1AEYA

Alpha-spectrin src homology 3 domain, solution nmr, 15 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
b'GKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN
publication title 1H and 15N NMR assignment and solution structure of the SH3 domain of spectrin: comparison of unrefined and refined structure sets with the crystal structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1997-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1aeyA00
5IHKA 1MV3A 4RTUA 1SHGA 2GTOA 2PNIA 4K11A 4GLMA 2ED0A 2ED1A 3EHQA 2OI3A 3I5SA 4M4ZA 2AZVA 2RN8A 2C0OA 2DBMA 4A63B 1V1CA 1UUEA 1OPLA 2DM1A 2KT1A 2ROTA 2K2MA 1BB9A 2RQUA 1XOVA 2GGRA 3C0CA 1UJ0A 1S1NA 4AFZC 1B07A 4QT7A 4J9BA 1AEYA 2M51A 1CSKA 2X3XD 2H8HA 4D8DA 1UG1A 2D8HA 2AZSA 1WXTA 1AWOA 2RQTA 2EYWA 2X3WD 5EC7A 1U06A 2EGCA 2F2XA 1WLPB 2OAWA 2O88A 2JM9A 1W6XA 1G83A 2CREA 2YUNA 4IIMA 4RTWA 1X2QA 2F2WA 2O9SA 4AFSC 4LUEA 1OEBA 2VKNA 5IHNA 1K0XA 1AWXA 1M3BA 1ZUUA 2FO0A 5HCKA 3PVLA 3VS0A 5IXBA 1NM7A 2KE9A 1VYUA 1Y57A 1N5ZA 2C0IA 4J9EA 4LE9A 4HXJA 3SHWA 2LJ0A 4J9FA 2LMJA 1I0CA 3NGPA 1GRIA 2DA9A 2RQRA 1QKWA 4X1VA 3IQLA 2SEMA 1Z9QA 2J06A 3VS1A 2ESWA 4CC4B 1WDXA 1NLOC 1UECA 2KRSA 5I22A 1WIEA 1AWJA 1WXBA 2EYYA 1SPKA 3M0RA 2CUDA 4HVWA 1SSHA 1JU5C 3UA6A 5FW9A 2EVRA 1WFWA 3I9QA 1K1ZA 1PRMC 2DE0X 2KYBA 4JZ3A 3FJ5A 2CH4A 1E6HA 2RNAA 4HVVA 3TSZA 1JO8A 1KSWA 2V1RA 2FRYA 2J6FA 1OPKA 2HDAA 4J9CA 3H0FA 1G2BA 3LH5A 2DILA 2HBWA 2VWFA 1WX6A 1QLYA 1RUWA 3EG1A 1GBQA 1YNZA 1JXOA 1ABOA 2DNUA 2I0NA 1UHFA 1GL5A 3JV3A 3U23A 1OOTA 2J6OA 2MOXA 1YCSB 2EQIA 2RMOA 3REBB 2D1XA 1TUDA 2FG0A 3CQTA 2DMOA 2LZ6B 1KJWA 4KRTA 2HEQA 1ZX6A 1GCPA 2EYZA 5GJWB 2JM8A 2DL5A 1NYGA 3EG3A 4RTXA 4LUDA 1T0HA 1QWFA 2EW3A 2NWMA 3RNJA 2F2VA 1NYFA 1YP5A 1BBZA 1MUZA 2PTKA 1WYXA 2CDTA 1WA7A 1NG2A 5FWCA 2FRWA 1ZLMA 4J9HA 1X69A 4HVUA 2QDLA 1ZBJA 2LJ3A 2KT8A 3UF4A 2K6DA 2V1QA 4JJCA 4HCKA 4R0KA 3TSWA 2FPEA 1SRLA 1ZUKA 1YWPA 1EFNA 2DVJA 4F17A 2GTJA 2JS2A 1M27C 4Y92A 1IO6A 2PZ1A 2O2OA 3H0HA 2C0TA 4IIOA 4JJDA 1TUCA 4D8KA 1ABQA 2JMCA 1TG0A 2D0NA 4RTVA 3THKA 1UE9A 1J3TA 2LQWA 1E7OA 3M0SA 1T3LA 2NUZA 4F16A 1H3HA 2EYXA 1AVZC 4CC3A 1X27A 1ZUYA 2DX1A 1W70A 4OMMA 2K3BA 1QCFA 1LCKA 2BZ8A 4WCIA 4RTTA 2K79A 1H92A 2GBQA 1GCQC 1HJDA 3EHRA 1JEGA 1BU1A 2L3PA 4OMPA 2EKHA 2LNHB 2KNBB 4Z8AA 1I07A 2E5KA 1GBRA 2K9GA 2J05A 2XMFA 1ZSGA 2A37A 1RI9A 4OMQA 2BZXA 4JPBW 2LX7A 5IH2A 1PWTA 3VS3A 2YUQA 3I35A 1UDLA 2AKKA 1K4US 3NHNA 1T3SA 4AFQC 2MCNA 2ECZA 2L3SA 4CC2A 2DJQA 3EG0A 3ULRB 2LCSA 1PNJA 4DEXA 3A98A 1M8MA 2KR3A 3UA7A 1U3OA 2AKLA 3EGUA 2CT3A 2SRCA 3M0UA 3M0QA 2DL3A 1RLPC 1M30A 1X43A 2YSQA 2BZYA 2KYMA 3SEMA 5I11A 3H0IA 3VRYA 1NEBA 2DLPA 3QWYA 1HD3A 1M3AA 2P4RA 4OMOA 5IHIA 1JXMA 3VRZA 1YN8A 1SRMA 2J7IA 1AZEA 1X6BA 3TVTA 1PRLC 1KIKA 2DRKA 3PE0A 4JJBA 1K76A 2VVKA 3H41A 2M0YA 2LJ1A 1CKAA 2DL8A 1KFZA 4DEYA 2OJ2A 2A36A 1Y0MA 2RQVA 1I1JA 1YWOA 3VS5A 2GNCA 2B86A 2CSQA 2HCKA 1MV0B 2JMAA 1T0JA 4E6RA 2KRMA 2W10A 2ROLA 4AG1C 4JZ4A 4GBQA 2HSPA 4RUGA 1BK2A 1K9AA 3VS6A 2ENMA 3VS7A 1HSQA 1NLPC 1VYVA 3M0PA 2FPFA 2AK5A 3GBQA 1X2KA 3VS4A 2EGAA 2DYBA 4J9IA 3PVQA 3REAB 2W0ZA 3ZL7C 2DL4A 4AG2C 1SEMA 4CC7A 5ECAA 2FEIA 1UJYA 2JTEA 1A0NB 2L0AA 1M3CA 5GJVB 2JXBA 1UFFA 1WI7A 1QWEA 2IIMA 1WXUA 4EIKA 1W1FA 2D8JA 2JT4A 1QKXA 2J6KA 2LQNA 2RF0A 2CSIA 1U5SA 1GFDA 4OMNA 3QWXX 2CUBA 2YT6A 3EG2A 2L3QA 2A08A 4F14A 1GFCA 1B3QA 2JS0A 1JQQA 4AFUC 5FWBA 3UATA 1E6GA 3NPFA 1SHFA 1FYNA 1PKTA 1RLQC 2O31A 1PKSA 1VA7A 2KBTA 2DL7A 2KROA 3NMZC 2JW4A 2ABLA 4OMLA 2EGEA 2MIOA 2KRNA 2CT4A 2BTTA 2YUOA 2DRMA 1AOJA 2KXCA 4ORZA 1OV3A 1AZGB 3RBBB 2GQIA 1PHTA 4LNPA 1UHCA 1CKBA 2EBPA 3O5ZA 3R6NA 1X6GA 4Z88A 1ARKA 1UTIA 2RPNA 2YDLA 1H8KA 2RQWA 1K0SA 4RTYA 2A28A 2FPDA 1VYTA 4ESRA 2G6FX 4RTZA 2O9VA 5IXFA 1FMKA 3I5RA 4Z89A 4J9DA 1UGVA 1AD5A 4J9GA 4FSSA 2KGTA 2DF6A 1NEGA 3M0TA 2CH4W 2YUPA 4LN2A 2L2PA 3VS2A 1AWWA 1GCQA 2K7AA 5L23A 1Z9ZA 2DBKA 2KXDA 2EPDA 2LP5A 3KFVA 2KEAA 4ZNXA
chains in the Genus database with same CATH superfamily
5IHKA 4RTUA 1NJIU 1SHGA 3I56Q 4PJOD 4GLMA 3CCMQ 3EHQA 5KYUB 3I5SA 4E7IA 4HT9A 1VIEA 1M90C 2NUTB 3L1AA 5GAN2 3PT9A 2QEXQ 2KDSA 2QTXA 3MPUB 4A63B 1UUEA 3TEEA 3BE3A 5A0GA 5GAMg 4M78B 4JS4A 1QQJA 2RQUA 3RKYA 1M1FA 5FRMA 5GAN6 1VQ9T 1NPRA 4F7UB 4MDXA 3C0CA 2EJGA 3JSCA 2VYTA 2D9TA 1B07A 2X4JA 4QQ6A 1AEYA 2X3XD 5GAN5 5GAMj 3CCUQ 2AZSA 1PD0A 4O6JA 4Z02A 4FT4A 2ZPHB 2RJFA 4M7AD 3CCVQ 2LT4A 5EC7A 1U06A 2EGCA 1WLPB 2O88A 4ZGJB 2JM9A 1W6XA 1ZA2B 5DLOA 1WPYA 3CCJA 2O9SA 2LCCA 4AFSC 4M7DF 3CCQA 3GIBA 3A8LB 1OI1A 4M75G 2K3XA 1ZUUA 2FO0A 4ZTJA 3VS0A 2ZPBB 2I2LA 2ZCFB 5DM7R 2C0IA 2RI3A 4J9EA 2DERA 1C1AA 2DFUA 3I56T 3CCMT 1GRIA 2E10A 3UDCA 1C6VX 2WSFE 3IQLA 1YCYA 4R56A 3HHTB 4Y28E 4IUQA 1NLOC 1UECA 3JCMb 4J6XA 2DXTA 2EYYA 5KYYA 2CP3A 2LRQA 4JRKA 2K4YA 3M0RA 2CUDA 4C92C 4M7DB 1OQKA 5CVIA 5D6WA 4VUBA 5GANh 1WFWA 1K1ZA 2VUBA 1SSFA 2KYBA 4LDXA 1E6HA 3OYBA 3LWIA 1JO8A 4E7HA 2QGFB 1Y71A 3FB9A 4J9CA 4C92F 2DILA 3CCVT 3JCMQ 3QJYA 3RKWA 1ZSZA 1WX6A 1QLYA 3EG1A 3HKSA 1GBQA 1ABOA 3HFNA 1WHHA 4M77G 2MK5A 1NPPA 1VUBA 4X34A 3REBB 2D1XA 3CQTA 4EMKC 2LZ6B 3FJPA 1NJIC 2P4TA 2MWOA 1M2OA 1ZX6A 1VQ6A 5KYXA 2F1LA 1T0HA 2AIRB 3G6EQ 4MMKA 4XTVA 1VQPQ 4OB1B 5GAN4 4C92B 3AT1B 4M78D 3M54A 4J6YA 3CD6Q 2QDLA 5LJ5j 3X24B 4QKUA 5FU6B 1WHLA 1ZBJA 4FW2A 1YJNQ 2OTLQ 1RADB 3M53A 4XU1A 4JJCA 3GPLA 1V76A 1P92A 5GAOn 3E2UA 2L8DA 4XTYA 4RCBA 2JTMA 1EFNA 2JS2A 1M27C 4C0DB 2DD4A 3AHUA 2PU9B 2JMCA 2RJEA 3OW2P 2A3LA 3THKA 4IURA 1E7OA 3KUFA 3WXMB 4F16A 3CCSQ 1OZ3A 1VQ5Q 3VYHB 7AT1B 1KQ2A 1I5OB 4CC3A 2DX1A 4OMMA 2K3BA 4KUDK 1QCFA 5A0DA 1LCKA 4JDSA 2E64A 2K3YA 4EMKB 2CZ7B 1H92A 1K9MR 1GCQC 3SDZA 1YITQ 1BU1A 2L3PA 1IHWA 2LNHB 2FVUA 1GBRA 1AT1B 3CCEQ 4NS5A 2J05A 1TH7A 1Y7XA 3ASKA 3FRNA 1RI9A 5GAMd 4M75E 3L2WA 3JCMg 4QQGA 1RI0A 2CZ0B 4EMHA 5GMKi 3G6ET 1UDLA 5CCAA 1VQPT 2AKKA 2O01E 1X01A 1VQ4A 3C4SA 3NHNA 2DXUA 3FIFA 4AFQC 4DBRA 2ECZA 3EAEA 2Y4YA 2DXCA 5HY6A 1QVGP 3TREA 3Q1JA 3ULRB 1YJNT 4M7DD 4PFZA 1MNEA 2K5IA 1KC8C 2FZCB 3MEUA 1U3OA 5CAIA 2AKLA 3HRTA 4PJJA 2BE7D 2EWNA 1O9SA 2O4XA 2RJCA 1X43A 3JCMe 1FX7A 2H3EB 2BZYA 3EFRA 1QW1A 3CCST 4OB0B 1VQ5T 3VYGA 3QWYA 2DLPA 3MP1A 3CMAQ 3VRZA 2FYKA 1SRMA 3ME9A 3HP9A 1D1CA 1KIKA 1B34B 2DZ9A 4C8QA 3H41A 2M0YA 1CKAA 3T9NA 4HT8A 3HRSA 4DEYA 2OJ2A 1Y0MA 3VS5A 1I1JA 3CCET 3CXCS 3RIRA 3FEOA 2HCKA 2KI7A 4E6RA 4JRPA 5CK9A 2RI5A 2CS7A 2ROLA 4GBQA 4M77E 5LJ3h 1BK2A 1IZ6A 2BUDA 1WHJA 1TOVA 5KE3A 1ACMB 1X2KA 1FXXA 3QJ6A 4MZMA 3CCRA 4C92D 3CC2Q 3QO3A 3ZL7C 4AG2C 3OY9A 1SEMA 1M1KU 2G3RA 2MWPA 3CCLQ 1G3SA 1UJYA 2JTEA 1QVFS 2M1HA 1RAAB 3SB2A 1W1FA 1B7TA 1QKXA 1XJWB 2LQNA 3RERA 4OMNA 3QWXX 2A08A 5GAOp 1SF9A 4M75C 3EGDA 2KVQG 1JQQA 2RI2A 3CMAT 4AFUC 1W4SA 5CKDA 4XTWA 2R57A 1RLQC 3NTIA 1V29B 2HZYA 2V8JA 1EIFA 1MMGA 1AHJB 2ABLA 3UT1A 3CPWS 5GMKj 2MIOA 2XHCA 2LVMA 5C0MA 3A8GB 3HPWA 2QGGA 4OF1A 2RO0A 3HFOA 1XTDA 4LDVA 4Q5WA 3RUXA 3JCMf 3X26B 3TCJA 3RBBB 1PHTA 3M55A 1VQKQ 3CC2T 3ZFJA 4QVDA 1YIJA 3X25B 3O5ZA 2HMAA 1VQMQ 5J3BA 3CCLT 1X6GA 1G5VA 1UTIA 1GXIE 4IKFA 2EAYA 1ZBXA 2FPDA 3I55Q 1VYTA 4L5GA 2O9VA 1HXDA 4FW1A 4BB7A 3P8DA 4B6MA 3A8OB 4A4FA 5GAMh 5CO7A 2R5MA 1WHMA 4FSSA 2DF6A 2H3JA 2CH4W 3CMEA 1N8RR 4J83A 2K7AA 4M77C 3EG9A 4PJOA 2LP5A 2WACA 3UPUA 2KEAA 2HQXA 1M90U 4A54A 4PJLA 3WVDB 2IVWA 2GTOA 4K11A 2YWWA 2ED0A 2ED1A 2RHXA 2K5FA 2B8AA 4ZN3A 3JCMd 2AZVA 1VQNA 4E47A 2OAUA 1W2BS 2KT1A 2ROTA 1BI1A 3EFSA 1BB9A 2MMPA 3VKIA 2E3HA 3CPFA 2JJ9A 2GGRA 2WSCE 2LC4A 2DAQA 3L2ZA 4AFZC 3CC4A 3SWNA 1VQKT 4QT7A 1IGQA 1VQMT 1M1KC 2EYQA 1QMCA 2H8HA 4M7AA 5FU7C 2DIGA 1MMNA 3V7CA 3I55T 1WJSA 1I8FA 2BE9B 3J81E 1UG1A 2D8HA 1WXTA 4HCZA 1AWOA 1NE8A 1YHQQ 2FZKB 2HD0A 4ANJA 2OAWA 1VIFA 2LQKA 3CBMA 1X2QA 1MMAA 4LUEA 4C5IA 3X20B 1U8RA 2XDBA 5IAYA 1K8AU 2VKNA 3QXEB 3EH1A 1QCOA 3PVLA 3MJXA 2KE9A 1Y96B 4E2FB 4UC4A 1TS9A 5CQYA 5CIUA 2YXYA 3SHWA 4J9FA 2QI2A 1YI2A 1I0CA 4C5HA 2DA9A 2QEXA 1QKWA 2ZPGB 3F70A 3NTKA 2Z0WA 3VS1A 2ESWA 4CC4B 1WDXA 1XQHA 1G3TA 4C8QG 1WIEA 1WXBA 2M0OA 2RM4A 4XAXB 4PK4A 4BY6B 3OBYA 3E1SA 4DBQA 3JAME 5LJ3e 1JU5C 1RAGB 3JB9F 3UA6A 1NJIR 3QDFA 3PIOA 4JLGA 2V26A 5IT9E 1YJ9Q 4J8OA 3FJ5A 3CCUA 1D0YA 5LJ5h 2MPXC 4HVVA 4XTUA 2CP7A 2F5KA 5KH6A 5L8RE 3M56A 2V8KA 1EX4A 3LH0A 2HDAA 1WQWA 3D7SB 1YHQT 1NBEB 3L2RA 4BI4A 1JB0E 2AT1B 1YNZA 2DNUA 1JXOA 2QTVA 4XU0A 4N0AA 4BDZA 4PFOA 3JV3A 3U23A 4E7SA 2J6OA 1TSFA 1YCSB 2EQIA 2FG0A 5KYUA 2DMOA 5D6XA 2NUTA 3GF5A 5GJWB 3CC7T 2DEUA 2JM8A 3OMGA 1VQOT 2R58A 4WTOB 4M78A 4RTXA 1N6AA 4DOWA 4LDWA 1NYFA 1YP5A 1MUZA 4F7UA 2QA4A 2EIFA 1VQLA 1ZLMA 4J9HA 1X69A 2P0KA 1RAEB 1FMWA 2V1QA 1BYMA 2FPEA 1SRLA 2A0FB 1YJ9T 2RHIA 2DVJA 3CBPA 2GTJA 4Y92A 1IO6A 4AT1B 2O2OA 1QVPA 4IIOA 1ABQA 3C94A 1TG0A 1UE9A 2EQMA 3MP8A 1D0ZA 2NUZA 2K57A 3JCMW 2YHTA 4PLIA 4KUIA 2EYXA 2R5AA 1K8AC 4KT0E 3EGXB 4ELYC 1X27A 2BZ8A 1YBYA 1ZSZC 2EKOA 5LJ3f 2DD5A 4Z8AA 2E5KA 1YJWA 1TU0B 2PUKB 1Q81U 2WSEE 4MZTA 3HSBA 1ZSGA 3OW2S 1VQ8T 1ZQ1A 4NL3A 2LX7A 4PJOG 4DA4A 5DY9A 3OYIA 3OYHA 3I35A 4C0GA 3OYKA 3MHXA 3LWHA 3DKMA 1K4US 4A53A 1LOJA 5M9OA 3CD6A 3V8JA 4M7DA 1JJ2A 1KC8U 2DJQA 2OTLA 2LCSA 3QUIA 4J6WA 2Y90A 4L59A 1IXDA 1M8MA 2KSSA 1NZ9A 5CKBA 3EGUA 3MEAA 4ZGDB 2QQBA 3A8HB 1RLPC 3PMIA 1M30A 2YSQA 2KYMA 3SEMA 4D6WA 1QVGS 4M7AG 2CP0A 1NEBA 1HD3A 1M3AA 2P4RA 4NOYA 3QYHB 2QQ9A 2J7IA 4XK8E 3CCJQ 1Q82U 1AZEA 1N9RA 5CKFA 1YITA 2DRKA 2YLBA 2VVKA 1OYXA 2RHYA 4ATOA 2LJ1A 2DL8A 1KFZA 2A36A 3G4ST 4LD9K 4BD3A 2XG8D 2B86A 3QZ5B 3X28B 2CSQA 1MV0B 1T0JA 3JB9D 2HNIA 4AG1C 1K9AA 2ENMA 3VS7A 1PCXA 4C92A 1Q7YU 1NLPC 3S6WA 1SKUB 1RABB 5GMKh 2JNGA 2DXBA 4TVRA 4XU2A 1KD1U 3GBQA 3QYGB 3VS4A 2EGAA 4FYWB 1BKBA 1JJ2P 3LGFA 3J7AF 3G1JA 4C0ZA 1SG5A 5ECAA 1M8VA 2LDMA 1KHCA 4E7JA 4JLIA 2L0AA 3L2UA 2JXBA 2CKKA 2IIMA 5GAOm 2KAFA 3V7RA 2D8JA 2VASA 4XTXA 3PTAA 1U5SA 2X35A 4CI0C 2YT6A 5LJ5e 4HCBA 1KQ1A 1B3QA 2JS0A 2DZCA 4EMKA 4KH0B 3E9GA 3CCJT 2E5QA 3UATA 1HK9A 3CCQT 3VU3C 2RH2A 5GAN8 1FYNA 2X51A 2X4XA 3NMZC 3PGGA 1Q81C 3OS2A 3CBOA 2EGEA 4HA8A 2QASA 4PLLA 1LVKA 1VQ6Q 3BY7A 2BTTA 4EMGA 4R55A 2KXCA 2XDDA 2ZAEA 3CC2A 1Q86U 4BE2A 4ORZA 3C95A 1CKBA 4M78G 4PJOE 3G7ZA 2VGMA 4C0FA 2MI6A 3V8LA 1I4K1 2YDLA 4F7UG 1RL2A 2RQWA 1K0SA 2JVVA 2G6FX 2ZZDA 5IXFA 3I5RA 3SFMA 4PNOA 4J7IA 4LN2A 3DLLA 1AWWA 2L2PA 4IUVA 2ATCB 4PL6A 1GCQA 3M59A 5L23A 1M1KR 3DLMA 1B34A 1G3YA 1WJQA 2XICA 1Q82C 1N27A 5EG2A 3G71A 1OU9A 1MV3A 3V7SA 3META 5GANg 2PNIA 2DTOA 1O75A 5LL6S 3OYNA 3S3NA 2RN8A 2DBMA 1MGQA 1V1CA 2DM1A 3FDRA 5GAN3 2VXFA 3P8HA 4N4HA 1VQ6T 2BIVA 1Q7YC 1UJ0A 5LJ5f 2NLUA 1KD1C 1VQ4Q 1CSKA 4ZTFA 1WNLA 3QPHA 2FHDA 5GANe 5FLXE 2E41A 2JTFA 1U1TA 4M7DG 4N4IA 4XTZA 1JBMA 5A2QE 2KMTA 2F2XA 2CREA 2YUNA 3OS5A 4RCCA 2ZPEB 3L2VA 2XD0A 1Q95G 3CXCA 2GF7A 1WHGA 2HBPA 4RMOA 2YRCA 3LX7A 1K0XA 1AWXA 1VQ7A 1R8OB 1G8XA 1ZA1B 1D3BB 2KK4A 1NM7A 2OTJA 1VYUA 3MEVA 3QKJA 1Y57A 2FZGB 4LE9A 4N4GA 4FYYB 4M75F 1KQSA 3NGPA 4PJOC 1C0MA 3GP8A 4NL2A 3MO8A 3JCMV 1QVFA 3M57A 2E3IA 1Z9QA 1YFNA 2J06A 2KRSA 2RJDA 2EJ9A 2D0QB 5KYWB 3MEWA 3QHSA 1UGQB 2VGNA 4BACA 1SPKA 2GFAA 4HVWA 1Q86C 1M90R 1SSHA 1S72A 1VQ4T 5FW9A 2EVRA 1PRMC 2DE0X 5A0LA 4C92G 3CCRQ 2CP5A 1M2VB 2CH4A 2RNAA 1DJ7B 3TQ7P 2DKGA 2V1RA 2J6FA 4M75B 3H0FA 1G2BA 2DK3A 3LH5A 2EQUA 1G3WA 4JRIA 2HBWA 2BKDN 2QQRA 3BFMA 2VWFA 4M78E 4PJNA 3M58A 3SD4A 5I2MA 1OULA 2XU8A 3CPWA 1RACB 1RUWA 3HTRA 1UHFA 2P0PA 1PM3A 4OVAA 9ATCB 2HL5C 1OOTA 2RMOA 1TUDA 3LYIA 4DBFA 3GOXA 2HEQA 1KQSP 4M77F 2EYZA 5KCHA 5GMKl 2IG0A 1NYGA 2QK0A 5GANf 1VQ9A 4LUDA 2X4WA 2NWMA 3RNJA 2F2VA 3LW5E 4JJNK 1BBZA 2LTOA 1K8AR 2PTKA 3EH2A 1I5LA 2FRWA 2YRVA 3QIIA 4HVUA 1K73U 4IUTA 2HSEB 2LJ3A 2L5QA 3KBGA 4P5NA 2M16A 5IN1A 1JRIA 3CCRT 1ZUKA 2DVEA 2EFIA 4E7KA 1WZOA 2XKOC 1YIJQ 3H0HA 3RESA 2VC8A 3RMQA 4D8KA 1IHVA 2D0NA 4RTVA 4M77B 1J3TA 2E6ZA 1T3LA 3QSUA 1KK7A 5LJ3g 1H3HA 3HL8A 4XQ3A 4OB2B 3URGA 2QXFA 3I56A 4BE1A 2DIQA 1W70A 5HK0A 3CCMA 1Y96A 1W2BA 4M7DE 4WCIA 4RTTA 2GBQA 3CMEQ 5GANd 3A8MB 2DETA 3CC7Q 1HJDA 1LPLA 4OMPA 2YLCA 1IB8A 2EJFA 1VQOQ 2KNBB 1I07A 3H6ZA 2K9GA 3JRZA 4FU6A 2BZXA 3VJPA 4JPBW 5LJ3j 4MMLA 1PWTA 3VS3A 4J7FA 3L2QA 4ME7A 2LX9A 3RDVA 3EFOB 4LDYA 2RK1A 1T3SA 1VQNQ 2MCNA 4JUVA 2L3SA 1BIAA 5FU7B 4KGZB 3JCMc 1BCMA 4M78C 3BDLA 2NUPB 1PNJA 4DEXA 3VUBA 4A4HA 2KR3A 3UA7A 3CCVA 4KH1B 2SRCA 3CC4Q 1YIJT 3M0QA 1UGSB 4M75D 3VUZA 1X75C 5I11A 4KGVB 4F04B 2E12A 3RR6A 3N5BB 1ZHIA 3H0IA 4RKUE 3VRYA 2GCXA 2L89A 3BDUA 1JXMA 2HQHA 1X6BA 3TVTA 1PRLC 1WGSA 3JB9H 3CMET 1K76A 1R0BG 1VQ8Q 3QZ9B 3LGLA 4B9WA 1YWOA 4X9CA 3OYCA 4RG2A 2DTIA 3OYDA 5C6SA 3ER0A 2W10A 2FL7A 1BI3A 4GY5A 2QQSA 4JZ4A 2HSPA 4RUGA 3VS6A 1YI2Q 3M9QA 2RB6A 3C12A 1HSQA 1H641 1RAHB 1VYVA 1LJOA 1VQNT 2XIDA 2DYBA 3OSVA 4J9IA 3HRUA 3PVQA 4BUGA 3JB9J 1K73C 2DL4A 4CC7A 2EQJA 2FEIA 1Q81R 2LCLA 6AT1B 2QAZA 1N8RC 2DPPB 5KCOA 1UFFA 1WI7A 3CC4T 3VV0A 4M7DC 1QWEA 3JCMh 1WXUA 4EIKA 1KG1A 4GLKA 2QQAA 1BCOA 2J6KA 1OU8A 2P84A 2RF0A 3OSSC 2CSIA 3H9NA 3EG2A 4M77D 1JJ2S 4F14A 1KC8R 4LXCA 3EGXA 4E7ZA 4JS5A 5GAMe 2XI9A 3O8VA 4A4KA 2LNVA 3G4SQ 5FWBA 1MHNA 3NPFA 3JCMJ 3QBYA 1PD1A 1PKSA 4ZN1A 2KBTA 3G6EA 2JW4A 1VQPA 1MNDA 1N9SA 3GLXA 2KRNA 1YI2T 3MKDA 2CT4A 3S3OA 2QEXT 1OZ2A 5HKCA 1YJNA 2DRMA 1AOJA 1Q82R 1XNIA 4OGEA 5KYYB 1M9SA 1AZGB 2GQIA 2XK0A 2D6FA 4LNPA 1BI0A 4C8QE 3OYEA 3PIPA 2QA4Q 4Z88A 1VQLQ 4XU3A 2E4HA 2RPNA 2ZGWA 3JCMP 4OB3B 4RTYA 4Y91A 3ZEHA 3CCSA 5FU6C 4RTZA 4A4GA 1VQ5A 1F1BB 2MYSA 1Q7YR 2JUFA 4Z89A 4FYXB 5LJ3d 3OS0A 3CCUT 1OX9A 1AD5A 4J9GA 1KD1R 3P8BB 1ZSZB 2KGTA 4C0DC 3OW2A 4FM4B 3L42A 3M0TA 2YUPA 3VS2A 2AHJB 1RAFB 2HQEA 2V8IA 3JB9I 1PSEA 3CCQQ 4HCCA 3CCEA 2EPDA 2VV5A 3KFVA 1UGRB 1EZZB 2OI3A 3OYLA 4M4ZA 2GFUA 1WHKA 2PQWA 5LJ5g 2C0OA 5GMKm 5AT1B 2XDPA 5KYXB 1OPLA 1YJWQ 5CKHA 2K2MA 4QVZA 2DEQA 2VXEA 4MDWA 1XOVA 5HK3A 2CZ6B 8AT1B 5I2SA 4II1A 3FC3A 1S1NA 2M9UA 5GAMf 3JCMX 4J9BA 2HKQB 2QA4T 3DB3A 2M51A 1QVGA 4RG8A 3A1PA 1D1AA 1VQLT 2DTHA 3OYGA 4D8DA 2PVDB 2PVOB 2HKNA 2RQTA 2COYA 2EYWA 4DQ2A 1HYOA 2X3WD 3CMAA 4IIMA 1G83A 4RTWA 2F2WA 1Q86R 3OYFA 1OEBA 2C06A 1MMDA 5IHNA 1M3BA 1BI2A 5HCKA 5IXBA 3NFCA 1TUGB 1N5ZA 4EDUA 4HXJA 2LJ0A 4ELZC 3J80E 2LMJA 4BE0A 4PJMA 2RQRA 1TTHB 3OS1A 4C8QC 4X1VA 2SEMA 1YJWT 5GAN7 2VB6A 2DJZA 5I22A 1R77A 5GAOq 3JB9G 1AWJA 1M5Q1 4CRIA 3CCLA 5D7UA 2KY9A 2RA2A 4V2SA 4C8QF 1WQ7A 2MAMA 1UGPB 3I9QA 4OMFB 2OX7A 3CD6T 2RHZA 4QVCA 4FCYA 4JZ3A 5GAOr 1K9MU 3PNWC 1PC0A 2JZ2A 3TSZA 2OTLT 1KSWA 3TU4K 3OYYA 2FRYA 1LNXA 1OPKA 1H3ZA 1IREB 2RK2A 1IGUA 4A4EA 2O4XB 2NYSA 4KBMB 2DYIA 1UB4A 5FROA 4AMCA 2CYZB 2I0NA 1IRXA 2YRDA 3PMTA 1U1SA 1GL5A 2K5LA 4OGCA 3KXTA 2MOXA 3PFSA 5D6YA 4M7AE 1D09B 3A5ZB 4C5GA 4KRTA 1KJWA 4C8QB 1WJRA 1GCPA 1D1BA 2DL5A 1YITT 3EG3A 2CP6A 1M4ZA 1TXQA 1QWFA 2EW3A 4FIBA 1D0XA 1VQKA 1WYXA 2CDTA 1WA7A 1NG2A 5FWCA 5GANj 1VQMA 1Y07A 5DLQE 3I55A 2KQWA 2E70A 2KT8A 2M02A 3LLRA 3UF4A 2K6DA 4QW2A 1KQSS 4HCKA 4R0KA 4MZPA 3TSWA 1YWPA 2F5TX 4F17A 3QG1A 4LD6A 2PZ1A 3UWNA 2C0TA 3MP6A 4JJDA 1TUCA 3OB9A 5J26A 3INZA 2LQWA 3M0SA 2K2VA 3GNFB 2QDYB 1AVZC 1R0CB 1D3BA 4DOVA 1ZUYA 3EGDB 2JN0A 2K79A 3EHRA 1JEGA 3M4YA 4LDUA 2EKHA 2RHUA 5LJ5d 2XMFA 2PUOB 8ATCB 2A37A 4OMQA 4FSXA 3DB4A 3G71Q 5IH2A 4FL6A 2YUQA 5KYWA 1UEBA 1PG5B 2IPOB 2FB7A 4PJOF 3GNGA 4L6V5 1QP3A 4PFPA 4CC2A 2EQKA 4EPCA 5GMKe 2E6NA 1OX8A 1PSFA 3M4GA 4JRQA 3EG0A 4O5VA 2X9HA 3A98A 2F69A 1M2VA 2L3RA 2QG9B 4DBHA 2HL3A 1YHQA 3SWNC 2CT3A 1K9MC 4M75A 3M0UA 2P0QA 4YTLA 4M7AC 2DL3A 3CXCP 4F7UE 2COZA 2A7YA 2PVGB 1QCNA 1K73R 1VOMA 4OMOA 2ZPIB 5IHIA 1YN8A 2Y4XA 3CEYA 4PKCC 2JOYA 3OYMA 3CC7A 3OYAA 3EG9B 4PJOB 4C5EA 3PE0A 2QYZA 4JJBA 4M7AF 5J39A 3OYJA 1TWBA 1VQOA 3WVEB 1VQ7Q 3OBWA 2RQVA 2GNCA 5KE2A 1QVFP 2OTJQ 2JMAA 4C8QD 2E1HA 4B9XA 4BDYA 2KRMA 3G71T 3V8KA 1RAIB 2ZPFB 5CR2A 4WF2A 3M0PA 2FPFA 2DO3A 1M1GA 2AK5A 3FLGA 3R6OA 2HAXA 1YJ9A 4E7LA 3OMCA 1FWZA 1N8RU 3REAB 2W0ZA 2MF2A 3OQ5A 3E19A 3SWNB 1KHIA 1A0NB 4BY6C 5KYNA 1M3CA 5GJVB 1S72Q 4M7AB 4M77A 4BI8B 3OA6A 4BI3A 2JT4A 3ZBDA 5GAOl 3CPWP 2GQVA 1FMVA 1GFDA 4QQDA 2CUBA 5CQXA 2L3QA 4J5YA 1GFCA 4KULA 3S3MA 3BW1A 2CZ1B 1E6GA 1VQ8A 3H8ZA 4N0AC 1SHFA 1PKTA 2E65A 5I21A 2O31A 1VQ7T 1VA7A 2LT1A 2DL7A 2KROA 4OMLA 3M5AA 2OTJT 2X4YA 1BIBA 3RKXA 3EFOA 3E9FA 2YUOA 1VQ9Q 1X6OA 2LQ8A 1OV3A 2NUPA 2RD1A 1UHCA 2EBPA 3R6NA 4IUUA 4ZGEB 4FT2A 5FRNA 1ARKA 4IUPA 1H8KA 3QDRB 1S72T 1I81A 2A28A 5AYFA 4ESRA 4FYVB 4M78F 3RMSA 1FMKA 4J9DA 1UGVA 4C92E 4F7UF 4OP0A 4X9DA 1NEGA 2CP2A 4KGXB 1W2BP 1QP2A 3G4SA 3NTHA 1Z9ZA 2COWA 2DBKA 2KXDA 3MCAB 4HKEA 4ZNXA 2CGHA 5CKEA
chains in the Genus database with same CATH topology
5IHKA 1MV3A 4RTUA 1SHGA 2GTOA 2PNIA 4K11A 4GLMA 2ED0A 2ED1A 3EHQA 2OI3A 3I5SA 4M4ZA 2AZVA 2RN8A 2C0OA 2DBMA 4A63B 1V1CA 1UUEA 1OPLA 2DM1A 2KT1A 2ROTA 2K2MA 1BB9A 2RQUA 1XOVA 2GGRA 3C0CA 1UJ0A 1S1NA 4AFZC 1B07A 4QT7A 4J9BA 1AEYA 2M51A 1CSKA 2X3XD 2H8HA 4D8DA 1UG1A 2D8HA 2AZSA 1WXTA 1AWOA 2RQTA 2EYWA 2X3WD 5EC7A 1U06A 2EGCA 2F2XA 1WLPB 2OAWA 2O88A 2JM9A 1W6XA 1G83A 2CREA 2YUNA 4IIMA 4RTWA 1X2QA 2F2WA 2O9SA 4AFSC 4LUEA 1OEBA 2VKNA 5IHNA 1K0XA 1AWXA 1M3BA 1ZUUA 2FO0A 5HCKA 3PVLA 3VS0A 5IXBA 1NM7A 2KE9A 1VYUA 1Y57A 1N5ZA 2C0IA 4J9EA 4LE9A 4HXJA 3SHWA 2LJ0A 4J9FA 2LMJA 1I0CA 3NGPA 1GRIA 2DA9A 2RQRA 1QKWA 4X1VA 3IQLA 2SEMA 1Z9QA 2J06A 3VS1A 2ESWA 4CC4B 1WDXA 1NLOC 1UECA 2KRSA 5I22A 1WIEA 1AWJA 1WXBA 2EYYA 1SPKA 3M0RA 2CUDA 4HVWA 1SSHA 1JU5C 3UA6A 5FW9A 2EVRA 1WFWA 3I9QA 1K1ZA 1PRMC 2DE0X 2KYBA 4JZ3A 3FJ5A 2CH4A 1E6HA 2RNAA 4HVVA 3TSZA 1JO8A 1KSWA 2V1RA 2FRYA 2J6FA 1OPKA 2HDAA 4J9CA 3H0FA 1G2BA 3LH5A 2DILA 2HBWA 2VWFA 1WX6A 1QLYA 1RUWA 3EG1A 1GBQA 1YNZA 1JXOA 1ABOA 2DNUA 2I0NA 1UHFA 1GL5A 3JV3A 3U23A 1OOTA 2J6OA 2MOXA 1YCSB 2EQIA 2RMOA 3REBB 2D1XA 1TUDA 2FG0A 3CQTA 2DMOA 2LZ6B 1KJWA 4KRTA 2HEQA 1ZX6A 1GCPA 2EYZA 5GJWB 2JM8A 2DL5A 1NYGA 3EG3A 4RTXA 4LUDA 1T0HA 1QWFA 2EW3A 2NWMA 3RNJA 2F2VA 1NYFA 1YP5A 1BBZA 1MUZA 2PTKA 1WYXA 2CDTA 1WA7A 1NG2A 5FWCA 2FRWA 1ZLMA 4J9HA 1X69A 4HVUA 2QDLA 1ZBJA 2LJ3A 2KT8A 3UF4A 2K6DA 2V1QA 4JJCA 4HCKA 4R0KA 3TSWA 2FPEA 1SRLA 1ZUKA 1YWPA 1EFNA 2DVJA 4F17A 2GTJA 2JS2A 1M27C 4Y92A 1IO6A 2PZ1A 2O2OA 3H0HA 2C0TA 4IIOA 4JJDA 1TUCA 4D8KA 1ABQA 2JMCA 1TG0A 2D0NA 4RTVA 3THKA 1UE9A 1J3TA 2LQWA 1E7OA 3M0SA 1T3LA 2NUZA 4F16A 1H3HA 2EYXA 1AVZC 4CC3A 1X27A 1ZUYA 2DX1A 1W70A 4OMMA 2K3BA 1QCFA 1LCKA 2BZ8A 4WCIA 4RTTA 2K79A 1H92A 2GBQA 1GCQC 1HJDA 3EHRA 1JEGA 1BU1A 2L3PA 4OMPA 2EKHA 2LNHB 2KNBB 4Z8AA 1I07A 2E5KA 1GBRA 2K9GA 2J05A 2XMFA 1ZSGA 2A37A 1RI9A 4OMQA 2BZXA 4JPBW 2LX7A 5IH2A 1PWTA 3VS3A 2YUQA 3I35A 1UDLA 2AKKA 1K4US 3NHNA 1T3SA 4AFQC 2MCNA 2ECZA 2L3SA 4CC2A 2DJQA 3EG0A 3ULRB 2LCSA 1PNJA 4DEXA 3A98A 1M8MA 2KR3A 3UA7A 1U3OA 2AKLA 3EGUA 2CT3A 2SRCA 3M0UA 3M0QA 2DL3A 1RLPC 1M30A 1X43A 2YSQA 2BZYA 2KYMA 3SEMA 5I11A 3H0IA 3VRYA 1NEBA 2DLPA 3QWYA 1HD3A 1M3AA 2P4RA 4OMOA 5IHIA 1JXMA 3VRZA 1YN8A 1SRMA 2J7IA 1AZEA 1X6BA 3TVTA 1PRLC 1KIKA 2DRKA 3PE0A 4JJBA 1K76A 2VVKA 3H41A 2M0YA 2LJ1A 1CKAA 2DL8A 1KFZA 4DEYA 2OJ2A 2A36A 1Y0MA 2RQVA 1I1JA 1YWOA 3VS5A 2GNCA 2B86A 2CSQA 2HCKA 1MV0B 2JMAA 1T0JA 4E6RA 2KRMA 2W10A 2ROLA 4AG1C 4JZ4A 4GBQA 2HSPA 4RUGA 1BK2A 1K9AA 3VS6A 2ENMA 3VS7A 1HSQA 1NLPC 1VYVA 3M0PA 2FPFA 2AK5A 3GBQA 1X2KA 3VS4A 2EGAA 2DYBA 4J9IA 3PVQA 3REAB 2W0ZA 3ZL7C 2DL4A 4AG2C 1SEMA 4CC7A 5ECAA 2FEIA 1UJYA 2JTEA 1A0NB 2L0AA 1M3CA 5GJVB 2JXBA 1UFFA 1WI7A 1QWEA 2IIMA 1WXUA 4EIKA 1W1FA 2D8JA 2JT4A 1QKXA 2J6KA 2LQNA 2RF0A 2CSIA 1U5SA 1GFDA 4OMNA 3QWXX 2CUBA 2YT6A 3EG2A 2L3QA 2A08A 4F14A 1GFCA 1B3QA 2JS0A 1JQQA 4AFUC 5FWBA 3UATA 1E6GA 3NPFA 1SHFA 1FYNA 1PKTA 1RLQC 2O31A 1PKSA 1VA7A 2KBTA 2DL7A 2KROA 3NMZC 2JW4A 2ABLA 4OMLA 2EGEA 2MIOA 2KRNA 2CT4A 2BTTA 2YUOA 2DRMA 1AOJA 2KXCA 4ORZA 1OV3A 1AZGB 3RBBB 2GQIA 1PHTA 4LNPA 1UHCA 1CKBA 2EBPA 3O5ZA 3R6NA 1X6GA 4Z88A 1ARKA 1UTIA 2RPNA 2YDLA 1H8KA 2RQWA 1K0SA 4RTYA 2A28A 2FPDA 1VYTA 4ESRA 2G6FX 4RTZA 2O9VA 5IXFA 1FMKA 3I5RA 4Z89A 4J9DA 1UGVA 1AD5A 4J9GA 4FSSA 2KGTA 2DF6A 1NEGA 3M0TA 2CH4W 2YUPA 4LN2A 2L2PA 3VS2A 1AWWA 1GCQA 2K7AA 5L23A 1Z9ZA 2DBKA 2KXDA 2EPDA 2LP5A 3KFVA 2KEAA 4ZNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHK A;  1MV3 A;  4RTU A;  1SHG A;  2GTO A;  2PNI A;  4K11 A;  4GLM A;  2ED0 A;  2ED1 A;  3EHQ A;  2OI3 A;  3I5S A;  4M4Z A;  2AZV A;  2RN8 A;  2C0O A;  2DBM A;  4A63 B;  1V1C A;  1UUE A;  1OPL A;  2DM1 A;  2KT1 A;  2ROT A;  2K2M A;  1BB9 A;  2RQU A;  1XOV A;  2GGR A;  3C0C A;  1UJ0 A;  1S1N A;  4AFZ C;  1B07 A;  4QT7 A;  4J9B A;  1AEY A;  2M51 A;  1CSK A;  2X3X D;  2H8H A;  4D8D A;  1UG1 A;  2D8H A;  2AZS A;  1WXT A;  1AWO A;  2RQT A;  2EYW A;  2X3W D;  5EC7 A;  1U06 A;  2EGC A;  2F2X A;  1WLP B;  2OAW A;  2O88 A;  2JM9 A;  1W6X A;  1G83 A;  2CRE A;  2YUN A;  4IIM A;  4RTW A;  1X2Q A;  2F2W A;  2O9S A;  4AFS C;  4LUE A;  1OEB A;  2VKN A;  5IHN A;  1K0X A;  1AWX A;  1M3B A;  1ZUU A;  2FO0 A;  5HCK A;  3PVL A;  3VS0 A;  5IXB A;  1NM7 A;  2KE9 A;  1VYU A;  1Y57 A;  1N5Z A;  2C0I A;  4J9E A;  4LE9 A;  4HXJ A;  3SHW A;  2LJ0 A;  4J9F A;  2LMJ A;  1I0C A;  3NGP A;  1GRI A;  2DA9 A;  2RQR A;  1QKW A;  4X1V A;  3IQL A;  2SEM A;  1Z9Q A;  2J06 A;  3VS1 A;  2ESW A;  4CC4 B;  1WDX A;  1NLO C;  1UEC A;  2KRS A;  5I22 A;  1WIE A;  1AWJ A;  1WXB A;  2EYY A;  1SPK A;  3M0R A;  2CUD A;  4HVW A;  1SSH A;  1JU5 C;  3UA6 A;  5FW9 A;  2EVR A;  1WFW A;  3I9Q A;  1K1Z A;  1PRM C;  2DE0 X;  2KYB A;  4JZ3 A;  3FJ5 A;  2CH4 A;  1E6H A;  2RNA A;  4HVV A;  3TSZ A;  1JO8 A;  1KSW A;  2V1R A;  2FRY A;  2J6F A;  1OPK A;  2HDA A;  4J9C A;  3H0F A;  1G2B A;  3LH5 A;  2DIL A;  2HBW A;  2VWF A;  1WX6 A;  1QLY A;  1RUW A;  3EG1 A;  1GBQ A;  1YNZ A;  1JXO A;  1ABO A;  2DNU A;  2I0N A;  1UHF A;  1GL5 A;  3JV3 A;  3U23 A;  1OOT A;  2J6O A;  2MOX A;  1YCS B;  2EQI A;  2RMO A;  3REB B;  2D1X A;  1TUD A;  2FG0 A;  3CQT A;  2DMO A;  2LZ6 B;  1KJW A;  4KRT A;  2HEQ A;  1ZX6 A;  1GCP A;  2EYZ A;  5GJW B;  2JM8 A;  2DL5 A;  1NYG A;  3EG3 A;  4RTX A;  4LUD A;  1T0H A;  1QWF A;  2EW3 A;  2NWM A;  3RNJ A;  2F2V A;  1NYF A;  1YP5 A;  1BBZ A;  1MUZ A;  2PTK A;  1WYX A;  2CDT A;  1WA7 A;  1NG2 A;  5FWC A;  2FRW A;  1ZLM A;  4J9H A;  1X69 A;  4HVU A;  2QDL A;  1ZBJ A;  2LJ3 A;  2KT8 A;  3UF4 A;  2K6D A;  2V1Q A;  4JJC A;  4HCK A;  4R0K A;  3TSW A;  2FPE A;  1SRL A;  1ZUK A;  1YWP A;  1EFN A;  2DVJ A;  4F17 A;  2GTJ A;  2JS2 A;  1M27 C;  4Y92 A;  1IO6 A;  2PZ1 A;  2O2O A;  3H0H A;  2C0T A;  4IIO A;  4JJD A;  1TUC A;  4D8K A;  1ABQ A;  2JMC A;  1TG0 A;  2D0N A;  4RTV A;  3THK A;  1UE9 A;  1J3T A;  2LQW A;  1E7O A;  3M0S A;  1T3L A;  2NUZ A;  4F16 A;  1H3H A;  2EYX A;  1AVZ C;  4CC3 A;  1X27 A;  1ZUY A;  2DX1 A;  1W70 A;  4OMM A;  2K3B A;  1QCF A;  1LCK A;  2BZ8 A;  4WCI A;  4RTT A;  2K79 A;  1H92 A;  2GBQ A;  1GCQ C;  1HJD A;  3EHR A;  1JEG A;  1BU1 A;  2L3P A;  4OMP A;  2EKH A;  2LNH B;  2KNB B;  4Z8A A;  1I07 A;  2E5K A;  1GBR A;  2K9G A;  2J05 A;  2XMF A;  1ZSG A;  2A37 A;  1RI9 A;  4OMQ A;  2BZX A;  4JPB W;  2LX7 A;  5IH2 A;  1PWT A;  3VS3 A;  2YUQ A;  3I35 A;  1UDL A;  2AKK A;  1K4U S;  3NHN A;  1T3S A;  4AFQ C;  2MCN A;  2ECZ A;  2L3S A;  4CC2 A;  2DJQ A;  3EG0 A;  3ULR B;  2LCS A;  1PNJ A;  4DEX A;  3A98 A;  1M8M A;  2KR3 A;  3UA7 A;  1U3O A;  2AKL A;  3EGU A;  2CT3 A;  2SRC A;  3M0U A;  3M0Q A;  2DL3 A;  1RLP C;  1M30 A;  1X43 A;  2YSQ A;  2BZY A;  2KYM A;  3SEM A;  5I11 A;  3H0I A;  3VRY A;  1NEB A;  2DLP A;  3QWY A;  1HD3 A;  1M3A A;  2P4R A;  4OMO A;  5IHI A;  1JXM A;  3VRZ A;  1YN8 A;  1SRM A;  2J7I A;  1AZE A;  1X6B A;  3TVT A;  1PRL C;  1KIK A;  2DRK A;  3PE0 A;  4JJB A;  1K76 A;  2VVK A;  3H41 A;  2M0Y A;  2LJ1 A;  1CKA A;  2DL8 A;  1KFZ A;  4DEY A;  2OJ2 A;  2A36 A;  1Y0M A;  2RQV A;  1I1J A;  1YWO A;  3VS5 A;  2GNC A;  2B86 A;  2CSQ A;  2HCK A;  1MV0 B;  2JMA A;  1T0J A;  4E6R A;  2KRM A;  2W10 A;  2ROL A;  4AG1 C;  4JZ4 A;  4GBQ A;  2HSP A;  4RUG A;  1BK2 A;  1K9A A;  3VS6 A;  2ENM A;  3VS7 A;  1HSQ A;  1NLP C;  1VYV A;  3M0P A;  2FPF A;  2AK5 A;  3GBQ A;  1X2K A;  3VS4 A;  2EGA A;  2DYB A;  4J9I A;  3PVQ A;  3REA B;  2W0Z A;  3ZL7 C;  2DL4 A;  4AG2 C;  1SEM A;  4CC7 A;  5ECA A;  2FEI A;  1UJY A;  2JTE A;  1A0N B;  2L0A A;  1M3C A;  5GJV B;  2JXB A;  1UFF A;  1WI7 A;  1QWE A;  2IIM A;  1WXU A;  4EIK A;  1W1F A;  2D8J A;  2JT4 A;  1QKX A;  2J6K A;  2LQN A;  2RF0 A;  2CSI A;  1U5S A;  1GFD A;  4OMN A;  3QWX X;  2CUB A;  2YT6 A;  3EG2 A;  2L3Q A;  2A08 A;  4F14 A;  1GFC A;  1B3Q A;  2JS0 A;  1JQQ A;  4AFU C;  5FWB A;  3UAT A;  1E6G A;  3NPF A;  1SHF A;  1FYN A;  1PKT A;  1RLQ C;  2O31 A;  1PKS A;  1VA7 A;  2KBT A;  2DL7 A;  2KRO A;  3NMZ C;  2JW4 A;  2ABL A;  4OML A;  2EGE A;  2MIO A;  2KRN A;  2CT4 A;  2BTT A;  2YUO A;  2DRM A;  1AOJ A;  2KXC A;  4ORZ A;  1OV3 A;  1AZG B;  3RBB B;  2GQI A;  1PHT A;  4LNP A;  1UHC A;  1CKB A;  2EBP A;  3O5Z A;  3R6N A;  1X6G A;  4Z88 A;  1ARK A;  1UTI A;  2RPN A;  2YDL A;  1H8K A;  2RQW A;  1K0S A;  4RTY A;  2A28 A;  2FPD A;  1VYT A;  4ESR A;  2G6F X;  4RTZ A;  2O9V A;  5IXF A;  1FMK A;  3I5R A;  4Z89 A;  4J9D A;  1UGV A;  1AD5 A;  4J9G A;  4FSS A;  2KGT A;  2DF6 A;  1NEG A;  3M0T A;  2CH4 W;  2YUP A;  4LN2 A;  2L2P A;  3VS2 A;  1AWW A;  1GCQ A;  2K7A A;  5L23 A;  1Z9Z A;  2DBK A;  2KXD A;  2EPD A;  2LP5 A;  3KFV A;  2KEA A;  4ZNX A; 
#chains in the Genus database with same CATH topology
 5IHK A;  4RTU A;  1NJI U;  1SHG A;  3I56 Q;  4PJO D;  4GLM A;  3CCM Q;  3EHQ A;  5KYU B;  3I5S A;  4E7I A;  4HT9 A;  1VIE A;  1M90 C;  2NUT B;  3L1A A;  5GAN 2;  3PT9 A;  2QEX Q;  2KDS A;  2QTX A;  3MPU B;  4A63 B;  1UUE A;  3TEE A;  3BE3 A;  5A0G A;  5GAM g;  4M78 B;  4JS4 A;  1QQJ A;  2RQU A;  3RKY A;  1M1F A;  5FRM A;  5GAN 6;  1VQ9 T;  1NPR A;  4F7U B;  4MDX A;  3C0C A;  2EJG A;  3JSC A;  2VYT A;  2D9T A;  1B07 A;  2X4J A;  4QQ6 A;  1AEY A;  2X3X D;  5GAN 5;  5GAM j;  3CCU Q;  2AZS A;  1PD0 A;  4O6J A;  4Z02 A;  4FT4 A;  2ZPH B;  2RJF A;  4M7A D;  3CCV Q;  2LT4 A;  5EC7 A;  1U06 A;  2EGC A;  1WLP B;  2O88 A;  4ZGJ B;  2JM9 A;  1W6X A;  1ZA2 B;  5DLO A;  1WPY A;  3CCJ A;  2O9S A;  2LCC A;  4AFS C;  4M7D F;  3CCQ A;  3GIB A;  3A8L B;  1OI1 A;  4M75 G;  2K3X A;  1ZUU A;  2FO0 A;  4ZTJ A;  3VS0 A;  2ZPB B;  2I2L A;  2ZCF B;  5DM7 R;  2C0I A;  2RI3 A;  4J9E A;  2DER A;  1C1A A;  2DFU A;  3I56 T;  3CCM T;  1GRI A;  2E10 A;  3UDC A;  1C6V X;  2WSF E;  3IQL A;  1YCY A;  4R56 A;  3HHT B;  4Y28 E;  4IUQ A;  1NLO C;  1UEC A;  3JCM b;  4J6X A;  2DXT A;  2EYY A;  5KYY A;  2CP3 A;  2LRQ A;  4JRK A;  2K4Y A;  3M0R A;  2CUD A;  4C92 C;  4M7D B;  1OQK A;  5CVI A;  5D6W A;  4VUB A;  5GAN h;  1WFW A;  1K1Z A;  2VUB A;  1SSF A;  2KYB A;  4LDX A;  1E6H A;  3OYB A;  3LWI A;  1JO8 A;  4E7H A;  2QGF B;  1Y71 A;  3FB9 A;  4J9C A;  4C92 F;  2DIL A;  3CCV T;  3JCM Q;  3QJY A;  3RKW A;  1ZSZ A;  1WX6 A;  1QLY A;  3EG1 A;  3HKS A;  1GBQ A;  1ABO A;  3HFN A;  1WHH A;  4M77 G;  2MK5 A;  1NPP A;  1VUB A;  4X34 A;  3REB B;  2D1X A;  3CQT A;  4EMK C;  2LZ6 B;  3FJP A;  1NJI C;  2P4T A;  2MWO A;  1M2O A;  1ZX6 A;  1VQ6 A;  5KYX A;  2F1L A;  1T0H A;  2AIR B;  3G6E Q;  4MMK A;  4XTV A;  1VQP Q;  4OB1 B;  5GAN 4;  4C92 B;  3AT1 B;  4M78 D;  3M54 A;  4J6Y A;  3CD6 Q;  2QDL A;  5LJ5 j;  3X24 B;  4QKU A;  5FU6 B;  1WHL A;  1ZBJ A;  4FW2 A;  1YJN Q;  2OTL Q;  1RAD B;  3M53 A;  4XU1 A;  4JJC A;  3GPL A;  1V76 A;  1P92 A;  5GAO n;  3E2U A;  2L8D A;  4XTY A;  4RCB A;  2JTM A;  1EFN A;  2JS2 A;  1M27 C;  4C0D B;  2DD4 A;  3AHU A;  2PU9 B;  2JMC A;  2RJE A;  3OW2 P;  2A3L A;  3THK A;  4IUR A;  1E7O A;  3KUF A;  3WXM B;  4F16 A;  3CCS Q;  1OZ3 A;  1VQ5 Q;  3VYH B;  7AT1 B;  1KQ2 A;  1I5O B;  4CC3 A;  2DX1 A;  4OMM A;  2K3B A;  4KUD K;  1QCF A;  5A0D A;  1LCK A;  4JDS A;  2E64 A;  2K3Y A;  4EMK B;  2CZ7 B;  1H92 A;  1K9M R;  1GCQ C;  3SDZ A;  1YIT Q;  1BU1 A;  2L3P A;  1IHW A;  2LNH B;  2FVU A;  1GBR A;  1AT1 B;  3CCE Q;  4NS5 A;  2J05 A;  1TH7 A;  1Y7X A;  3ASK A;  3FRN A;  1RI9 A;  5GAM d;  4M75 E;  3L2W A;  3JCM g;  4QQG A;  1RI0 A;  2CZ0 B;  4EMH A;  5GMK i;  3G6E T;  1UDL A;  5CCA A;  1VQP T;  2AKK A;  2O01 E;  1X01 A;  1VQ4 A;  3C4S A;  3NHN A;  2DXU A;  3FIF A;  4AFQ C;  4DBR A;  2ECZ A;  3EAE A;  2Y4Y A;  2DXC A;  5HY6 A;  1QVG P;  3TRE A;  3Q1J A;  3ULR B;  1YJN T;  4M7D D;  4PFZ A;  1MNE A;  2K5I A;  1KC8 C;  2FZC B;  3MEU A;  1U3O A;  5CAI A;  2AKL A;  3HRT A;  4PJJ A;  2BE7 D;  2EWN A;  1O9S A;  2O4X A;  2RJC A;  1X43 A;  3JCM e;  1FX7 A;  2H3E B;  2BZY A;  3EFR A;  1QW1 A;  3CCS T;  4OB0 B;  1VQ5 T;  3VYG A;  3QWY A;  2DLP A;  3MP1 A;  3CMA Q;  3VRZ A;  2FYK A;  1SRM A;  3ME9 A;  3HP9 A;  1D1C A;  1KIK A;  1B34 B;  2DZ9 A;  4C8Q A;  3H41 A;  2M0Y A;  1CKA A;  3T9N A;  4HT8 A;  3HRS A;  4DEY A;  2OJ2 A;  1Y0M A;  3VS5 A;  1I1J A;  3CCE T;  3CXC S;  3RIR A;  3FEO A;  2HCK A;  2KI7 A;  4E6R A;  4JRP A;  5CK9 A;  2RI5 A;  2CS7 A;  2ROL A;  4GBQ A;  4M77 E;  5LJ3 h;  1BK2 A;  1IZ6 A;  2BUD A;  1WHJ A;  1TOV A;  5KE3 A;  1ACM B;  1X2K A;  1FXX A;  3QJ6 A;  4MZM A;  3CCR A;  4C92 D;  3CC2 Q;  3QO3 A;  3ZL7 C;  4AG2 C;  3OY9 A;  1SEM A;  1M1K U;  2G3R A;  2MWP A;  3CCL Q;  1G3S A;  1UJY A;  2JTE A;  1QVF S;  2M1H A;  1RAA B;  3SB2 A;  1W1F A;  1B7T A;  1QKX A;  1XJW B;  2LQN A;  3RER A;  4OMN A;  3QWX X;  2A08 A;  5GAO p;  1SF9 A;  4M75 C;  3EGD A;  2KVQ G;  1JQQ A;  2RI2 A;  3CMA T;  4AFU C;  1W4S A;  5CKD A;  4XTW A;  2R57 A;  1RLQ C;  3NTI A;  1V29 B;  2HZY A;  2V8J A;  1EIF A;  1MMG A;  1AHJ B;  2ABL A;  3UT1 A;  3CPW S;  5GMK j;  2MIO A;  2XHC A;  2LVM A;  5C0M A;  3A8G B;  3HPW A;  2QGG A;  4OF1 A;  2RO0 A;  3HFO A;  1XTD A;  4LDV A;  4Q5W A;  3RUX A;  3JCM f;  3X26 B;  3TCJ A;  3RBB B;  1PHT A;  3M55 A;  1VQK Q;  3CC2 T;  3ZFJ A;  4QVD A;  1YIJ A;  3X25 B;  3O5Z A;  2HMA A;  1VQM Q;  5J3B A;  3CCL T;  1X6G A;  1G5V A;  1UTI A;  1GXI E;  4IKF A;  2EAY A;  1ZBX A;  2FPD A;  3I55 Q;  1VYT A;  4L5G A;  2O9V A;  1HXD A;  4FW1 A;  4BB7 A;  3P8D A;  4B6M A;  3A8O B;  4A4F A;  5GAM h;  5CO7 A;  2R5M A;  1WHM A;  4FSS A;  2DF6 A;  2H3J A;  2CH4 W;  3CME A;  1N8R R;  4J83 A;  2K7A A;  4M77 C;  3EG9 A;  4PJO A;  2LP5 A;  2WAC A;  3UPU A;  2KEA A;  2HQX A;  1M90 U;  4A54 A;  4PJL A;  3WVD B;  2IVW A;  2GTO A;  4K11 A;  2YWW A;  2ED0 A;  2ED1 A;  2RHX A;  2K5F A;  2B8A A;  4ZN3 A;  3JCM d;  2AZV A;  1VQN A;  4E47 A;  2OAU A;  1W2B S;  2KT1 A;  2ROT A;  1BI1 A;  3EFS A;  1BB9 A;  2MMP A;  3VKI A;  2E3H A;  3CPF A;  2JJ9 A;  2GGR A;  2WSC E;  2LC4 A;  2DAQ A;  3L2Z A;  4AFZ C;  3CC4 A;  3SWN A;  1VQK T;  4QT7 A;  1IGQ A;  1VQM T;  1M1K C;  2EYQ A;  1QMC A;  2H8H A;  4M7A A;  5FU7 C;  2DIG A;  1MMN A;  3V7C A;  3I55 T;  1WJS A;  1I8F A;  2BE9 B;  3J81 E;  1UG1 A;  2D8H A;  1WXT A;  4HCZ A;  1AWO A;  1NE8 A;  1YHQ Q;  2FZK B;  2HD0 A;  4ANJ A;  2OAW A;  1VIF A;  2LQK A;  3CBM A;  1X2Q A;  1MMA A;  4LUE A;  4C5I A;  3X20 B;  1U8R A;  2XDB A;  5IAY A;  1K8A U;  2VKN A;  3QXE B;  3EH1 A;  1QCO A;  3PVL A;  3MJX A;  2KE9 A;  1Y96 B;  4E2F B;  4UC4 A;  1TS9 A;  5CQY A;  5CIU A;  2YXY A;  3SHW A;  4J9F A;  2QI2 A;  1YI2 A;  1I0C A;  4C5H A;  2DA9 A;  2QEX A;  1QKW A;  2ZPG B;  3F70 A;  3NTK A;  2Z0W A;  3VS1 A;  2ESW A;  4CC4 B;  1WDX A;  1XQH A;  1G3T A;  4C8Q G;  1WIE A;  1WXB A;  2M0O A;  2RM4 A;  4XAX B;  4PK4 A;  4BY6 B;  3OBY A;  3E1S A;  4DBQ A;  3JAM E;  5LJ3 e;  1JU5 C;  1RAG B;  3JB9 F;  3UA6 A;  1NJI R;  3QDF A;  3PIO A;  4JLG A;  2V26 A;  5IT9 E;  1YJ9 Q;  4J8O A;  3FJ5 A;  3CCU A;  1D0Y A;  5LJ5 h;  2MPX C;  4HVV A;  4XTU A;  2CP7 A;  2F5K A;  5KH6 A;  5L8R E;  3M56 A;  2V8K A;  1EX4 A;  3LH0 A;  2HDA A;  1WQW A;  3D7S B;  1YHQ T;  1NBE B;  3L2R A;  4BI4 A;  1JB0 E;  2AT1 B;  1YNZ A;  2DNU A;  1JXO A;  2QTV A;  4XU0 A;  4N0A A;  4BDZ A;  4PFO A;  3JV3 A;  3U23 A;  4E7S A;  2J6O A;  1TSF A;  1YCS B;  2EQI A;  2FG0 A;  5KYU A;  2DMO A;  5D6X A;  2NUT A;  3GF5 A;  5GJW B;  3CC7 T;  2DEU A;  2JM8 A;  3OMG A;  1VQO T;  2R58 A;  4WTO B;  4M78 A;  4RTX A;  1N6A A;  4DOW A;  4LDW A;  1NYF A;  1YP5 A;  1MUZ A;  4F7U A;  2QA4 A;  2EIF A;  1VQL A;  1ZLM A;  4J9H A;  1X69 A;  2P0K A;  1RAE B;  1FMW A;  2V1Q A;  1BYM A;  2FPE A;  1SRL A;  2A0F B;  1YJ9 T;  2RHI A;  2DVJ A;  3CBP A;  2GTJ A;  4Y92 A;  1IO6 A;  4AT1 B;  2O2O A;  1QVP A;  4IIO A;  1ABQ A;  3C94 A;  1TG0 A;  1UE9 A;  2EQM A;  3MP8 A;  1D0Z A;  2NUZ A;  2K57 A;  3JCM W;  2YHT A;  4PLI A;  4KUI A;  2EYX A;  2R5A A;  1K8A C;  4KT0 E;  3EGX B;  4ELY C;  1X27 A;  2BZ8 A;  1YBY A;  1ZSZ C;  2EKO A;  5LJ3 f;  2DD5 A;  4Z8A A;  2E5K A;  1YJW A;  1TU0 B;  2PUK B;  1Q81 U;  2WSE E;  4MZT A;  3HSB A;  1ZSG A;  3OW2 S;  1VQ8 T;  1ZQ1 A;  4NL3 A;  2LX7 A;  4PJO G;  4DA4 A;  5DY9 A;  3OYI A;  3OYH A;  3I35 A;  4C0G A;  3OYK A;  3MHX A;  3LWH A;  3DKM A;  1K4U S;  4A53 A;  1LOJ A;  5M9O A;  3CD6 A;  3V8J A;  4M7D A;  1JJ2 A;  1KC8 U;  2DJQ A;  2OTL A;  2LCS A;  3QUI A;  4J6W A;  2Y90 A;  4L59 A;  1IXD A;  1M8M A;  2KSS A;  1NZ9 A;  5CKB A;  3EGU A;  3MEA A;  4ZGD B;  2QQB A;  3A8H B;  1RLP C;  3PMI A;  1M30 A;  2YSQ A;  2KYM A;  3SEM A;  4D6W A;  1QVG S;  4M7A G;  2CP0 A;  1NEB A;  1HD3 A;  1M3A A;  2P4R A;  4NOY A;  3QYH B;  2QQ9 A;  2J7I A;  4XK8 E;  3CCJ Q;  1Q82 U;  1AZE A;  1N9R A;  5CKF A;  1YIT A;  2DRK A;  2YLB A;  2VVK A;  1OYX A;  2RHY A;  4ATO A;  2LJ1 A;  2DL8 A;  1KFZ A;  2A36 A;  3G4S T;  4LD9 K;  4BD3 A;  2XG8 D;  2B86 A;  3QZ5 B;  3X28 B;  2CSQ A;  1MV0 B;  1T0J A;  3JB9 D;  2HNI A;  4AG1 C;  1K9A A;  2ENM A;  3VS7 A;  1PCX A;  4C92 A;  1Q7Y U;  1NLP C;  3S6W A;  1SKU B;  1RAB B;  5GMK h;  2JNG A;  2DXB A;  4TVR A;  4XU2 A;  1KD1 U;  3GBQ A;  3QYG B;  3VS4 A;  2EGA A;  4FYW B;  1BKB A;  1JJ2 P;  3LGF A;  3J7A F;  3G1J A;  4C0Z A;  1SG5 A;  5ECA A;  1M8V A;  2LDM A;  1KHC A;  4E7J A;  4JLI A;  2L0A A;  3L2U A;  2JXB A;  2CKK A;  2IIM A;  5GAO m;  2KAF A;  3V7R A;  2D8J A;  2VAS A;  4XTX A;  3PTA A;  1U5S A;  2X35 A;  4CI0 C;  2YT6 A;  5LJ5 e;  4HCB A;  1KQ1 A;  1B3Q A;  2JS0 A;  2DZC A;  4EMK A;  4KH0 B;  3E9G A;  3CCJ T;  2E5Q A;  3UAT A;  1HK9 A;  3CCQ T;  3VU3 C;  2RH2 A;  5GAN 8;  1FYN A;  2X51 A;  2X4X A;  3NMZ C;  3PGG A;  1Q81 C;  3OS2 A;  3CBO A;  2EGE A;  4HA8 A;  2QAS A;  4PLL A;  1LVK A;  1VQ6 Q;  3BY7 A;  2BTT A;  4EMG A;  4R55 A;  2KXC A;  2XDD A;  2ZAE A;  3CC2 A;  1Q86 U;  4BE2 A;  4ORZ A;  3C95 A;  1CKB A;  4M78 G;  4PJO E;  3G7Z A;  2VGM A;  4C0F A;  2MI6 A;  3V8L A;  1I4K 1;  2YDL A;  4F7U G;  1RL2 A;  2RQW A;  1K0S A;  2JVV A;  2G6F X;  2ZZD A;  5IXF A;  3I5R A;  3SFM A;  4PNO A;  4J7I A;  4LN2 A;  3DLL A;  1AWW A;  2L2P A;  4IUV A;  2ATC B;  4PL6 A;  1GCQ A;  3M59 A;  5L23 A;  1M1K R;  3DLM A;  1B34 A;  1G3Y A;  1WJQ A;  2XIC A;  1Q82 C;  1N27 A;  5EG2 A;  3G71 A;  1OU9 A;  1MV3 A;  3V7S A;  3MET A;  5GAN g;  2PNI A;  2DTO A;  1O75 A;  5LL6 S;  3OYN A;  3S3N A;  2RN8 A;  2DBM A;  1MGQ A;  1V1C A;  2DM1 A;  3FDR A;  5GAN 3;  2VXF A;  3P8H A;  4N4H A;  1VQ6 T;  2BIV A;  1Q7Y C;  1UJ0 A;  5LJ5 f;  2NLU A;  1KD1 C;  1VQ4 Q;  1CSK A;  4ZTF A;  1WNL A;  3QPH A;  2FHD A;  5GAN e;  5FLX E;  2E41 A;  2JTF A;  1U1T A;  4M7D G;  4N4I A;  4XTZ A;  1JBM A;  5A2Q E;  2KMT A;  2F2X A;  2CRE A;  2YUN A;  3OS5 A;  4RCC A;  2ZPE B;  3L2V A;  2XD0 A;  1Q95 G;  3CXC A;  2GF7 A;  1WHG A;  2HBP A;  4RMO A;  2YRC A;  3LX7 A;  1K0X A;  1AWX A;  1VQ7 A;  1R8O B;  1G8X A;  1ZA1 B;  1D3B B;  2KK4 A;  1NM7 A;  2OTJ A;  1VYU A;  3MEV A;  3QKJ A;  1Y57 A;  2FZG B;  4LE9 A;  4N4G A;  4FYY B;  4M75 F;  1KQS A;  3NGP A;  4PJO C;  1C0M A;  3GP8 A;  4NL2 A;  3MO8 A;  3JCM V;  1QVF A;  3M57 A;  2E3I A;  1Z9Q A;  1YFN A;  2J06 A;  2KRS A;  2RJD A;  2EJ9 A;  2D0Q B;  5KYW B;  3MEW A;  3QHS A;  1UGQ B;  2VGN A;  4BAC A;  1SPK A;  2GFA A;  4HVW A;  1Q86 C;  1M90 R;  1SSH A;  1S72 A;  1VQ4 T;  5FW9 A;  2EVR A;  1PRM C;  2DE0 X;  5A0L A;  4C92 G;  3CCR Q;  2CP5 A;  1M2V B;  2CH4 A;  2RNA A;  1DJ7 B;  3TQ7 P;  2DKG A;  2V1R A;  2J6F A;  4M75 B;  3H0F A;  1G2B A;  2DK3 A;  3LH5 A;  2EQU A;  1G3W A;  4JRI A;  2HBW A;  2BKD N;  2QQR A;  3BFM A;  2VWF A;  4M78 E;  4PJN A;  3M58 A;  3SD4 A;  5I2M A;  1OUL A;  2XU8 A;  3CPW A;  1RAC B;  1RUW A;  3HTR A;  1UHF A;  2P0P A;  1PM3 A;  4OVA A;  9ATC B;  2HL5 C;  1OOT A;  2RMO A;  1TUD A;  3LYI A;  4DBF A;  3GOX A;  2HEQ A;  1KQS P;  4M77 F;  2EYZ A;  5KCH A;  5GMK l;  2IG0 A;  1NYG A;  2QK0 A;  5GAN f;  1VQ9 A;  4LUD A;  2X4W A;  2NWM A;  3RNJ A;  2F2V A;  3LW5 E;  4JJN K;  1BBZ A;  2LTO A;  1K8A R;  2PTK A;  3EH2 A;  1I5L A;  2FRW A;  2YRV A;  3QII A;  4HVU A;  1K73 U;  4IUT A;  2HSE B;  2LJ3 A;  2L5Q A;  3KBG A;  4P5N A;  2M16 A;  5IN1 A;  1JRI A;  3CCR T;  1ZUK A;  2DVE A;  2EFI A;  4E7K A;  1WZO A;  2XKO C;  1YIJ Q;  3H0H A;  3RES A;  2VC8 A;  3RMQ A;  4D8K A;  1IHV A;  2D0N A;  4RTV A;  4M77 B;  1J3T A;  2E6Z A;  1T3L A;  3QSU A;  1KK7 A;  5LJ3 g;  1H3H A;  3HL8 A;  4XQ3 A;  4OB2 B;  3URG A;  2QXF A;  3I56 A;  4BE1 A;  2DIQ A;  1W70 A;  5HK0 A;  3CCM A;  1Y96 A;  1W2B A;  4M7D E;  4WCI A;  4RTT A;  2GBQ A;  3CME Q;  5GAN d;  3A8M B;  2DET A;  3CC7 Q;  1HJD A;  1LPL A;  4OMP A;  2YLC A;  1IB8 A;  2EJF A;  1VQO Q;  2KNB B;  1I07 A;  3H6Z A;  2K9G A;  3JRZ A;  4FU6 A;  2BZX A;  3VJP A;  4JPB W;  5LJ3 j;  4MML A;  1PWT A;  3VS3 A;  4J7F A;  3L2Q A;  4ME7 A;  2LX9 A;  3RDV A;  3EFO B;  4LDY A;  2RK1 A;  1T3S A;  1VQN Q;  2MCN A;  4JUV A;  2L3S A;  1BIA A;  5FU7 B;  4KGZ B;  3JCM c;  1BCM A;  4M78 C;  3BDL A;  2NUP B;  1PNJ A;  4DEX A;  3VUB A;  4A4H A;  2KR3 A;  3UA7 A;  3CCV A;  4KH1 B;  2SRC A;  3CC4 Q;  1YIJ T;  3M0Q A;  1UGS B;  4M75 D;  3VUZ A;  1X75 C;  5I11 A;  4KGV B;  4F04 B;  2E12 A;  3RR6 A;  3N5B B;  1ZHI A;  3H0I A;  4RKU E;  3VRY A;  2GCX A;  2L89 A;  3BDU A;  1JXM A;  2HQH A;  1X6B A;  3TVT A;  1PRL C;  1WGS A;  3JB9 H;  3CME T;  1K76 A;  1R0B G;  1VQ8 Q;  3QZ9 B;  3LGL A;  4B9W A;  1YWO A;  4X9C A;  3OYC A;  4RG2 A;  2DTI A;  3OYD A;  5C6S A;  3ER0 A;  2W10 A;  2FL7 A;  1BI3 A;  4GY5 A;  2QQS A;  4JZ4 A;  2HSP A;  4RUG A;  3VS6 A;  1YI2 Q;  3M9Q A;  2RB6 A;  3C12 A;  1HSQ A;  1H64 1;  1RAH B;  1VYV A;  1LJO A;  1VQN T;  2XID A;  2DYB A;  3OSV A;  4J9I A;  3HRU A;  3PVQ A;  4BUG A;  3JB9 J;  1K73 C;  2DL4 A;  4CC7 A;  2EQJ A;  2FEI A;  1Q81 R;  2LCL A;  6AT1 B;  2QAZ A;  1N8R C;  2DPP B;  5KCO A;  1UFF A;  1WI7 A;  3CC4 T;  3VV0 A;  4M7D C;  1QWE A;  3JCM h;  1WXU A;  4EIK A;  1KG1 A;  4GLK A;  2QQA A;  1BCO A;  2J6K A;  1OU8 A;  2P84 A;  2RF0 A;  3OSS C;  2CSI A;  3H9N A;  3EG2 A;  4M77 D;  1JJ2 S;  4F14 A;  1KC8 R;  4LXC A;  3EGX A;  4E7Z A;  4JS5 A;  5GAM e;  2XI9 A;  3O8V A;  4A4K A;  2LNV A;  3G4S Q;  5FWB A;  1MHN A;  3NPF A;  3JCM J;  3QBY A;  1PD1 A;  1PKS A;  4ZN1 A;  2KBT A;  3G6E A;  2JW4 A;  1VQP A;  1MND A;  1N9S A;  3GLX A;  2KRN A;  1YI2 T;  3MKD A;  2CT4 A;  3S3O A;  2QEX T;  1OZ2 A;  5HKC A;  1YJN A;  2DRM A;  1AOJ A;  1Q82 R;  1XNI A;  4OGE A;  5KYY B;  1M9S A;  1AZG B;  2GQI A;  2XK0 A;  2D6F A;  4LNP A;  1BI0 A;  4C8Q E;  3OYE A;  3PIP A;  2QA4 Q;  4Z88 A;  1VQL Q;  4XU3 A;  2E4H A;  2RPN A;  2ZGW A;  3JCM P;  4OB3 B;  4RTY A;  4Y91 A;  3ZEH A;  3CCS A;  5FU6 C;  4RTZ A;  4A4G A;  1VQ5 A;  1F1B B;  2MYS A;  1Q7Y R;  2JUF A;  4Z89 A;  4FYX B;  5LJ3 d;  3OS0 A;  3CCU T;  1OX9 A;  1AD5 A;  4J9G A;  1KD1 R;  3P8B B;  1ZSZ B;  2KGT A;  4C0D C;  3OW2 A;  4FM4 B;  3L42 A;  3M0T A;  2YUP A;  3VS2 A;  2AHJ B;  1RAF B;  2HQE A;  2V8I A;  3JB9 I;  1PSE A;  3CCQ Q;  4HCC A;  3CCE A;  2EPD A;  2VV5 A;  3KFV A;  1UGR B;  1EZZ B;  2OI3 A;  3OYL A;  4M4Z A;  2GFU A;  1WHK A;  2PQW A;  5LJ5 g;  2C0O A;  5GMK m;  5AT1 B;  2XDP A;  5KYX B;  1OPL A;  1YJW Q;  5CKH A;  2K2M A;  4QVZ A;  2DEQ A;  2VXE A;  4MDW A;  1XOV A;  5HK3 A;  2CZ6 B;  8AT1 B;  5I2S A;  4II1 A;  3FC3 A;  1S1N A;  2M9U A;  5GAM f;  3JCM X;  4J9B A;  2HKQ B;  2QA4 T;  3DB3 A;  2M51 A;  1QVG A;  4RG8 A;  3A1P A;  1D1A A;  1VQL T;  2DTH A;  3OYG A;  4D8D A;  2PVD B;  2PVO B;  2HKN A;  2RQT A;  2COY A;  2EYW A;  4DQ2 A;  1HYO A;  2X3W D;  3CMA A;  4IIM A;  1G83 A;  4RTW A;  2F2W A;  1Q86 R;  3OYF A;  1OEB A;  2C06 A;  1MMD A;  5IHN A;  1M3B A;  1BI2 A;  5HCK A;  5IXB A;  3NFC A;  1TUG B;  1N5Z A;  4EDU A;  4HXJ A;  2LJ0 A;  4ELZ C;  3J80 E;  2LMJ A;  4BE0 A;  4PJM A;  2RQR A;  1TTH B;  3OS1 A;  4C8Q C;  4X1V A;  2SEM A;  1YJW T;  5GAN 7;  2VB6 A;  2DJZ A;  5I22 A;  1R77 A;  5GAO q;  3JB9 G;  1AWJ A;  1M5Q 1;  4CRI A;  3CCL A;  5D7U A;  2KY9 A;  2RA2 A;  4V2S A;  4C8Q F;  1WQ7 A;  2MAM A;  1UGP B;  3I9Q A;  4OMF B;  2OX7 A;  3CD6 T;  2RHZ A;  4QVC A;  4FCY A;  4JZ3 A;  5GAO r;  1K9M U;  3PNW C;  1PC0 A;  2JZ2 A;  3TSZ A;  2OTL T;  1KSW A;  3TU4 K;  3OYY A;  2FRY A;  1LNX A;  1OPK A;  1H3Z A;  1IRE B;  2RK2 A;  1IGU A;  4A4E A;  2O4X B;  2NYS A;  4KBM B;  2DYI A;  1UB4 A;  5FRO A;  4AMC A;  2CYZ B;  2I0N A;  1IRX A;  2YRD A;  3PMT A;  1U1S A;  1GL5 A;  2K5L A;  4OGC A;  3KXT A;  2MOX A;  3PFS A;  5D6Y A;  4M7A E;  1D09 B;  3A5Z B;  4C5G A;  4KRT A;  1KJW A;  4C8Q B;  1WJR A;  1GCP A;  1D1B A;  2DL5 A;  1YIT T;  3EG3 A;  2CP6 A;  1M4Z A;  1TXQ A;  1QWF A;  2EW3 A;  4FIB A;  1D0X A;  1VQK A;  1WYX A;  2CDT A;  1WA7 A;  1NG2 A;  5FWC A;  5GAN j;  1VQM A;  1Y07 A;  5DLQ E;  3I55 A;  2KQW A;  2E70 A;  2KT8 A;  2M02 A;  3LLR A;  3UF4 A;  2K6D A;  4QW2 A;  1KQS S;  4HCK A;  4R0K A;  4MZP A;  3TSW A;  1YWP A;  2F5T X;  4F17 A;  3QG1 A;  4LD6 A;  2PZ1 A;  3UWN A;  2C0T A;  3MP6 A;  4JJD A;  1TUC A;  3OB9 A;  5J26 A;  3INZ A;  2LQW A;  3M0S A;  2K2V A;  3GNF B;  2QDY B;  1AVZ C;  1R0C B;  1D3B A;  4DOV A;  1ZUY A;  3EGD B;  2JN0 A;  2K79 A;  3EHR A;  1JEG A;  3M4Y A;  4LDU A;  2EKH A;  2RHU A;  5LJ5 d;  2XMF A;  2PUO B;  8ATC B;  2A37 A;  4OMQ A;  4FSX A;  3DB4 A;  3G71 Q;  5IH2 A;  4FL6 A;  2YUQ A;  5KYW A;  1UEB A;  1PG5 B;  2IPO B;  2FB7 A;  4PJO F;  3GNG A;  4L6V 5;  1QP3 A;  4PFP A;  4CC2 A;  2EQK A;  4EPC A;  5GMK e;  2E6N A;  1OX8 A;  1PSF A;  3M4G A;  4JRQ A;  3EG0 A;  4O5V A;  2X9H A;  3A98 A;  2F69 A;  1M2V A;  2L3R A;  2QG9 B;  4DBH A;  2HL3 A;  1YHQ A;  3SWN C;  2CT3 A;  1K9M C;  4M75 A;  3M0U A;  2P0Q A;  4YTL A;  4M7A C;  2DL3 A;  3CXC P;  4F7U E;  2COZ A;  2A7Y A;  2PVG B;  1QCN A;  1K73 R;  1VOM A;  4OMO A;  2ZPI B;  5IHI A;  1YN8 A;  2Y4X A;  3CEY A;  4PKC C;  2JOY A;  3OYM A;  3CC7 A;  3OYA A;  3EG9 B;  4PJO B;  4C5E A;  3PE0 A;  2QYZ A;  4JJB A;  4M7A F;  5J39 A;  3OYJ A;  1TWB A;  1VQO A;  3WVE B;  1VQ7 Q;  3OBW A;  2RQV A;  2GNC A;  5KE2 A;  1QVF P;  2OTJ Q;  2JMA A;  4C8Q D;  2E1H A;  4B9X A;  4BDY A;  2KRM A;  3G71 T;  3V8K A;  1RAI B;  2ZPF B;  5CR2 A;  4WF2 A;  3M0P A;  2FPF A;  2DO3 A;  1M1G A;  2AK5 A;  3FLG A;  3R6O A;  2HAX A;  1YJ9 A;  4E7L A;  3OMC A;  1FWZ A;  1N8R U;  3REA B;  2W0Z A;  2MF2 A;  3OQ5 A;  3E19 A;  3SWN B;  1KHI A;  1A0N B;  4BY6 C;  5KYN A;  1M3C A;  5GJV B;  1S72 Q;  4M7A B;  4M77 A;  4BI8 B;  3OA6 A;  4BI3 A;  2JT4 A;  3ZBD A;  5GAO l;  3CPW P;  2GQV A;  1FMV A;  1GFD A;  4QQD A;  2CUB A;  5CQX A;  2L3Q A;  4J5Y A;  1GFC A;  4KUL A;  3S3M A;  3BW1 A;  2CZ1 B;  1E6G A;  1VQ8 A;  3H8Z A;  4N0A C;  1SHF A;  1PKT A;  2E65 A;  5I21 A;  2O31 A;  1VQ7 T;  1VA7 A;  2LT1 A;  2DL7 A;  2KRO A;  4OML A;  3M5A A;  2OTJ T;  2X4Y A;  1BIB A;  3RKX A;  3EFO A;  3E9F A;  2YUO A;  1VQ9 Q;  1X6O A;  2LQ8 A;  1OV3 A;  2NUP A;  2RD1 A;  1UHC A;  2EBP A;  3R6N A;  4IUU A;  4ZGE B;  4FT2 A;  5FRN A;  1ARK A;  4IUP A;  1H8K A;  3QDR B;  1S72 T;  1I81 A;  2A28 A;  5AYF A;  4ESR A;  4FYV B;  4M78 F;  3RMS A;  1FMK A;  4J9D A;  1UGV A;  4C92 E;  4F7U F;  4OP0 A;  4X9D A;  1NEG A;  2CP2 A;  4KGX B;  1W2B P;  1QP2 A;  3G4S A;  3NTH A;  1Z9Z A;  2COW A;  2DBK A;  2KXD A;  3MCA B;  4HKE A;  4ZNX A;  2CGH A;  5CKE A; 
#chains in the Genus database with same CATH homology
 5IHK A;  1MV3 A;  4RTU A;  1SHG A;  2GTO A;  2PNI A;  4K11 A;  4GLM A;  2ED0 A;  2ED1 A;  3EHQ A;  2OI3 A;  3I5S A;  4M4Z A;  2AZV A;  2RN8 A;  2C0O A;  2DBM A;  4A63 B;  1V1C A;  1UUE A;  1OPL A;  2DM1 A;  2KT1 A;  2ROT A;  2K2M A;  1BB9 A;  2RQU A;  1XOV A;  2GGR A;  3C0C A;  1UJ0 A;  1S1N A;  4AFZ C;  1B07 A;  4QT7 A;  4J9B A;  1AEY A;  2M51 A;  1CSK A;  2X3X D;  2H8H A;  4D8D A;  1UG1 A;  2D8H A;  2AZS A;  1WXT A;  1AWO A;  2RQT A;  2EYW A;  2X3W D;  5EC7 A;  1U06 A;  2EGC A;  2F2X A;  1WLP B;  2OAW A;  2O88 A;  2JM9 A;  1W6X A;  1G83 A;  2CRE A;  2YUN A;  4IIM A;  4RTW A;  1X2Q A;  2F2W A;  2O9S A;  4AFS C;  4LUE A;  1OEB A;  2VKN A;  5IHN A;  1K0X A;  1AWX A;  1M3B A;  1ZUU A;  2FO0 A;  5HCK A;  3PVL A;  3VS0 A;  5IXB A;  1NM7 A;  2KE9 A;  1VYU A;  1Y57 A;  1N5Z A;  2C0I A;  4J9E A;  4LE9 A;  4HXJ A;  3SHW A;  2LJ0 A;  4J9F A;  2LMJ A;  1I0C A;  3NGP A;  1GRI A;  2DA9 A;  2RQR A;  1QKW A;  4X1V A;  3IQL A;  2SEM A;  1Z9Q A;  2J06 A;  3VS1 A;  2ESW A;  4CC4 B;  1WDX A;  1NLO C;  1UEC A;  2KRS A;  5I22 A;  1WIE A;  1AWJ A;  1WXB A;  2EYY A;  1SPK A;  3M0R A;  2CUD A;  4HVW A;  1SSH A;  1JU5 C;  3UA6 A;  5FW9 A;  2EVR A;  1WFW A;  3I9Q A;  1K1Z A;  1PRM C;  2DE0 X;  2KYB A;  4JZ3 A;  3FJ5 A;  2CH4 A;  1E6H A;  2RNA A;  4HVV A;  3TSZ A;  1JO8 A;  1KSW A;  2V1R A;  2FRY A;  2J6F A;  1OPK A;  2HDA A;  4J9C A;  3H0F A;  1G2B A;  3LH5 A;  2DIL A;  2HBW A;  2VWF A;  1WX6 A;  1QLY A;  1RUW A;  3EG1 A;  1GBQ A;  1YNZ A;  1JXO A;  1ABO A;  2DNU A;  2I0N A;  1UHF A;  1GL5 A;  3JV3 A;  3U23 A;  1OOT A;  2J6O A;  2MOX A;  1YCS B;  2EQI A;  2RMO A;  3REB B;  2D1X A;  1TUD A;  2FG0 A;  3CQT A;  2DMO A;  2LZ6 B;  1KJW A;  4KRT A;  2HEQ A;  1ZX6 A;  1GCP A;  2EYZ A;  5GJW B;  2JM8 A;  2DL5 A;  1NYG A;  3EG3 A;  4RTX A;  4LUD A;  1T0H A;  1QWF A;  2EW3 A;  2NWM A;  3RNJ A;  2F2V A;  1NYF A;  1YP5 A;  1BBZ A;  1MUZ A;  2PTK A;  1WYX A;  2CDT A;  1WA7 A;  1NG2 A;  5FWC A;  2FRW A;  1ZLM A;  4J9H A;  1X69 A;  4HVU A;  2QDL A;  1ZBJ A;  2LJ3 A;  2KT8 A;  3UF4 A;  2K6D A;  2V1Q A;  4JJC A;  4HCK A;  4R0K A;  3TSW A;  2FPE A;  1SRL A;  1ZUK A;  1YWP A;  1EFN A;  2DVJ A;  4F17 A;  2GTJ A;  2JS2 A;  1M27 C;  4Y92 A;  1IO6 A;  2PZ1 A;  2O2O A;  3H0H A;  2C0T A;  4IIO A;  4JJD A;  1TUC A;  4D8K A;  1ABQ A;  2JMC A;  1TG0 A;  2D0N A;  4RTV A;  3THK A;  1UE9 A;  1J3T A;  2LQW A;  1E7O A;  3M0S A;  1T3L A;  2NUZ A;  4F16 A;  1H3H A;  2EYX A;  1AVZ C;  4CC3 A;  1X27 A;  1ZUY A;  2DX1 A;  1W70 A;  4OMM A;  2K3B A;  1QCF A;  1LCK A;  2BZ8 A;  4WCI A;  4RTT A;  2K79 A;  1H92 A;  2GBQ A;  1GCQ C;  1HJD A;  3EHR A;  1JEG A;  1BU1 A;  2L3P A;  4OMP A;  2EKH A;  2LNH B;  2KNB B;  4Z8A A;  1I07 A;  2E5K A;  1GBR A;  2K9G A;  2J05 A;  2XMF A;  1ZSG A;  2A37 A;  1RI9 A;  4OMQ A;  2BZX A;  4JPB W;  2LX7 A;  5IH2 A;  1PWT A;  3VS3 A;  2YUQ A;  3I35 A;  1UDL A;  2AKK A;  1K4U S;  3NHN A;  1T3S A;  4AFQ C;  2MCN A;  2ECZ A;  2L3S A;  4CC2 A;  2DJQ A;  3EG0 A;  3ULR B;  2LCS A;  1PNJ A;  4DEX A;  3A98 A;  1M8M A;  2KR3 A;  3UA7 A;  1U3O A;  2AKL A;  3EGU A;  2CT3 A;  2SRC A;  3M0U A;  3M0Q A;  2DL3 A;  1RLP C;  1M30 A;  1X43 A;  2YSQ A;  2BZY A;  2KYM A;  3SEM A;  5I11 A;  3H0I A;  3VRY A;  1NEB A;  2DLP A;  3QWY A;  1HD3 A;  1M3A A;  2P4R A;  4OMO A;  5IHI A;  1JXM A;  3VRZ A;  1YN8 A;  1SRM A;  2J7I A;  1AZE A;  1X6B A;  3TVT A;  1PRL C;  1KIK A;  2DRK A;  3PE0 A;  4JJB A;  1K76 A;  2VVK A;  3H41 A;  2M0Y A;  2LJ1 A;  1CKA A;  2DL8 A;  1KFZ A;  4DEY A;  2OJ2 A;  2A36 A;  1Y0M A;  2RQV A;  1I1J A;  1YWO A;  3VS5 A;  2GNC A;  2B86 A;  2CSQ A;  2HCK A;  1MV0 B;  2JMA A;  1T0J A;  4E6R A;  2KRM A;  2W10 A;  2ROL A;  4AG1 C;  4JZ4 A;  4GBQ A;  2HSP A;  4RUG A;  1BK2 A;  1K9A A;  3VS6 A;  2ENM A;  3VS7 A;  1HSQ A;  1NLP C;  1VYV A;  3M0P A;  2FPF A;  2AK5 A;  3GBQ A;  1X2K A;  3VS4 A;  2EGA A;  2DYB A;  4J9I A;  3PVQ A;  3REA B;  2W0Z A;  3ZL7 C;  2DL4 A;  4AG2 C;  1SEM A;  4CC7 A;  5ECA A;  2FEI A;  1UJY A;  2JTE A;  1A0N B;  2L0A A;  1M3C A;  5GJV B;  2JXB A;  1UFF A;  1WI7 A;  1QWE A;  2IIM A;  1WXU A;  4EIK A;  1W1F A;  2D8J A;  2JT4 A;  1QKX A;  2J6K A;  2LQN A;  2RF0 A;  2CSI A;  1U5S A;  1GFD A;  4OMN A;  3QWX X;  2CUB A;  2YT6 A;  3EG2 A;  2L3Q A;  2A08 A;  4F14 A;  1GFC A;  1B3Q A;  2JS0 A;  1JQQ A;  4AFU C;  5FWB A;  3UAT A;  1E6G A;  3NPF A;  1SHF A;  1FYN A;  1PKT A;  1RLQ C;  2O31 A;  1PKS A;  1VA7 A;  2KBT A;  2DL7 A;  2KRO A;  3NMZ C;  2JW4 A;  2ABL A;  4OML A;  2EGE A;  2MIO A;  2KRN A;  2CT4 A;  2BTT A;  2YUO A;  2DRM A;  1AOJ A;  2KXC A;  4ORZ A;  1OV3 A;  1AZG B;  3RBB B;  2GQI A;  1PHT A;  4LNP A;  1UHC A;  1CKB A;  2EBP A;  3O5Z A;  3R6N A;  1X6G A;  4Z88 A;  1ARK A;  1UTI A;  2RPN A;  2YDL A;  1H8K A;  2RQW A;  1K0S A;  4RTY A;  2A28 A;  2FPD A;  1VYT A;  4ESR A;  2G6F X;  4RTZ A;  2O9V A;  5IXF A;  1FMK A;  3I5R A;  4Z89 A;  4J9D A;  1UGV A;  1AD5 A;  4J9G A;  4FSS A;  2KGT A;  2DF6 A;  1NEG A;  3M0T A;  2CH4 W;  2YUP A;  4LN2 A;  2L2P A;  3VS2 A;  1AWW A;  1GCQ A;  2K7A A;  5L23 A;  1Z9Z A;  2DBK A;  2KXD A;  2EPD A;  2LP5 A;  3KFV A;  2KEA A;  4ZNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...