM2B 2A3JA 3L7UA 1OSCA 1Y3KA 2EFGA 4JB8B 3CJSA 4ILMA 2OKQA 2VIHA 4ANCA 2OPSA 2Z2ZA 4BC9A 1TL7A 5HQMA 5KFCA 2RQKA 2KT5A 4J90A 3RBZA 1AUDA 3T6BA 1RQ0A 5K14B 2VPYB 4PCQA 2JRSA 1R8CA 1S7HA 1OY8A 4P71A 2G1DA 3UQSA 3OV7A 4WU3A 1CJUB 3E51A 2ZH2A 4CYUA 1UJ5A 4B3RJ 1NKCA 3LQVA 1OQ3A 1A9NB 3DMJA 1H72C 5C25A 2AGQA 3VAKA 5ETNA 4ID5B 3D3BJ 4DV2F 2BKOA 5LT5A 1JWWA 3DOLA 4JI7F 4C8LA 1HD1A 2LMIA 4HACA 3DRRA 4NLUA 3R5DA 2HWTA 2CPIA 1QTNB 3R5BA 5A8WB 2H48B 3H42A 2QX0A 4RW9B 4DUZF 3PKMA 2C3YA 4IKAA 1UJ4A 4M5MA 3H4DA 2KJVA 3D9BA 4PG8A 2HBQB 5CZVA 3EZ5A 4M5LA 5I3PA 2E1AA 2LLZA 3AT1B 2XMJA 3FDSA 4PXEA 3PR4A 1LWFA 1JLGA 1XQIA 3TWZA 3CCVS 4TU7A 3D1QA 1ZM4A 4LF4F 4I68A 4LFBJ 3N6NA 4UOFA 4MT1A 4L76A 4OX8A 2XS5A 4P9SA 2FHMA 3OTDA 3HULA 4OZJA 1RAGB 1WG1A 4KFBA 4ZIVA 1HWUA 4P72A 3WDOA 4U95A 2I5JB 4MFBB 3KWMA 3G87A 3H90A 4RUHA 4ZVRB 5LJ5Y 1U0HB 2CQBA 5C24A 4NLDA 2M0GB 4ED0A 1T3NA 1EAYC 1I94F 3TZWA 2CQ3A 5KT2A 2DRBA 1BY9A 4RZRA 2FJWA 2LXIA 1TZ0A 1VQKS 1VDHA 2WHOA 3LOUA 4HEA9 1RT4A 3GFZA 4B9LA 1F9FA 3QBCA 3D54A 3N4WA 5D0GA 2MLYA 3MMBA 2F5GA 3PO4A 2A18A 2YQ1A 4Y2MA 1WORA 3P49B 3BQ1A 2VPXB 2O67A 2DVIA 4A8FA 4USVA 1RHUB 2K06A 2DPIA 1APSA 5KFWA 2PT0A 1WSVA 3MAAB 2DJWA 5D4NA 3QWUA 4RR5A 3CJTA 3DRPA 2OPPB 1Q7YT 4G6VB 4LF1A 2ABYA 3ZTSA 1RAOA 2HRUA 4IFVB 1KHVA 1XMQJ 1X9MA 5ETRA 1Y0HA 3NGUA 2K7KA 1KLMB 2VDIA 1KNZA 1H73A 2OD4A 3M8SA 2LECA 2CPZA 1NPRA 4CT8A 4J9MA 9ATCB 5HP1B 3AD9C 1LOUA 1FXLA 5AXMA 4LFAJ 4DSIA 3KJVB 1EQMA 3PEJA 1X4HA 1VI7A 1GMWA 5KG1A 1LWEB 4TU8A 4X4NA 2BE2A 4B9MA 1UKUA 3CCRS 4G65A 2RF2A 2E5HA 1RT7A 3EUNA 3EJMA 1FA0A 1FRIA 2DXEA 1CG2A 2DR5A 4WE1A 1LFPA 1MMLA 1TUVA 3DU6A 1HD0A 4C0OC 2L9WA 3RW6A 3JSMA 3CCSS 2GGPA 3FBBA 2C2EA 1SH2A 4LRCA 5HAOA 2AGPA 1SUQA 2CWXA 3DOMB 2W4DA 2MLXA 1CULA 3R5JB 5LL6d 3MEEA 5ITHA 1VQ7S 3RZAA 4I2PA 1FRJA 1NM2A 3KDNA 1AFJA 1WD6A 2CZ4A 2OJ3A 4IG3A 4YP3A 3I55S 2NS1B 2HS0A 4CH0S 4PUOA 3N01A 4TNOA 5D0RA 1ZAXA 3LF0A 5HATA 3JSRA 2DGUA 2J6UA 1FDDA 5AJ3F 3CCMS 1XNRF 5T7LA 3JQMA 1FJGJ 3DYAB 1M90T 1SKRA 3Q8RB 5A8RB 3FMBA 2POKA 3M9NB 1YRTA 2BDPA 3ILJA 1CJTA 3FBEA 3W66A 2OP5A 4FNIA 1IKWA 2IA6A 2DCUB 1T7PA 2E7WA 1FT8A 2SXLA 1MN7A 2PA3A 2P5VA 3HVRA 1IUJA 1IKXA 4JP8A 4FYYB 1VQ4S 5GMEA 3GJSB 2C1EB 2HNDA 3N28A 2KTQA 1B0PA 4JBCA 2JSXA 4WFNQ 1AT1B 2Q3PA 1X4FA 4TN2A 4ECYA 3RJMB 5BYSA 2RD5C 4DQPA 1WUUA 1RHKB 2AQ4A 4OX7A 2F8HA 4Y2CA 4LR9A 2BKPA 3QFHA 2LQBA 3W62A 3D0HE 2V5HG 3RW7A 3ITHB 2W25A 1JXLA 4IRDA 1PJ7A 4FP9A 3DU5A 3DLGB 2W01A 1WACA 4I6WA 4B3MJ 1RAJA 2K3KA 3M2UB 3V5RA 1WC0A 2UUCJ 2DHHA 3CJKB 4N76A 1YDLA 3IMQJ 1S1WA 4PRFA 4CO3A 3PW4A 1VOMA 2V2QA 2ZOFA 2DGWA 1HNIB 1M1GA 5HBMB 2HLUA 3KLFA 1R8HA 3Q22A 2EBGA 2GJFA 2N3OA 5CA5A 2E9TA 5K8PA 3MECB 4WTYA 2R4FA 4UTGA 1QY7A 4NA1A 5D0EA 4RW6A 4XDCA 5F8MA 3T1YF 3MUMP 4NA2A 3QFWA 3KLVA 2DIUA 5DM7Q 2F40A 4QWAA 4JV5J 4QWCA 3DRSB 2HVEA 2VICA 3UI3A 2LXFA 3M8YA 4QOTA 3R27A 2Y1JA 1KQKA 3A4TA 2LEPA 2FHOB 2KRRA 4DMZA 2W1BA 3MOZA 1J5OA 2JEFA 3BO2A 4OJ3A 4RUBA 2Z57B 4EGLA 1P9YA 2V9KA 2BR0A 4ZP7A 1M5VC 3KTQA 4OI4A 1JMTA 2UZAA 2JVOA 2DO0A 4DFPA 2ILZA 2HHVA 1XMOJ 3UN3A 3UN2A 1DZ5A 3LUYA 3MCOA 1N5YB 3A13A 2ZH7A 3GYXB 5E3CA 1I6JA 4OMFG 3BGUA 4YUDA 3LGMA 1DQ8A 1ZOTA 1TVRB 2ZOMA 1QAYA 4IOAQ 1FJEB 3FEZA 2K1RB 3A8JA 1JLFA 2CADA 1RKIA 1RWOB 4BC7A 1U1KA 4HDGA 2DNHA 5L1JA 3V81A 3PW2A 3M8PA 1S99A 1GNKA 1HNWF 1N6QB 2Z0GA 4NCBA 2VH7A 5DETA 5IWAJ 5KAKA 4IG0A 4QW8A 3QSYB 1V5VA 2E9RX 1IVZA 3UD5A 1TKDA 3ENVA 4H4MB 1YJVA 1P1LA 4QU7A 4CLKA 2FJXA 4ED2A 2XB2D 5F3ZA 3B54A 2RHQB 5B0CA 1XNQF 4HH0A 1KOOA 2BE9B 2IC3B 5E3AA 4A8SA 3D1OA 1D1UA 4DUYF 2D1CA 4G1QB 3HVAA 3EDQB 5KFXA 1RWNB 1VHIA 5U47A 2H5IB 2MKIA 3BGOP 4C11B 3F56A 1N4LA 3GFXA 4X4UA 5IT4A 5HVFA 2N7CA 2OPQA 1UEKA 3C6TB 1PIEA 4HDHA 1TFYA 1PJ5A 5E3RA 3B4MA 4CZCA 5C42B 1O0PA 1RT5B 4OYAA 1NHVA 2CPDA 2RB7A 3M1VB 2M3DA 2A2DA 1VJQA 4P2MA 1VMBA 2NLWA 3W8GA 4NCGB 2GNKA 1JLBA 2KT2A 3E01B 1Q78A 2QSFA 3TI0A 1K8AT 2VG5B 3MFHA 1Q0NA 2XSJA 3A3PB 3MPUB 1D9FA 4DV6J 4B3SF 1TUGB 2E1PA 3IBCB 3NS5A 4WXOA 3LPEA 1EX8A 4EZ6A 1UVMA 2O01C 3J81Y 1KQGB 3HSZA 4DR5J 1FJCA 4XAKA 5J1EB 3D5MA 2XY7A 4NMXA 1X5TA 3CNQP 4I1TA 2R42A 2MTLA 3QT8A 2E5LJ 5I3UB 1ZZNA 1PYSB 1FTCA 3OVSA 4WBFA 2AV5A 3AD7C 3SFUA 4P75A 1QAJA 1HQEB 1D8ZA 4RW4A 2CNKB 3MMAB 1Y5IB 4YFUA 4ZHRB 1U1PA 1RTIB 3CCES 4DR7F 1MMDA 2RSQA 2RKIB 2XY5A 4B3OB 1YVFA 2R7WA 1FRXA 4ZJOA 4DFKA 1HBUB 3PHEA 4QWDA 2OIHA 1SL2A 4JI2F 1WF0A 1YX2A 5KG3A 4YY3F 3GU0A 4ZJQA 2D69A 2D3OR 4OJ1A 2R7QA 4IR1A 3J80U 1I5OB 3ICLA 4CM2A 1Y3JA 3VAIA 8AT1B 5GMKa 2G2ZA 2BOAA 3FK4A 3A12A 4QWBA 2LEAA 1G7CB 4ZKAA 4FXDA 1TKTA 2H4YB 3M05A 3R9LA 5LM7E 2MMYA 1YRUA 2ACMA 4RBTA 1UPMB 3HT0A 1TKXB 1EETA 2MGZA 2RIJA 3AB4B 4PYDA 1SV5B 4LQ3A 4PQUA 1DQ9A 2N7YA 3MEDB 4L6V3 2ALZA 2XMKA 4ED7A 3HVWA 2J5AA 4M8LA 2QL9B 4ZLJA 2CFXA 5IM0B 1Z4UA 2D3O1 2DNMA 4F3OA 1N32J 3SBMA 1JLCB 3QRQA 1IN0A 4TKTA 1U1NA 3OR1B 1KVIA 3EM1A 3SQOP 2M2BA 4PPZA 4ED5A 3IG1A 4MAKA 1R6YA 3W64A 3TJ9A 2COLA 3V4IB 1OIAA 4YR2A 5IQQA 3KK3B 3HHLC 4DX7A 2DGXA 5EWGA 2R2SA 2HZVA 2E1RA 1VRQC 3AQPA 4ETZA 2KVIA 1HMVB 2BM0A 3S6EA 1Q86T 5DG7A 2KFNA 4IFYB 3VCDA 3PCOB 3SI8A 1IBKJ 3RR8A 2DGVA 4PG6A 2QA4S 2IIHA 3FCVA 1VRTB 4B3RF 4ECSA 3C15B 1S6QA 3NKYA 1VQMS 3EGWB 4P2FA 1NSQA 4CTAA 1UPPA 3DCAA 5CYMB 4AD6A 2ZM6J 2MQOA 2AD9A 5HJXA 4F2RA 5HMXA 4LIRA 3QATA 1KOHA 2XTJP 4TYBA 4X65J 3D1HA 2ZKUA 1MLAA 2XO6A 4LR8A 5J2PB 2DR6A 5B09A 4Q43A 2LEBA 3P45B 4DI6A 4M5GA 1T05B 3J7YU 4D3GA 3UWTA 2HNZA 4WYWA 3KUEA 2HGNA 2X3DA 2MZSA 1KRPA 1BMQB 3KK2A 4ZS6A 4ECRA 2MPUA 4OI3A 3MM5A 2J9EA 1FNOA 3CMQA 4ZPCA 4ZVSB 4LFBF 3LAMA 1FERA 3K2YA 1SJ3P 4UUXA 2JHEA 4YB1P 2DEIA 3BR9A 1TKZB 4Y28C 2AIRB 1EB0A 1RAFB 2CQGA 2HLTA 2C3PA 2WRMA 2YX4A 1S6PA 2J6SA 3HHKA 1WG4A 2EW9A 2RUGA 2J7WA 5JXSA 4F0KA 3IS9B 4Y0FA 2AP6A 3DLLQ 4PWDA 3LP0B 2AZ3A 3UCZP 2EK1A 1HBMA 3NMRA 1FFSB 1BQNB 4YDDB 3OTEA 3L7OA 4KV8A 4N41A 5AT1B 1Z2LA 1NDCA 3GILA 1DTQB 3IR7B 3CC4S 3B4DA 2YH0A 3A3NB 5K8MA 2BE7D 4ECVA 1NZ8A 4PXBA 3FGVA 2XLKA 4JI0J 4JI3F 2MZ1A 1HWLA 2ZBQA 3CDEA 1N0UA 1YITS 2MZTA 2ZITA 4B9UA 2CQDA 3RR7A 2OMLA 4DPTA 1UCNA 3K58A 4OI1A 1TL5A 3EMTA 4EBDA 3TR5A 2JJ4D 5C7PA 3H5XA 3G86A 2Z30B 4TQRA 3RGIA 4ZPDA 2CJXB 3C14A 3VHQA 3HVTB 4Q8FA 1RWMB 2CUYA 2AMCB 2Z2LA 2BKNA 1DQAA 4CLWA 3M6UA 2QLBB 4K4UA 4K5SA 5DS7A 3CSKA 1BLUA 3F41A 4TYAA 3J7ZT 5DGAA 4O3SA 3M32B 2BRLA 4KRWA 2E5GA 3JYTA 1FDAA 3KHRA 4KKOB 4JI8F 2QLFB 2ZZTA 1UVNA 1S1XB 2YY3A 1I1GA 2CJ9A 4WF9Q 4WP9A 3PG9A 4YR3A 5IV4A 3FKBA 2HK2A 3LWLA 3PACA 3CCZA 4GKJF 2YKQA 3HP6A 3I32A 3R5CA 5L1IA 1MG7A 1CC8A 2FIUA 3UO0A 1ZA2B 4CLPA 4F67A 3AXMA 4XTTA 4L74A 2QO3A 1HNXJ 1KS2A 2UXDJ 3JTPA 2FUG9 4R8UA 5A8KB 3W8PA 5E3QA 2RQMA 2W2PP 3VAHA 3Q8VA 5T41A 2KZMA 1FWPA 5THWA 1RHQB 1F5CA 4ECXA 1TL3A 2EBEA 4IH7A 2B0GA 2JLGA 4DUTA 5ETVA 5L1LA 4DV3J 4X64F 3GLJA 4Y6IA 1CS4A 5FDLA 1FRKA 1LWCA 2DR8A 1FJGF 2AWZA 5J1NA 1WC3A 4A8QA 2CJKA 3R7BB 4M63A 1VHFA 2GVDA 4LQ9A 2BZ2A 3TOQA 3CW2C 4J9QA 2IJNA 5L9XA 3KJNB 3DLEB 4FXVA 4OX9J 1RB0A 7AT1B 4R25A 2LQ8A 3KLIA 1SJQA 1ICEB 2LP4A 1NZAA 1R0AB 3LGNA 4UQGA 2R2RA 5KG6A 2BEFA 2LKZA 2JEIA 3NP5A 1Y10A 1BQMB 2VF3A 1VISA 3CPWR 1G2EA 3VAJA 4X4QA 1SC6A 1FWLA 4LSNA 5J1PA 2AJ2A 5J2NA 2QFIA 1L3SA 1NAQA 1ZM9A 3C46A 5B0EA 1YJUA 4FVMA 3M2VA 4NLPA 1FFGB 5SUHA 2DNZA 3NLCA 3ILLA 1V5IB 1RWWB 4B3MF 3JQJA 4WIIA 3MHYA 2UUCF 1HYSB 4DSLA 3RUBL 1RTZA 1Y5LB 3VWSA 2WBMA 2VV5A 4FKXA 3IO1A 3H0PA 1NCLA 2DHGA 3G82B 1Y11A 1HKAA 4CO0A 3UCUP 3AOBA 1HWIA 1X5PA 1LW0A 2ALYB 4C0BA 4I7FB 1EJ7L 2DY9A 2VFTA 4ZVGA 4G1IA 4LF9J 4CLFA 5DQGA 2ZH8A 2GFFA 3BYPA 2VDHA 3NOGA 2Q66A 2YNGA 2AJ4A 4EO8A 2AZ1A 1H98A 4JV5F 2KXHA 1Q5VA 5K5MA 3W61A 1WHWA 2AYGA 4MMOA 1PO6A 4OHWA 2CNNB 2ZE2A 3KLEB 4J9PA 5LMNJ 3I9ZA 3F44A 4A8WA 1RU2A 2PIIA 5KT3A 2DHSA 5KFNA 3CT9A 2VJUA 2XBPA 4DL4A 2XMTA 4FZVA 5ETOA 2HVHA 2GC8A 1NEEA 1KWMA 1RDRA 5BR8F 4F0HA 1U1MA 2OSQA 2BV3A 2ZD1A 1JJ2R 3QPIA 2DISA 2R7TA 1XMOF 2R7SA 3L4BC 1XR7A 3NNHA 3M6XA 4W98A 2QL5B 2R3VA 1FEHA 2KM8C 4P6QA 4K4YA 2V4JB 4KTQA 4O3OA 2GIQA 2B8QA 2R7RA 3QIPB 4R5PA 2OPRB 4CWBA 3FUYA 4UUWA 4RNOA 2FVPA 1MN9A 2MQLA 1JXEA 5IWAF 1S1VB 4C2MA 1OY6A 1SH0A 4UF4A 4UY85 1DTTB 2YNIB 3MR6A 1VC0A 3DLHA 1UETA 2ZNYA 4O44A 2BJ8A 2WW4A 4EK2A 4I69A 1S1TB 1FWKA 3W1YC 1MWQA 4K0KF 2HQCA 4UZBA 4DN0A 1AZSA 3IP0A 3U1LA 1BD6A 4DR2J 3QQCD 4U9RA 4N77A 4CO2A 4JI6F 5HMZA 3LW5C 1K73T 5GAEI 4EI2A 3DLJA 5D3GB 2DRAA 3GIIA 1HBNB 1X31C 3CIMA 4B3TF 2VBYA 2HKEA 1EP4A 4F50A 4RBVA 4JOUA 3BQ0A 3CD0A 4NZ0A 3UDCA 1YZ6A 3G6VA 3V6DB 4NI2A 1RBLA 5CQGA 1UTAA 4ZVHA 5KFRA 2H5JB 2QRRA 2PN6A 2BQUA 3UNYA 2KG0A 2CVEA 3W7BA 2HNYA 2HHSA 1UZHA 3DM2A 1N8RT 4X2BA 3I4HX 3K57A 3R5GA 1EQ0A 1VBZA 4DV2J 2RDIA 4ZOSA 2IA0A 4JI7J 4EBEA 5F41A 4RJVA 3THPA 2E5LF 3QSIA 5KFPA 5K14A 1D9AA 5E0OA 2FD2A 2DNKA 4IDKB 2F4VJ 2MYFA 2DGTA 1BGXT 4KGZB 1CJUA 4LUBA 1KONA 4LF8J 2W7PA 1NPKA 3NS7B 1XEZA 3PFOA 1S1UB 1QVGR 1YTYA 4ID5A 3FMWA 5IS2A 4OZ5A 1WWHA 5T14A 1P27B 4CLLA 3ZO7A 5DJBA 2H51B 3I82A 3AOAA 1GMWD 5EGYA 2I0XA 2WSFC 4USKA 2EFOA 1JIHA 5A8WA 2MHNA 2YX1A 3QIDA 2HHWA 2DYAA 1FE0A 5KT5A 4ZVEA 4LF4J 2HMIB 4RW9A 4RNMA 1NJIT 3G8SA 2W9CB 6FDRA 1KFDA 2XEXA 3MR5A 2CPXA 1HI8A 3KJQB 3PW0A 3W5XA 3GIKA 2AT1B 3MR2A 1K44A 1I94J 2ATLA 1U49A 3QT5A 3PY8A 1SC4B 2FB0A 2ZHOA 3D0GE 1FXDA 2UUAJ 1H2VZ 1QJHA 1V9OA 3QO9B 2DR9A 1U6BA 2ASLA 2FHJA 4ZVUB 1T9VA 2M5YA 1PAUB 4NYOA 5L9NA 4IQMA 2WOMB 2I5JA 4MFBA 1N32F 4JI1J 2OEMA 1U0HA 3C66A 2D41A 2K7JA 4URQU 3KK1B 2HEKA 4OZ0A 3GIRA 4AUKA 4OI6A 3D0IE 1NXIA 2XS7A 5A0YB 4EUVA 2M52A 4PEOA 2HBYB 1CQMA 2ZFHA 2VB6A 1DAXA 4FNHA 4LF5F 2QMUB 5I42B 3OLAA 3NMAA 1XC9A 3VQTA 2DH7A 3FSYA 5B0GA 4WCEQ 1UWBB 1XR6A 3GMGA 5ETLA 3ZC4A 5F8GA 2OEJA 4Y2AA 1IBKF 3H2UB 3M9OB 1YK9A 3A8EA 1XJWB 3MAAA 1VC5A 1VQ9S 4RWXA 4ED1A 2CAJA 3AH6A 4A8YA 2HBRB 2OPPA 3GE9A 2UXCF 4KB7A 2E7XA 1S7IA 4IFVA 1H7WA 4DF8A 4C98A 4IRCA 2RRBA 2UU9J 1EZZB 2BM1A 3CDAA 4X65F 3QGHA 4OYWA 1KLMA 1VRUB 1FI4A 5KFLA 2ZC4A 1M1HA 1BC6A 2Y0BB 3N6MA 4R0JA 5HP1A 1REVB 2C2MB 1HA1A 5AXNA 3KG0A 2J0WA 5KFJA 3KJVA 4Q45A 4E0DA 4K4VA 4DSKA 3BDPA 3LALA 5C2CA 2RH3A 1LWEA 4RWWA 3OL9A 4X4SA 3KHLA 1TV6B 3AOCA 1QSLA 3OHAA 1F60B 2G2OA 1RA6A 4MIBA 5LMUJ 4NOHA 3CJ3A 3G2XA 2CIMA 3JAMU 3M8RA 4WP3A 4DV5F 1SCJB 2FTRA 4DPWA 2IAJB 2FLOA 2MZQA 2MHEA 3EX7B 1JK9B 3ONQA 1XNRJ 2B4VA 1FDBA 1RE1B 3DOMA 3R97A 4NLRA 1U2FA 5HQLA 2KG1A 3PEHA 4USJC 4Y3CA 1QAIA 3D6MB 1L3UA 2P9GA 4NEYA 4WK1A 3W3SA 2IRUA 4YB6A 2AEJA 3CO9A 2HHHF 1Q79A 4CLYA 4DJBA 4HKQA 2ZWOA 1UEUA 1NKEA 2G1HA 1YBAA 2B7CB 4C8NA 1S49A 2MKKA 3P5TL 2DH8A 2GMHA 5FJ4A 1ZTTA 3EYZA 4F26A 5ADZA 1RAEB 4AE5A 4KE5A 1NK5A 5BYRA 3DYAA 3EZOA 5C2GA 3I96A 1KVJA 3LA0A 1T9YA 1BWVA 5A8RA 3BSAA 1ITPA 1A6LA 2CPFA 1RWKB 2C2NA 5DLGA 2JLFA 3L9ZA 3OXFA 5D8HB 4RW7B 3TAPA 1IKVB 3P96A 5B0FA 3BKFA 1ZBTA 1QVFR 3DI6B 4I4BA 4EFAC 1Q1KA 3PJ9A 5IQ6A 3OUYB 1DLOB 2ERRA 2NR0A 2W8LA 1HPZB 2Z2YB 5IXUA 4GO5X 2UVRA 4HHUA 2H9ZA 3Q89A 1S6UA 1BWEA 3GTYX 1JLEB 1JLQB 3EPIA 1K0VA 2KFZA 2GV1A 3N0VA 1T03B 2V2VA 2DR7A 3SV4A 2GIFA 4GKKJ 4HVZA 3N5FA 4EZ9A 4F4XA 2IMOA 3ITHA 1I51B 3EVOA 3DLGA 3KXDA 4J91A 3VAFA 1N88A 1R43A 3M2UA 3MTJA 3AXKA 3J7AN 2X51A 3V6JA 5GVQA 1KC8T 3CJKA 3QGIA 2B51A 3OJSA 1RHMB 2XM3A 1HNXF 3WBZA 4DPOA 2UXDF 1HNIA 3T1HF 1H6KX 2ZH6A 5HBMA 2YNFB 4OZ3A 2MDAA 1JLAB 4CLUA 3B6BA 2ZEJA 4ED6A 5D4PA 3DNCA 4PABA 2VPZB 5ETKA 1FKOB 3MECA 2PA8D 3C16B 2KKHA 5D78A 2LYVA 3LO3A 4DV3F 1NB2A 4IH5A 4NLYA 3NCRA 4IR9A 1C0TB 1FHTA 3M6WA 3CD5A 3OL6A 3PRDA 4BHQA 1N48A 2GA7A 3M2RB 2WK4A 3DRSA 3TQEA 4F4YA 2WVDA 2FC8A 2R8KA 4Q0BB 2BUNA 5AXLA 4HI2A 4OLOA 4F3MA 2CQIA 2AX1A 2ZBCA 3OFGA 1S9EB 1VC6A 4OX9F 2V2ZA 2HVZA 1YI2S 1OS5A 2VG7B 2B7BB 4ECTA 5KT6A 3GYNA 3FQLA 4PPDA 3ZZYA 1MU2B 1SVDA 2KB2A 1NDLA 4ED4A 2XLIA 4DV7F 1FCAA 1D8YA 2YVSA 1FVQA 3K17A 3O8WA 2V4QA 5DGBA 4ECUA 2GAGC 3OTCA 3CCTA 2WVCA 3RRHA 3NG8A 3HJFA 1N5YA 4M5DB 3BBFA 4F0MA 2B5JB 5HL7Q
chains in the Genus database with same CATH topology
4QIFA 4XDDA 1U48A 3T5JA 2BACA 4U7CA 4WFBQ 2CQHA 5L39A 1MW7A 3DDNA 3CMAS 4ES1A 1S72S 2RJZA 1BQXA 1FJCA 4DR6F 2NUUG 2VZ9A 4XAKA 1OQ6A 1TVRA 1QUPA 2HHXA 5J1EB 2AX0A 1JJHA 4NLGA 3IG1B 3NGDA 1WTFA 3D5MA 4G1PA 2XY7A 2HS3A 3RRGA 1FK9A 1X5TA 2MJUA 4N47A 2GJIA 5J2QA 2V8GA 4I1TA 4HH1A 2FJVA 2K1RA 1LK5A 1TL1B 2B4PA 3WX4A 3BGRA 5K8NA 1W2BR 4ZPWR 2UUBF 3IN5A 1HBOA 4RBUA 4A48A 3UNGC 5I3UB 1ZZNA 3I87A 3IR6B 4RNNA 1FTCA 2PDAA 3OVSA 3CCUS 2YWFA 1H7XA 5KFOA 3TANA 3GV8B 2LCWA 2AV5A 3SFUA 2NQPA 3MPWA 4KQZA 1QAJA 3MM8A 1Q82T 1Y5NB 1HQEB 3FSIA 1D8ZA 3RTVA 4RW4A 4CT9A 2CKWA 3Q23A 1AROP 4K4ZA 3MMAB 3FCHA 1G3OA 1Y5IB 2YNFA 4YFUA 3Q24A 3KNAA 1OSDA 1GT8A 1N6QA 1JLAA 2RVJA 3DRXA 4ZHRB 1U1PA 3V6HA 1RTIB 3CCES 4DR7F 1MMDA 4XK8C 3K5OA 5KFUA 2RSQA 2N4DA 2I38A 2RKIB 3LP2B 2PE8A 1U26A 1FKOA 5KTQA 4TY8B 4LFCF 4NLVA 2XY5A 3PXGa 3MURP 2W24A 4IO1A 4B3OB 1YVFA 3MM9B 4H4MA 4N8NA 2R7WA 2RS2A 1M5KC 3GB0A 2Q6BA 1FRXA 4ES2A 1S6QB 2VOPA 4FF2A 3LANA 5K8OA 2OTJS 2KFYA 1LFWA 4UW2A 1HBUB 4AFFA 5DQHA 4DFKA 3PHEA 4QWDA 2OIHA 2PC6A 2ADCA 5AE1A 2WCXA 2QA4G 2IBKA 2DNPA 2JFKA 1SL2A 4WKYA 4JI2F 4IQXA 1X4DA 5EWFA 1C0TA 1WF0A 5KG3A 1R8BA 1NK6A 4YY3F 1MWYA 1RTDB 4CTAB 2CQ4A 3LH2S 4G1QA 2G9OA 3M2RA 3NBPA 1UVKA 4HT5A 4YOEA 3SQGB 2CZVC 4N8OA 3IWNC 2D3OR 3PFEA 4DL0C 4OJ1A 1S9GA 2R7QA 4IR1A 2J6TA 4C11A 2MQMA 4USHA 3T5KA 1H0HB 1UMJA 2DNNA 3DOKA 3T9NA 2DK2A 4P7VA 5KFDA 3ICLA 4Q0BA 5GAGU 1HFEL 4MK8A 2B6AB 2FDNA 3MM7A 3M30A 1Y3JA 2HIQA 4I64A 2B43A 3VAIA 3IGVA 2OFHX 5GMKa 4DL5A 1DBDA 4PG4A 4LVOP 4QWBA 1B0TA 2LDIA 3C6TA 4ITSA 2ZHBA 1S9EA 2LEAA 1G7CB 1S76D 3I0RA 2R2TA 2M88A 1SJ4P 2XWXA 4ZKAA 4FXDA 1TKTA 3IA0A 3M05A 2MMYA 2E66A 1YRUA 1T94A 4BWMA 2VG7A 3ULHA 1WHXA 4OLPA 5C42A 2KZZA 4RBTA 3R1HA 2PGCA 1RT5A 1NK4A 3M1VA 3SV3A 1TKXB 2ASDA 1EETA 1MU2A 2MGZA 5A6WA 2RIJA 3MI7X 5LMNF 3AB4B 3SCIE 4E8UA 1SV5B 3M9MB 2HNZB 5FD1A 3O3LA 4F02A 4LQ3A 4NCGA 4PQUA 2UP1A 1S79A 5KG0A 2Z2MA 3BREA 1DQ9A 3E01A 1FDNA 2N7YA 3MEDB 4AL6A 2QE5A 3U7JA 4L6V3 3Q8SB 2XI2A 3KK2B 2ALZA 2J9DE 2VG5A 4HI1A 2H5EA 7FD1A 2ZM6F 2XMKA 2DNRA 1X5SA 2C3MA 5F8LA 3G71S 3PDNA 4ED7A 3HVWA 1IR0A 4DQQA 1C0UA 4FS1A 2VC0A 2J5AA 1UA0A 3UFCX 4M8LA 3ZZUA 1U7LA 2CFXA 5IM0B 3MXHP 3MM5B 2FGOA 2PMHA 1NK7A 1GX5A 1Z4UA 2MZJA 1PILA 2GCFA 1FKPB 4IH6A 5JVHQ 4F4ZA 5B0BA 1S6OA 2BBEA 1T8EA 4M95A 2DNMA 3UE2A 2GQQA 1TR0A 4NMLA 4M5DA 3PVXA 5DDPC 4F3OA 1GX6A 1E6VB 2ACYA 1R7IA 4LSLA 2B5JA 2MKSA 2MKJA 2XMVA 1JLCB 1RISA 3CWJA 1Y9OA 2ADBA 1IN0A 4TKTA 1YWXA 1UP1A 1LQ9A 1U1NA 1URNA 2ASYA 2DHXA 1HL6A 3OR1B 1KVIA 2R7XA 3BM7A 2M2BA 2A1BA 4PPZA 4YQWA 5J1EA 4ED5A 1K9MT 2JX2A 3IG1A 4MAKA 1C4CA 1R6YA 2VKRA 1SL1A 1GTHA 3OFFA 5KFMA 2COLA 1T3OA 3V4IB 3TQ1A 3KHHA 4J9SA 1ULRA 1S6PB 1TL1A 1U6FA 4P2SA 4MKYA 2HFOA 2ILYA 1G6BA 1OIAA 4YR2A 4WZQA 5I3UA 5IQQA 1VQPS 4RNHA 4TLRA 3KK3B 4ZPBA 3Q2SC 3HHLC 3BGLA 1RKJA 3MUVP 2DGXA 2JVRA 5GADI 2JFDA 3OR2B 2HHQA 1HW9A 3ISND 5EWGA 4PWDB 2R2SA 3MTKA 1TQLA 5LSOA 4F8RA 1HQEA 1HBMB 2DITA 2E1RA 1Q81T 4IO9Q 1UJ6A 3AQPA 3KLGB 3MMAA 4ES3A 3E2EA 2R8JA 4ETZA 1Q53A 2GO8A 2KVIA 2NUHA 3DHXA 4KV8B 2X1BA 5CYQB 1X9SA 1N56A 1Q16B 2FVCA 2M4MA 1HMVB 2ROPA 3MCSA 5BYQA 4DHVA 4ZHRA 5JUMA 1KHWA 1RTIA 2BM0A 3S6EA 2R2UA 4FPRA 4MYUA 1Q86T 2RKIA 2K2PA 5DG7A 3LP2A 1M5OC 4IFYB 4V19J 2XNRA 3VCDA 2KFNA 4TY8A 3SSRA 2WTFA 3SI8A 3RR8A 2DGVA 4PG6A 2CJAA 2LDYA 2QA4S 4B3OA 3MM9A 4LMZA 1KEKA 1VRTB 4B3RF 4OI2A 4X4RA 4ECSA 1HHSA 1S6QA 1WEZA 3NKYA 3OVAA 2VQEF 1HBUA 1Y4ZB 3HX9A 3C3LA 1NK8A 4RUAA 1VQMS 1Q8IA 2EG1A 1LW2B 2DIVA 3EGWB 5H9EJ 4ILLA 3MPVA 1RTDA 4QIWD 4CTAA 4L72B 1X4AA 3DCAA 5IZHA 1HWKA 4WK3A 5D4OA 5CXTA 5CYMB 3SQGA 4DV4F 1O51A 3BR8A 2IM2A 1P8GA 2MQOA 2AD9A 1VQNS 2FVRA 1FF2A 4F2RA 2NSCA 3TO8A 5HMXA 4LIRA 4UOCA 1KOHA 4ETXA 2B6AA 3CF5Q 1F5AA 4TYBA 2EFNA 2CPHA 3SXLA 3UW1A 3A1YG 2ZJRQ 1G1XA 4JI4F 3G9CA 4HYKA 3D1HA 2ZKUA 3GR0A 2YKAA 2I1RA 3K8VA 2AJ1A 1HNVB 5J2PB 5B09A 4Q43A 3PRBA 2LEBA 5F8NA 2RILA 4DR2F 4FBUA 3S8SA 4N5SA 4QIEA 3NNCA 4JI0F 2EFQA 1T05B 3IFEA 1TKXA 3J7YU 4Y00A 4D3GA 3UWTA 4MK9A 4ID8A 1SV5A 2HNZA 4WYWA 4OI0A 2G13A 1YJRA 3TUZC 1N5VA 1S10A 2HGNA 3FSXA 2MZSA 4B9SA 4N56A 4V19X 1KRPA 2DHAA 4I2QA 3PJWA 3KK2A 3PW7A 2XHWA 3M4XA 4ZS6A 2NREA 3FRZA 1WEYA 3KHGA 2QT7A 2OAUA 2VD3A 4JUZA 2P9EA 4G3IA 4HL9A 3S7RA 4ECRA 3BJYA 2DNYA 2MPUA 2WB1D 2WSCC 3CC2S 2DPJA 4OI3A 2RE1A 3AA8A 4L3NA 5IM0A 3MM5A 3MUTP 3JYTB 2I2YA 2L9NA 1FKPA 4AL7A 2J9EA 3T6JA 1FNOA 3VZIA 4D3HA 2RU3A 3NAHA 4ZPCA 3B78A 3LAMA 4O3RA 4LFBF 1FERA 2U1AA 3K2YA 1U47A 1E6VA 2YKPA 3MDFA 1SJ3P 2IM0A 2FJDB 4UUXA 3JB9k 1JLCA 3K5LA 2JHEA 2XLJA 4YB1P 3LP1B 3BR9A 1TKZB 4Y28C 4NL5A 3OR1A 2JEGA 3G4SS 2CQGA 2HLTA 3AQOA 4OZNA 2C3PA 4Y2KA 2WRMA 2F1FA 4WFYA 3QZ8A 4B9TA 1RT6B