1AJ3A

Solution structure of the spectrin repeat, nmr, 20 structures
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
98
structure length
98
Chain Sequence
b'HQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA SPECTRIN
publication title Solution structure of the spectrin repeat: a left-handed antiparallel triple-helical coiled-coil.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 49
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1997-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1aj3A00
1QUUA 2SPCA 3PE0A 3UUMA 1U5PA 1HCIA 3UUNA 3F31A 3UULA 1S35A 1AJ3A 3FB2A 1U4QA 1WLXA 1CUNA 2ODUA 3LBXB 3EDVA 3LBXA 2ODVA 1OWAA
chains in the Genus database with same CATH superfamily
5L4EA 4WZXA 3RC3A 3MA9A 4TX5A 5F3JA 2XQYA 2VQFT 3M65A 2NOXA 5AFUL 1XNRT 3LFMA 2BKPA 4MALA 2V7LA 1NEKA 2KWIB 4M1PA 3KV9A 3EAMA 3N9NA 1J5WA 2D2SA 5JDFA 4U72A 2LT3A 2ZM8A 2QYWA 4QH1A 3ZCJA 2UXCT 3UULA 5AQUB 2WS3A 3PTRB 2XSAA 3RRWA 2K24A 1IZNB 1D0XA 3B5MA 3LBXA 4DR1T 4TNVA 5HWXA 4B3RT 4IT4A 3T8OA 3CK6A 5LGNB 4LMJA 4H9OC 2WCAA 3P4QA 2GK9A 5EK2A 2IMLA 2NR4A 1MIVA 5AQRB 4YFSA 2W61A 3RKOA 5HXSA 2J1DG 4UEMA 2WDRA 2WMOA 2LOSA 4C90A 3ONXA 2CHNA 4CQIA 3AA7B 4TUYE 4GKJT 4FJOA 4TWFA 4X1IE 2YOEA 3P4RA 4I0UA 4LF6T 4O2AE 3RLFF 4MBQA 4QHOA 2LM9A 2LKHA 2WDVA 5FL0A 1X9BA 2WZHA 4DUZT 4H9SE 2ACXA 3ZMTB 2QA7A 3W15B 1US7B 3RF1A 2K5BB 2XTLA 4DR4T 3O1HA 2VKDA 1VCSA 2VL8A 4U2ZA 2LSIA 4PK5A 4DBRA 3TLTA 4B3MT 1T98A 3PUAA 2Y6XA 3OKQA 2E9XD 2UUBT 4HFBA 3CX6B 3ZMSB 2CWOA 3P4WA 3PU3A 5FP3A 3HR0A 4UXNB 2CM0A 3RGLA 3P7IA 2XHEB 4H63V 5AQJB 3ZMVB 1WRDA 3F31A 5LMNT 2J47A 4HWIB 3CIRA 3IF8B 2VWAA 3FB2A 4HFDA 4PFOA 3KVBA 2KT9A 2LRLA 3AEGA 2UXDT 2QVAA 2M67A 4LMKA 2M6BA 1S94A 4QKNA 2WDQA 5FXWA 4U7IA 2A3DA 2W00A 1HCIA 3ZSTA 1ZKEA 2BG9C 1S35A 4AKIA 4OHFA 2NTYA 4DV1T 5AQQB 1XZYA 3RQWA 4KBMB 2PG8A 1X79A 2I59A 3CQGB 4GK0E 5C3JA 2L8KA 5H6QB 3R84B 2DCFA 2LLYA 2UXXB 2V6YB 3CPZA 3EDUA 3AE9A 4DV7T 4X20E 2E9XB 2A9UA 4L0RA 1J5ET 5LHHB 3RPUA 1OXZA 4WYVA 5DJQC 4ZHQE 5ABFA 2OV9A 3ZC0A 4EEDA 1OEDE 2IAKA 4TN7B 5JDHA 3UU6A 1UUSA 3IA3A 2X9WA 4U3CA 2LSYA 2KLQA 4PJMA 5IUXA 5JR9A 2YINA 4DV5T 1XMOT 2HPLA 3QB5A 4EYYR 1UK5A 4TZ4C 1V9DA 4HN9A 2JRKA 3Q5WA 3AVSA 3IEEA 5AQHB 3RYIE 1IBMT 4ZI7E 2QRXA 3JAFA 4P0BA 3RYFE 2A2FX 4QH5A 2CA5A 2KMFA 3RIAA 4NXMT 2XSBA 1D1BA 3AE2A 3K1SA 5LYJE 2D0TA 5FY1A 4DIDB 3VR8A 4CI1B 5J0ZA 1J1JA 1XMQT 4JYAT 2XQ8A 3CKDA 3ZYKA 1MIWA 5LOVE 1Z8UA 3JC6D 2BS3A 3KINB 2LKGA 3QC9A 3AECA 3ONLC 4ISTA 4IDNA 4A5XA 3ABVA 1YKEB 3FXEB 1IAPA 2BKOA 4HFEA 4UELA 4ERRA 5KXJA 4AKRB 5LHIB 3CQXC 3MXZA 2XZEA 3CWZB 4UF0A 4ASKA 4JI1T 5L2LA 4C91A 4F8HA 3AE7A 3EABA 2K3WA 3MJXA 2CXLA 2WP9A 4PNIA 4P0AA 4DUYT 5AQLB 2IHR1 3PV0F 5KDMC 2LHNA 4UVBB 4ZI3D 4LF7T 3PJAA 2VQET 5J2TE 2ODVA 5HYAA 4UVCB 5AQVB 2KZ7B 3SFDA 1U5PA 1WR0A 2XQ9A 4DMWA 4OX9T 3ETVA 3ZCIA 1N36T 5LA6E 4LF9T 3CVRA 4MHCA 2PBIA 4HWHA 2VVSA 5CA1E 3PUYF 4HEAA 4HE8A 3AEEA 4IE6A 5CA0E 4DR7T 5FVKA 1XWMA 2JQ9A 3ZT7A 3AA1B 2D9DA 4AKHA 1UGOA 3N9LA 5ADXL 3N9OA 2VK9A 2K48A 3I0OA 3ZT6A 3U78A 2H7VC 2X0LB 5DQWA 3VHLA 2V7JA 2ZM6T 1L0VA 3D0TA 4LMLA 4Z8XA 5FVLA 2KSRA 3AVRA 4E7ZA 2UU9T 2FJEA 3HKEE 4IDOA 1YKHB 3Q5DA 4IL9A 4GKKT 4ZXLA 4DNDA 3G06A 2R6GF 3K3NA 1XNQT 4JI4T 1BR4A 3PDYA 2FUPA 2EHOD 4Z91A 1WCRA 5IHYA 2I0MA 2L3LA 3CX8B 4O4LE 2WMNA 4H9QC 5HEUA 3E22E 3ZYLA 4I43B 2HH7A 4JUYA 4AISA 4ILAA 2YKSA 3P4SA 4PK6A 2I6HA 4DV3T 3AEFA 3FHNA 4QXBB 2Z6EA 3DP7A 1WR6A 4PJJA 2MTQA 3UFEA 4YSYA 4B3ST 5HEJA 4DMVA 5FMNA 1U4QA 1HTJF 2RP4A 3O9XA 3EUHA 4QWNB 4LF8T 3K8PC 5JTGA 5CGMA 4CI2B 2ACZA 3BQLA 2W4XA 1EZ3A 1WFDA 2LE8A 4KX6A 2SPCA 3ZMZB 4Z90A 1KEYA 3HI2A 2EHOB 1LRZA 3LK3B 5JRCB 5HCMA 2BG9A 4J2CA 2C5KT 3JAEA 5LJMA 2X0YA 1OEDB 5AQSB 1MMNA 1QSDA 3RC8A 2FJAA 3UTKA 5M4YA 4QXCB 4EZHA 2HHHT 4N78D 2WWUA 2Q9QA 4WNKA 4CXWA 2JPFA 2C0SA 1D1AA 2IC9A 2MBGA 2V7KA 4HFVA 5HXHA 5LHGB 3SFEA 4NIQA 4UF0B 3PURA 3UU4A 1HNWT 1W0AA 2LSJA 5BR8T 5C2TA 4NXNT 1HF8A 2E9XC 2JQQA 5EK4A 5JVDE 4IIJE 3AEDA 1N32T 5E0OA 1N33T 3GN5A 3OPCA 4QX7B 4JBWF 2KINB 3AE1A 4H9NC 4XZCA 4UV8B 3E0ZA 2CPTA 3F2EA 3UU8A 2X9HA 2B76A 3C4WA 5LP6E 5L3EB 4KHZF 4JI2T 4Q25A 3KBUA 1T7SA 3PUWF 1LVKA 3H3MA 2HN1A 1KK7A 3LK2B 4WBNE 5JREA 1NENA 4X1KE 4U2YA 4IE5A 3FZHB 4CXYA 5AQGB 3L8RA 1FMVA 4BAYB 2MAWA 4X5TA 2RA1A 2XY8B 3ANWA 5HCJA 1O3XA 2CE7A 2WM9A 2ODUA 2PJQA 3E08A 4EXTA 3AAAB 4LFAT 1M7KA 2CEAA 2X0HA 3NZQA 4PAGA 3HKDE 3C98B 3O4XE 4JI6T 3LJCA 4X64T 2BBHA 4YTPA 2C5JA 4H9PC 4DV2T 1T72A 1H7CA 2LEHA 5J2UE 1MMDA 3CMLA 2AXDS 4TWHA 2J4GA 1FJGT 5L3GB 5KMGP 2NW7A 4E7SA 1N34T 4YLHA 1MIYA 4JI5T 3UUBA 3KFWX 2H3RA 5AQTB 4CN4A 5L4HA 1HR0T 1XDOA 3ETUA 2BZBA 4LF5T 3SWHA 3RIFA 2IDOB 2XM2A 3C4ZA 4IDZA 4JEUB 1QLBA 3KV5A 4AIUA 5CJ5A 2NWBA 2W66A 4X1YE 4KP3C 4H63H 4ZI2C 4YHJA 1FEWA 2NP9A 1IJ5A 1HG2A 3RYHE 3WAKA 3IBPA 5AQFB 5BMVE 2XAGB 5IYZE 2MPKA 3AA0B 2RPAA 1G73A 3QUJA 1BR0A 2BVLA 3P50A 4P1NA 1IJ6A 2V5DA 3PUZF 3JC6C 4QH4A 2WBLA 2V5CA 3L39A 3VRAA 3RIUC 3MZKB 2Q9QD 3AE8A 3FXDB 4TNWA 4ANJA 5AQIB 3N5LA 2VASA 4JI0T 4MFRA 3BK9A 4BA9A 5HEGA 4IDPA 4U31A 2HN2A 2CCQA 5J1GA 3LBXB 5TAOA 5LCYA 4HFHA 5HXEA 4AQYT 2CRBA 4X62T 2V26A 4QX8B 5HXCA 2YDQA 2K9AA 3A7MA 4YY3T 3C50A 4DR2T 3RQUA 3AE5A 4ZI3C 4BJNA 4CN6A 3BQKA 3MK7C 4IE4A 3QOFA 1WYCA 1CUNA 2YU2A 2XQ6A 3DJBA 4YTMA 3RKGA 2XAJB 2CLYB 2HPJA 2LJLA 3C4XA 3O1IA 2D0UA 3FZMB 3L3PA 1Y64B 3FZLB 3B13A 2FJBA 1IBKT 2ZM2A 4AXPA 2OLTA 2BKNA 3FZFB 3ZC1A 2IC6A 4DR5T 3PUGA 2IUBA 2XJ7A 3WAJA 3T1HT 2XAFB 4AKLA 4EAHA 2PFVA 4GYRA 5LXTE 3X1DA 2XAQB 3GN5B 3LK42 4GK5E 4PK4A 3TKLB 1FIOA 3TLUA 5AQNB 5L3BB 1YD8G 2YK0A 4YHHT 4PJLA 2XAHB 3T1YT 3R6NA 2BS4A 2UUCT 1HNZT 5HEOA 2WB5A 4OK0A 1DU2A 2X9XA 4PFPA 4L9IA 1XDPA 3ZPOA 1E7PA 4HFCA 4NUVA 2YDRA 2VKHA 2CHOA 5AQPB 4JI8T 3RYCE 3ONJA 5JQGE 4BJMA 5ABEA 1MNDA 1D1CA 4YT0A 4JI7T 3ANWB 3VKGA 2BBJA 3MKDA 4I55E 2VURA 1GQEA 2NW9A 2JIWA 2DLRA 3N2KE 3OYZA 3EVYA 3ZSSA 3LDQB 5FY0A 4DV0T 1WYBA 2EHOC 4F6RC 3IHRA 3Q9DA 2N9DA 2B1EA 1SUMB 2JMKA 2KXPB 5LB7B 2BDEA 1OEDC 2IW5B 4A97A 4HTEA 1SE7A 4CI3B 2BS2A 4UVAB 3OTOT 2LSGA 3AE4A 3AE6A 4EGWA 3OBVE 5ETWA 4TV8E 4HWFA 2V6YA 4KMCA 3UQ4A 2E9XA 2UXNB 2V1DB 3TLVA 1VCTA 3C51A 3ZJ2A 2JQHA 4AQFC 3ZN0B 5ABFB 3O1JA 5AQKB 1E2AA 2BG9E 2E8IA 4TV9E 3HKBE 2N2NA 4ZEYA 2ES0A 5FXZA 4HKAA 2ZLYA 2D5UA 3QNUA 4DR6T 5JR9B 2J62A 5HWYA 3AB3B 2CWYA 1UURA 3N2GE 4KI0F 3HL6A 2DL1A 3AXJA 5A1LA 3N9MA 3V5UA 4LF4T 3GWHA 4HWCA 4P09A 4EB6E 4QXHB 3HKCE 2VKOA 4UR9A 4IGUA 1HNXT 3ZLIA 3RH3A 5L3CB 2WWVA 4UIGA 3ZYMA 4YXDA 1ZP0A 1MMGA 1SHZC 4EV6A 1CHUA 2ZM0A 3ZKRA 2AE9A 5H6RB 5HAXA 4JV5T 3EDVA 4IE0A 3RHWA 4YJ2E 1IBLT 2CBJA 5JDNA 5LMUT 4MLKA 1LVFA 3VR9A 1KNRA 4FI5A 5HEHA 4IDQA 1I94T 4DR3T 3FBLA 3BQIA 3RX6A 2YU1A 3PUXF 3EHZA 3V5SA 4DV4T 1W09A 2DWGA 3I9YA 2DNXA 2X68A 2DWKA 3Q5EA 5L3DB 5JDLA 4A98A 5LG3A 5FYMA 4KUMB 3GMIA 5EK3A 1HG5A 3UUXB 5JDMA 3CQCB 1QUUA 2X51A 1BR1A 2H88A 4JLEA 4CZZB 3LSVA 4B6XA 4GOUA 2VB6A 1W9RA 5IWAT 3KVAA 3UQ7A 2VL0A 4O8SA 2BVMA 3M3ZB 3H3AA 2CXDA 3PUSA 2IIUA 1NAFA 1E1HB 3NVOA 3J7Yq 3VKHA 3N9QA 2ZMAA 2C5IT 4XBFB 2XQ7A 3GA8A 3Q2MA 3RIUA 2KWHA 2LOPA 2W63A 2Y8DA 2CBIA 3PJAJ 4JI3T 3ZMUB 4CN1A 4IHJE 4PW8A 1YQ4A 5L3FB 1B7TA 1WLXA 4O2BE 2MYSA 1UX5A 3FZKB 2UUAT 2WAUA 4OYKA 3K3OA 1W0BA 3NZPA 2V8SV 2Y48B 1HX1B 3FBZA 4GIWA 1G8XA 3EI0A 4WW0A 4IE7A 4ILUA 4G2AA 3RRCA 1ZHCA 3NBXX 3J9X1 1R8IA 4LFCT 2P9BA 1YW0A 3UU5A 3S4UA 3I9WA 1YQ3A 5ABHA 4UV9B 2JQKA 4COFA 2E5VA 2PTFA 4YJ3E 2E5LT 4OYJA 5L47A 2YN6A 5HXRA 4CXXA 5JH7E 4EEBA 4X65T 1SA0E 4ISSA 4PJNA 1VOMA 3NWIA 2Q9QC 2OA5A 4IREA 3UU3A 1AJ3A 2CLYC 4X66T 1HX8A 1KNZA 3PUQA 5CB4E 2WY2A 5EZYE 5LG4A 2KNDA 3AAIA 2JJ9A 1HS7A 4DVDA 4L5GA 5CFBA 2M6IA 4HWDA 2X9YA 2UXBT 3AA6B 3MACA 3KDSE 4ZOLE 1ZOYA 3AEBA 1KFYA 4A56A 2VVNA 3NRXA 3K3QC 4U7YA 3AXJB 1UCUA 1JNZA 4DO0A 4YSZA 2XUEA 4EYUA 4HFIA 3N2OA 3KV4A 2WU5A 1Z0PA 4I50E 3ZT5A 2LM2A 5LGTB 3P4PA 1OWAA 4ZI2D 4YSXA 3JADA 5FNVE 3I1AA 4U33A 4LFBT 4JEHB 3N9PA 5FXVA 3KV6A 2XQ5A 1Y01A 5LNKA 2EHOA 2A72A 3SS1A 2E2AA 2BG9B 5JRCA 5ABGA 4EOZB 2LRKA 2CXFA 2F4VT 4KHPT 1OEDA 5FXXA 2X67A 2XM1A 4O4IE 3F57A 2MOZA 5LBQB 1NWMX 4YTNA 2Q9QB 4HGAA 2QGSA 2JMHA 5FL1A 2LHRA 2G0UA 1FMWA 2X66A 3JCFA 3NKZA 1YXRA 3ZJ1A 1BR2A 3ZEFB 4AQFA 3PUVF 1ZV4X 4ILBA 2L9QA 3VU7H 4WBOA 4NUUA 3ZN1B 1D0YA 2H89A 3OJAA 4EIWA 2WSSV 5DQVA 3ESLA 5LJNA 3KBTA 4ILCA 4AQGA 3UUNA 2XQ3A 4G63A 2FJDA 5LGUB 2V7IA 3AE3A 2CMRA 4V1Av 3U3IA 2NW8A 1I6ZA 2DI4A 3HA4A 4DBQA 4NPPA 4ZZBA 3UUMA 5JR9C 4ZS3A 5JDQA 3CX7B 2YDSA 3WI3A 5F8PA 5GONE 2XASB 3VRBA 4GYSA 4AKGA 4IL4A 3SRZA 1MMAA 1T8BA 5LBMA 4TWDA 2W62A 1KNPA 2WZIA 5AQMB 5C8YE 2W2UA 2V7MA 3A8YC 2WU2A 4B3TT 2NTXA 3NRYA 2VKJA 3I0QA 2WQYA 1UX4A 4O4JE 3SOLA 3QK6A 2W0GA 3DTOA 1MNEA 5FY7A 3PE0A 3C64A 3LG7A 4OFZA 4O4HE 4I4TE 1ZEEA 3TLWA 4ADZA 3H37A 3PU8A 4DV6T 3OYXA 4K0KT 2LSKA 1M62A 3TLSA 3QB5K 5F5WA 4EZ4A 2XPKA 3UFGA 4U74A 1D0ZA 5JDGA 3OVUA 4ZZCA 3RI5A 3B57A 4H9RC 3AAEB 2W67A 4K0UA 3L09A 1JNRA 3AEAA 2XQ4A 2FBWA 2H7OA 1VRBA 4ZS2A 5KX5E 2V6XA 3A5XA 4XAXB 1KF6A 4AI6A 1LKXA 2XQAA 5AQOB 5FKYA 2N1GA 3P8CD 2DHRA 3UT5E 3Q5XA 5DABA 2YEVC 1HFAA
chains in the Genus database with same CATH topology
3J7Yq 1G73A 3RC3A 3VKHA 3QUJA 3MA9A 2KZ7B 1BR0A 3N9QA 2BVLA 1U5PA 2ZMAA 2C5IT 4XBFB 4TX5A 4DMWA 5F3JA 2XQYA 1IJ6A 3ETVA 3GA8A 3M65A 3Q2MA 2KWHA 3ZCIA 2NOXA 3JC6C 5LA6E 5AFUL 2WBLA 2LOPA 3LFMA 2W63A 2Y8DA 3CVRA 4MHCA 4MALA 2V7LA 2PBIA 2KWIB 3MZKB 4M1PA 2Q9QD 3FXDB 3KV9A 3N9NA 3ZMUB 4ANJA 2D2SA 5JDFA 4U72A 2LT3A 2ZM8A 4IHJE 4PW8A 5CA1E 3N5LA 5L3FB 4HEAA 3ZCJA 3UULA 1B7TA 2VASA 4HE8A 1WLXA 3PTRB 4MFRA 3BK9A 4BA9A 4O2BE 2MYSA 1UX5A 2CCQA 5J1GA 3RRWA 4IE6A 5CA0E 2K24A 2WAUA 1IZNB 3LBXB 4OYKA 3K3OA 1D0XA 3LBXA 5TAOA 5HWXA 5LCYA 3NZPA 3T8OA 5LGNB 2Y48B 3FBZA 5HXEA 4GIWA 1G8XA 3AA1B 4AKHA 4H9OC 3N9LA 4WW0A 5ADXL 3N9OA 2V26A 4QX8B 4IE7A 2GK9A 4ILUA 4G2AA 5HXCA 1ZHCA 3RRCA 2VK9A 5EK2A 2K9AA 2K48A 1MIVA 3NBXX 3J9X1 3I0OA 3U78A 3C50A 2H7VC 2X0LB 4YFSA 2P9BA 2W61A 5DQWA 3RKOA 4ZI3C 2V7JA 3VHLA 4BJNA 5HXSA 2J1DG 1YW0A 4UEMA 3S4UA 3D0TA 3I9WA 3BQKA 3MK7C 4IE4A 4UV9B 4Z8XA 3AVRA 1WYCA 2WMOA 2LOSA 1CUNA 4C90A 2YU2A 3ONXA 4E7ZA 4CQIA 3AA7B 4YJ3E 4OYJA 4TUYE 3DJBA 3HKEE 4FJOA 1YKHB 4X1IE 5HXRA 4CXXA 5JH7E 2XAJB 2CLYB 1SA0E 4ISSA 4PJNA 1VOMA 4DNDA 2HPJA 2LJLA 2OA5A 2Q9QC 2D0UA 3C4XA 3O1IA 4O2AE 1AJ3A 2CLYC 3L3PA 1Y64B 3K3NA 3B13A 1HX8A 1KNZA 2ZM2A 4MBQA 1BR4A 3PDYA 3PUQA 4QHOA 2EHOD 5CB4E 4AXPA 5EZYE 5LG4A 2KNDA 2LM9A 3ZC1A 5IHYA 2IC6A 3AAIA 3PUGA 2JJ9A 3WAJA 2L3LA 3CX8B 4O4LE 2WMNA 4H9QC 3E22E 2XAFB 1HS7A 4H9SE 3ZYLA 4AKLA 2ACXA 4I43B 3ZMTB 4DVDA 2QA7A 3W15B 2HH7A 4EAHA 2PFVA 4GYRA 5LXTE 4JUYA 4L5GA 1US7B 2XAQB 2K5BB 2XTLA 3GN5B 3LK42 4GK5E 4PK4A 4PK6A 3TKLB 2X9YA 1FIOA 3O1HA 3FHNA 4QXBB 3AA6B 3MACA 2VKDA 3KDSE 5L3BB 2Z6EA 3DP7A 1YD8G 2YK0A 4ZOLE 1WR6A 2VL8A 4PJJA 4PJLA 2XAHB 3R6NA 4A56A 2LSIA 3NRXA 2MTQA 4PK5A 3UFEA 4OK0A 3K3QC 2X9XA 4PFPA 4DBRA 4DMVA 4L9IA 1UCUA 5FMNA 4DO0A 2XUEA 3ZPOA 1T98A 1HTJF 1U4QA 2RP4A 3O9XA 3PUAA 4EYUA 3EUHA 4NUVA 4QWNB 2VKHA 2Y6XA 3N2OA 3K8PC 3KV4A 3OKQA 2E9XD 4CI2B 1Z0PA 4I50E 3CX6B 3BQLA 3ZMSB 2CWOA 3PU3A 1EZ3A 5LGTB 1OWAA 3RYCE 4ZI2D 5FP3A 3HR0A 2LE8A 5JQGE 4UXNB 4BJMA 2CM0A 2SPCA 5FNVE 3ZMZB 3P7IA 1MNDA 2XHEB 4H63V 3I1AA 1D1CA 3ZMVB 1WRDA 3F31A 4JEHB 3ANWB 3N9PA 3IF8B 2VWAA 3FB2A 3VKGA 3HI2A 3MKDA 4I55E 4PFOA 3KVBA 2KT9A 3KV6A 5FXVA 2EHOB 1LRZA 5LNKA 3LK3B 2M67A 2EHOA 2A72A 2NW9A 5JRCB 3SS1A 5JRCA 2DLRA 3N2KE 3OYZA 1S94A 3EVYA 4QKNA 4J2CA 2C5KT 5FY0A 1WYBA 2EHOC 5LJMA 4EOZB 5FXWA 2CXFA 4F6RC 3IHRA 2A3DA 2W00A 3Q9DA 2N9DA 5FXXA 1HCIA 2B1EA 1MMNA 1ZKEA 2JMKA 1QSDA 2X67A 1S35A 3RC8A 2KXPB 4AKIA 4O4IE 3F57A 2MOZA 4OHFA 3UTKA 2BDEA 2NTYA 5M4YA 2IW5B 4QXCB 4EZHA 5LBQB 1NWMX 4N78D 2WWUA 2Q9QB 4HGAA 2QGSA 2JMHA 4HTEA 2LHRA 4KBMB 2PG8A 1X79A 2I59A 2Q9QA 3CQGB 4WNKA 4CXWA 4CI3B 2JPFA 4GK0E 4UVAB 2L8KA 2C0SA 1D1AA 2G0UA 2LSGA 2IC9A 1FMWA 2X66A 5H6QB 3R84B 2MBGA 3OBVE 2V7KA 4HFVA 5HXHA 5ETWA 5LHGB 2DCFA 2UXXB 3CPZA 4TV8E 3EDUA 3ZJ1A 4KMCA 4UF0B 4X20E 3PURA 1BR2A 3ZEFB 2E9XB 4AQFA 1ZV4X 4L0RA 2E9XA 2UXNB 2LSJA 2V1DB 2L9QA 3VU7H 4WBOA 4NUUA 3RPUA 5LHHB 1OXZA 3C51A 3ZN1B 3ZJ2A 1D0YA 5DJQC 1HF8A 3OJAA 4AQFC 4EIWA 3ZN0B 3O1JA 2WSSV 4ZHQE 2E9XC 5DQVA 3ESLA 5LJNA 2E8IA 3KBTA 4TV9E 3ZC0A 4AQGA 3UUNA 2JQQA 4G63A 3HKBE 5LGUB 5EK4A 2N2NA 2V7IA 2IAKA 4TN7B 5JVDE 2CMRA 4IIJE 2ES0A 5JDHA 5FXZA 4HKAA 4V1Av 3U3IA 5E0OA 2NW8A 2X9WA 2ZLYA 3GN5A 2D5UA 2DI4A 4QX7B 3HA4A 4DBQA 2LSYA 2KINB 5JR9B 4H9NC 2KLQA 5HWYA 4PJMA 4XZCA 2YINA 5JR9A 4UV8B 3AB3B 2CWYA 2HPLA 3E0ZA 4EYYR 4TZ4C 3N2GE 3UUMA 1V9DA 3F2EA 4HN9A 3HL6A 2JRKA 4ZS3A 2X9HA 3CX7B 5JDQA 5JR9C 3C4WA 5LP6E 3WI3A 3Q5WA 5F8PA 2XASB 5GONE 5L3EB 3AVSA 3IEEA 3RYIE 4GYSA 5A1LA 3KBUA 3N9MA 1LVKA 4AKGA 3V5UA 4ZI7E 3GWHA 3SRZA 1KK7A 4P09A 4EB6E 3LK2B 1MMAA 4WBNE 5JREA 4QXHB 3HKCE 4P0BA 5LBMA 3RYFE 2VKOA 2A2FX 4X1KE 2CA5A 2KMFA 2W62A 4IGUA 3ZLIA 3RH3A 5L3CB 1D1BA 4IE5A 4UIGA 4CXYA 3ZYMA 5C8YE 2D0TA 5LYJE 1MMGA 1FMVA 2V7MA 4BAYB 5FY1A 1SHZC 4CI1B 2RA1A 3ANWA 1O3XA 2ZM0A 5H6RB 5HAXA 2CE7A 2NTXA 2WM9A 2ODUA 2PJQA 2VKJA 3NRYA 3E08A 3EDVA 3I0QA 4IE0A 4EXTA 3AAAB 3CKDA 3ZYKA 1UX4A 4YJ2E 2CEAA 5JDNA 4MLKA 1MIWA 4O4JE 1LVFA 3QK6A 3SOLA 2W0GA 3NZQA 3DTOA 1MNEA 4PAGA 3JC6D 3HKDE 4FI5A 5FY7A 5LOVE 3PE0A 3KINB 3QC9A 3C98B 3FBLA 3O4XE 4ISTA 3C64A 3LG7A 4OFZA 4O4HE 3BQIA 3LJCA 4I4TE 3RX6A 1ZEEA 2YU1A 2C5JA 4H9PC 3V5SA 4ADZA 1H7CA 2LEHA 5J2UE 3H37A 1MMDA 3CMLA 3PU8A 1YKEB 3FXEB 3OYXA 1IAPA 5L3GB 2LSKA 4UELA 2DWGA 4ERRA 5KMGP 2NW7A 3I9YA 4AKRB 4E7SA 4EZ4A 2DNXA 2X68A 4YLHA 5LHIB 2DWKA 4U74A 3CQXC 3MXZA 5L3DB 1MIYA 5JDLA 1D0ZA 5JDGA 3CWZB 5FYMA 3KFWX 4KUMB 2H3RA 3GMIA 5EK3A 1HG5A 3B57A 4UF0A 4H9RC 3AAEB 3ETUA 2BZBA 4K0UA 3UUXB 5JDMA 4ASKA 3L09A 3SWHA 5L2LA 4C91A 3CQCB 1QUUA 2H7OA 3C4ZA 2X51A 4IDZA 1VRBA 4JEUB 4ZS2A 3KV5A 2NWBA 1BR1A 4JLEA 4X1YE 4CZZB 5KX5E 3A5XA 4KP3C 4XAXB 3MJXA 4B6XA 4GOUA 2VB6A 4H63H 4ZI2C 4YHJA 1FEWA 4AI6A 2NP9A 2CXLA 4PNIA 3KVAA 4P0AA 1IJ5A 1LKXA 1HG2A 3RYHE 4O8SA 5KDMC 2N1GA 2BVMA 3IBPA 2LHNA 4UVBB 3H3AA 3WAKA 4ZI3D 5BMVE 2XAGB 5IYZE 2CXDA 3PUSA 3P8CD 2DHRA 3UT5E 5J2TE 1NAFA 3Q5XA 5DABA 2ODVA 2YEVC 3AA0B 5HYAA 1E1HB 4UVCB 1HFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUU A;  2SPC A;  3PE0 A;  3UUM A;  1U5P A;  1HCI A;  3UUN A;  3F31 A;  3UUL A;  1S35 A;  1AJ3 A;  3FB2 A;  1U4Q A;  1WLX A;  1CUN A;  2ODU A;  3LBX B;  3EDV A;  3LBX A;  2ODV A;  1OWA A; 
#chains in the Genus database with same CATH topology
 5L4E A;  4WZX A;  3RC3 A;  3MA9 A;  4TX5 A;  5F3J A;  2XQY A;  2VQF T;  3M65 A;  2NOX A;  5AFU L;  1XNR T;  3LFM A;  2BKP A;  4MAL A;  2V7L A;  1NEK A;  2KWI B;  4M1P A;  3KV9 A;  3EAM A;  3N9N A;  1J5W A;  2D2S A;  5JDF A;  4U72 A;  2LT3 A;  2ZM8 A;  2QYW A;  4QH1 A;  3ZCJ A;  2UXC T;  3UUL A;  5AQU B;  2WS3 A;  3PTR B;  2XSA A;  3RRW A;  2K24 A;  1IZN B;  1D0X A;  3B5M A;  3LBX A;  4DR1 T;  4TNV A;  5HWX A;  4B3R T;  4IT4 A;  3T8O A;  3CK6 A;  5LGN B;  4LMJ A;  4H9O C;  2WCA A;  3P4Q A;  2GK9 A;  5EK2 A;  2IML A;  2NR4 A;  1MIV A;  5AQR B;  4YFS A;  2W61 A;  3RKO A;  5HXS A;  2J1D G;  4UEM A;  2WDR A;  2WMO A;  2LOS A;  4C90 A;  3ONX A;  2CHN A;  4CQI A;  3AA7 B;  4TUY E;  4GKJ T;  4FJO A;  4TWF A;  4X1I E;  2YOE A;  3P4R A;  4I0U A;  4LF6 T;  4O2A E;  3RLF F;  4MBQ A;  4QHO A;  2LM9 A;  2LKH A;  2WDV A;  5FL0 A;  1X9B A;  2WZH A;  4DUZ T;  4H9S E;  2ACX A;  3ZMT B;  2QA7 A;  3W15 B;  1US7 B;  3RF1 A;  2K5B B;  2XTL A;  4DR4 T;  3O1H A;  2VKD A;  1VCS A;  2VL8 A;  4U2Z A;  2LSI A;  4PK5 A;  4DBR A;  3TLT A;  4B3M T;  1T98 A;  3PUA A;  2Y6X A;  3OKQ A;  2E9X D;  2UUB T;  4HFB A;  3CX6 B;  3ZMS B;  2CWO A;  3P4W A;  3PU3 A;  5FP3 A;  3HR0 A;  4UXN B;  2CM0 A;  3RGL A;  3P7I A;  2XHE B;  4H63 V;  5AQJ B;  3ZMV B;  1WRD A;  3F31 A;  5LMN T;  2J47 A;  4HWI B;  3CIR A;  3IF8 B;  2VWA A;  3FB2 A;  4HFD A;  4PFO A;  3KVB A;  2KT9 A;  2LRL A;  3AEG A;  2UXD T;  2QVA A;  2M67 A;  4LMK A;  2M6B A;  1S94 A;  4QKN A;  2WDQ A;  5FXW A;  4U7I A;  2A3D A;  2W00 A;  1HCI A;  3ZST A;  1ZKE A;  2BG9 C;  1S35 A;  4AKI A;  4OHF A;  2NTY A;  4DV1 T;  5AQQ B;  1XZY A;  3RQW A;  4KBM B;  2PG8 A;  1X79 A;  2I59 A;  3CQG B;  4GK0 E;  5C3J A;  2L8K A;  5H6Q B;  3R84 B;  2DCF A;  2LLY A;  2UXX B;  2V6Y B;  3CPZ A;  3EDU A;  3AE9 A;  4DV7 T;  4X20 E;  2E9X B;  2A9U A;  4L0R A;  1J5E T;  5LHH B;  3RPU A;  1OXZ A;  4WYV A;  5DJQ C;  4ZHQ E;  5ABF A;  2OV9 A;  3ZC0 A;  4EED A;  1OED E;  2IAK A;  4TN7 B;  5JDH A;  3UU6 A;  1UUS A;  3IA3 A;  2X9W A;  4U3C A;  2LSY A;  2KLQ A;  4PJM A;  5IUX A;  5JR9 A;  2YIN A;  4DV5 T;  1XMO T;  2HPL A;  3QB5 A;  4EYY R;  1UK5 A;  4TZ4 C;  1V9D A;  4HN9 A;  2JRK A;  3Q5W A;  3AVS A;  3IEE A;  5AQH B;  3RYI E;  1IBM T;  4ZI7 E;  2QRX A;  3JAF A;  4P0B A;  3RYF E;  2A2F X;  4QH5 A;  2CA5 A;  2KMF A;  3RIA A;  4NXM T;  2XSB A;  1D1B A;  3AE2 A;  3K1S A;  5LYJ E;  2D0T A;  5FY1 A;  4DID B;  3VR8 A;  4CI1 B;  5J0Z A;  1J1J A;  1XMQ T;  4JYA T;  2XQ8 A;  3CKD A;  3ZYK A;  1MIW A;  5LOV E;  1Z8U A;  3JC6 D;  2BS3 A;  3KIN B;  2LKG A;  3QC9 A;  3AEC A;  3ONL C;  4IST A;  4IDN A;  4A5X A;  3ABV A;  1YKE B;  3FXE B;  1IAP A;  2BKO A;  4HFE A;  4UEL A;  4ERR A;  5KXJ A;  4AKR B;  5LHI B;  3CQX C;  3MXZ A;  2XZE A;  3CWZ B;  4UF0 A;  4ASK A;  4JI1 T;  5L2L A;  4C91 A;  4F8H A;  3AE7 A;  3EAB A;  2K3W A;  3MJX A;  2CXL A;  2WP9 A;  4PNI A;  4P0A A;  4DUY T;  5AQL B;  2IHR 1;  3PV0 F;  5KDM C;  2LHN A;  4UVB B;  4ZI3 D;  4LF7 T;  3PJA A;  2VQE T;  5J2T E;  2ODV A;  5HYA A;  4UVC B;  5AQV B;  2KZ7 B;  3SFD A;  1U5P A;  1WR0 A;  2XQ9 A;  4DMW A;  4OX9 T;  3ETV A;  3ZCI A;  1N36 T;  5LA6 E;  4LF9 T;  3CVR A;  4MHC A;  2PBI A;  4HWH A;  2VVS A;  5CA1 E;  3PUY F;  4HEA A;  4HE8 A;  3AEE A;  4IE6 A;  5CA0 E;  4DR7 T;  5FVK A;  1XWM A;  2JQ9 A;  3ZT7 A;  3AA1 B;  2D9D A;  4AKH A;  1UGO A;  3N9L A;  5ADX L;  3N9O A;  2VK9 A;  2K48 A;  3I0O A;  3ZT6 A;  3U78 A;  2H7V C;  2X0L B;  5DQW A;  3VHL A;  2V7J A;  2ZM6 T;  1L0V A;  3D0T A;  4LML A;  4Z8X A;  5FVL A;  2KSR A;  3AVR A;  4E7Z A;  2UU9 T;  2FJE A;  3HKE E;  4IDO A;  1YKH B;  3Q5D A;  4IL9 A;  4GKK T;  4ZXL A;  4DND A;  3G06 A;  2R6G F;  3K3N A;  1XNQ T;  4JI4 T;  1BR4 A;  3PDY A;  2FUP A;  2EHO D;  4Z91 A;  1WCR A;  5IHY A;  2I0M A;  2L3L A;  3CX8 B;  4O4L E;  2WMN A;  4H9Q C;  5HEU A;  3E22 E;  3ZYL A;  4I43 B;  2HH7 A;  4JUY A;  4AIS A;  4ILA A;  2YKS A;  3P4S A;  4PK6 A;  2I6H A;  4DV3 T;  3AEF A;  3FHN A;  4QXB B;  2Z6E A;  3DP7 A;  1WR6 A;  4PJJ A;  2MTQ A;  3UFE A;  4YSY A;  4B3S T;  5HEJ A;  4DMV A;  5FMN A;  1U4Q A;  1HTJ F;  2RP4 A;  3O9X A;  3EUH A;  4QWN B;  4LF8 T;  3K8P C;  5JTG A;  5CGM A;  4CI2 B;  2ACZ A;  3BQL A;  2W4X A;  1EZ3 A;  1WFD A;  2LE8 A;  4KX6 A;  2SPC A;  3ZMZ B;  4Z90 A;  1KEY A;  3HI2 A;  2EHO B;  1LRZ A;  3LK3 B;  5JRC B;  5HCM A;  2BG9 A;  4J2C A;  2C5K T;  3JAE A;  5LJM A;  2X0Y A;  1OED B;  5AQS B;  1MMN A;  1QSD A;  3RC8 A;  2FJA A;  3UTK A;  5M4Y A;  4QXC B;  4EZH A;  2HHH T;  4N78 D;  2WWU A;  2Q9Q A;  4WNK A;  4CXW A;  2JPF A;  2C0S A;  1D1A A;  2IC9 A;  2MBG A;  2V7K A;  4HFV A;  5HXH A;  5LHG B;  3SFE A;  4NIQ A;  4UF0 B;  3PUR A;  3UU4 A;  1HNW T;  1W0A A;  2LSJ A;  5BR8 T;  5C2T A;  4NXN T;  1HF8 A;  2E9X C;  2JQQ A;  5EK4 A;  5JVD E;  4IIJ E;  3AED A;  1N32 T;  5E0O A;  1N33 T;  3GN5 A;  3OPC A;  4QX7 B;  4JBW F;  2KIN B;  3AE1 A;  4H9N C;  4XZC A;  4UV8 B;  3E0Z A;  2CPT A;  3F2E A;  3UU8 A;  2X9H A;  2B76 A;  3C4W A;  5LP6 E;  5L3E B;  4KHZ F;  4JI2 T;  4Q25 A;  3KBU A;  1T7S A;  3PUW F;  1LVK A;  3H3M A;  2HN1 A;  1KK7 A;  3LK2 B;  4WBN E;  5JRE A;  1NEN A;  4X1K E;  4U2Y A;  4IE5 A;  3FZH B;  4CXY A;  5AQG B;  3L8R A;  1FMV A;  4BAY B;  2MAW A;  4X5T A;  2RA1 A;  2XY8 B;  3ANW A;  5HCJ A;  1O3X A;  2CE7 A;  2WM9 A;  2ODU A;  2PJQ A;  3E08 A;  4EXT A;  3AAA B;  4LFA T;  1M7K A;  2CEA A;  2X0H A;  3NZQ A;  4PAG A;  3HKD E;  3C98 B;  3O4X E;  4JI6 T;  3LJC A;  4X64 T;  2BBH A;  4YTP A;  2C5J A;  4H9P C;  4DV2 T;  1T72 A;  1H7C A;  2LEH A;  5J2U E;  1MMD A;  3CML A;  2AXD S;  4TWH A;  2J4G A;  1FJG T;  5L3G B;  5KMG P;  2NW7 A;  4E7S A;  1N34 T;  4YLH A;  1MIY A;  4JI5 T;  3UUB A;  3KFW X;  2H3R A;  5AQT B;  4CN4 A;  5L4H A;  1HR0 T;  1XDO A;  3ETU A;  2BZB A;  4LF5 T;  3SWH A;  3RIF A;  2IDO B;  2XM2 A;  3C4Z A;  4IDZ A;  4JEU B;  1QLB A;  3KV5 A;  4AIU A;  5CJ5 A;  2NWB A;  2W66 A;  4X1Y E;  4KP3 C;  4H63 H;  4ZI2 C;  4YHJ A;  1FEW A;  2NP9 A;  1IJ5 A;  1HG2 A;  3RYH E;  3WAK A;  3IBP A;  5AQF B;  5BMV E;  2XAG B;  5IYZ E;  2MPK A;  3AA0 B;  2RPA A;  1G73 A;  3QUJ A;  1BR0 A;  2BVL A;  3P50 A;  4P1N A;  1IJ6 A;  2V5D A;  3PUZ F;  3JC6 C;  4QH4 A;  2WBL A;  2V5C A;  3L39 A;  3VRA A;  3RIU C;  3MZK B;  2Q9Q D;  3AE8 A;  3FXD B;  4TNW A;  4ANJ A;  5AQI B;  3N5L A;  2VAS A;  4JI0 T;  4MFR A;  3BK9 A;  4BA9 A;  5HEG A;  4IDP A;  4U31 A;  2HN2 A;  2CCQ A;  5J1G A;  3LBX B;  5TAO A;  5LCY A;  4HFH A;  5HXE A;  4AQY T;  2CRB A;  4X62 T;  2V26 A;  4QX8 B;  5HXC A;  2YDQ A;  2K9A A;  3A7M A;  4YY3 T;  3C50 A;  4DR2 T;  3RQU A;  3AE5 A;  4ZI3 C;  4BJN A;  4CN6 A;  3BQK A;  3MK7 C;  4IE4 A;  3QOF A;  1WYC A;  1CUN A;  2YU2 A;  2XQ6 A;  3DJB A;  4YTM A;  3RKG A;  2XAJ B;  2CLY B;  2HPJ A;  2LJL A;  3C4X A;  3O1I A;  2D0U A;  3FZM B;  3L3P A;  1Y64 B;  3FZL B;  3B13 A;  2FJB A;  1IBK T;  2ZM2 A;  4AXP A;  2OLT A;  2BKN A;  3FZF B;  3ZC1 A;  2IC6 A;  4DR5 T;  3PUG A;  2IUB A;  2XJ7 A;  3WAJ A;  3T1H T;  2XAF B;  4AKL A;  4EAH A;  2PFV A;  4GYR A;  5LXT E;  3X1D A;  2XAQ B;  3GN5 B;  3LK4 2;  4GK5 E;  4PK4 A;  3TKL B;  1FIO A;  3TLU A;  5AQN B;  5L3B B;  1YD8 G;  2YK0 A;  4YHH T;  4PJL A;  2XAH B;  3T1Y T;  3R6N A;  2BS4 A;  2UUC T;  1HNZ T;  5HEO A;  2WB5 A;  4OK0 A;  1DU2 A;  2X9X A;  4PFP A;  4L9I A;  1XDP A;  3ZPO A;  1E7P A;  4HFC A;  4NUV A;  2YDR A;  2VKH A;  2CHO A;  5AQP B;  4JI8 T;  3RYC E;  3ONJ A;  5JQG E;  4BJM A;  5ABE A;  1MND A;  1D1C A;  4YT0 A;  4JI7 T;  3ANW B;  3VKG A;  2BBJ A;  3MKD A;  4I55 E;  2VUR A;  1GQE A;  2NW9 A;  2JIW A;  2DLR A;  3N2K E;  3OYZ A;  3EVY A;  3ZSS A;  3LDQ B;  5FY0 A;  4DV0 T;  1WYB A;  2EHO C;  4F6R C;  3IHR A;  3Q9D A;  2N9D A;  2B1E A;  1SUM B;  2JMK A;  2KXP B;  5LB7 B;  2BDE A;  1OED C;  2IW5 B;  4A97 A;  4HTE A;  1SE7 A;  4CI3 B;  2BS2 A;  4UVA B;  3OTO T;  2LSG A;  3AE4 A;  3AE6 A;  4EGW A;  3OBV E;  5ETW A;  4TV8 E;  4HWF A;  2V6Y A;  4KMC A;  3UQ4 A;  2E9X A;  2UXN B;  2V1D B;  3TLV A;  1VCT A;  3C51 A;  3ZJ2 A;  2JQH A;  4AQF C;  3ZN0 B;  5ABF B;  3O1J A;  5AQK B;  1E2A A;  2BG9 E;  2E8I A;  4TV9 E;  3HKB E;  2N2N A;  4ZEY A;  2ES0 A;  5FXZ A;  4HKA A;  2ZLY A;  2D5U A;  3QNU A;  4DR6 T;  5JR9 B;  2J62 A;  5HWY A;  3AB3 B;  2CWY A;  1UUR A;  3N2G E;  4KI0 F;  3HL6 A;  2DL1 A;  3AXJ A;  5A1L A;  3N9M A;  3V5U A;  4LF4 T;  3GWH A;  4HWC A;  4P09 A;  4EB6 E;  4QXH B;  3HKC E;  2VKO A;  4UR9 A;  4IGU A;  1HNX T;  3ZLI A;  3RH3 A;  5L3C B;  2WWV A;  4UIG A;  3ZYM A;  4YXD A;  1ZP0 A;  1MMG A;  1SHZ C;  4EV6 A;  1CHU A;  2ZM0 A;  3ZKR A;  2AE9 A;  5H6R B;  5HAX A;  4JV5 T;  3EDV A;  4IE0 A;  3RHW A;  4YJ2 E;  1IBL T;  2CBJ A;  5JDN A;  5LMU T;  4MLK A;  1LVF A;  3VR9 A;  1KNR A;  4FI5 A;  5HEH A;  4IDQ A;  1I94 T;  4DR3 T;  3FBL A;  3BQI A;  3RX6 A;  2YU1 A;  3PUX F;  3EHZ A;  3V5S A;  4DV4 T;  1W09 A;  2DWG A;  3I9Y A;  2DNX A;  2X68 A;  2DWK A;  3Q5E A;  5L3D B;  5JDL A;  4A98 A;  5LG3 A;  5FYM A;  4KUM B;  3GMI A;  5EK3 A;  1HG5 A;  3UUX B;  5JDM A;  3CQC B;  1QUU A;  2X51 A;  1BR1 A;  2H88 A;  4JLE A;  4CZZ B;  3LSV A;  4B6X A;  4GOU A;  2VB6 A;  1W9R A;  5IWA T;  3KVA A;  3UQ7 A;  2VL0 A;  4O8S A;  2BVM A;  3M3Z B;  3H3A A;  2CXD A;  3PUS A;  2IIU A;  1NAF A;  1E1H B;  3NVO A;  3J7Y q;  3VKH A;  3N9Q A;  2ZMA A;  2C5I T;  4XBF B;  2XQ7 A;  3GA8 A;  3Q2M A;  3RIU A;  2KWH A;  2LOP A;  2W63 A;  2Y8D A;  2CBI A;  3PJA J;  4JI3 T;  3ZMU B;  4CN1 A;  4IHJ E;  4PW8 A;  1YQ4 A;  5L3F B;  1B7T A;  1WLX A;  4O2B E;  2MYS A;  1UX5 A;  3FZK B;  2UUA T;  2WAU A;  4OYK A;  3K3O A;  1W0B A;  3NZP A;  2V8S V;  2Y48 B;  1HX1 B;  3FBZ A;  4GIW A;  1G8X A;  3EI0 A;  4WW0 A;  4IE7 A;  4ILU A;  4G2A A;  3RRC A;  1ZHC A;  3NBX X;  3J9X 1;  1R8I A;  4LFC T;  2P9B A;  1YW0 A;  3UU5 A;  3S4U A;  3I9W A;  1YQ3 A;  5ABH A;  4UV9 B;  2JQK A;  4COF A;  2E5V A;  2PTF A;  4YJ3 E;  2E5L T;  4OYJ A;  5L47 A;  2YN6 A;  5HXR A;  4CXX A;  5JH7 E;  4EEB A;  4X65 T;  1SA0 E;  4ISS A;  4PJN A;  1VOM A;  3NWI A;  2Q9Q C;  2OA5 A;  4IRE A;  3UU3 A;  1AJ3 A;  2CLY C;  4X66 T;  1HX8 A;  1KNZ A;  3PUQ A;  5CB4 E;  2WY2 A;  5EZY E;  5LG4 A;  2KND A;  3AAI A;  2JJ9 A;  1HS7 A;  4DVD A;  4L5G A;  5CFB A;  2M6I A;  4HWD A;  2X9Y A;  2UXB T;  3AA6 B;  3MAC A;  3KDS E;  4ZOL E;  1ZOY A;  3AEB A;  1KFY A;  4A56 A;  2VVN A;  3NRX A;  3K3Q C;  4U7Y A;  3AXJ B;  1UCU A;  1JNZ A;  4DO0 A;  4YSZ A;  2XUE A;  4EYU A;  4HFI A;  3N2O A;  3KV4 A;  2WU5 A;  1Z0P A;  4I50 E;  3ZT5 A;  2LM2 A;  5LGT B;  3P4P A;  1OWA A;  4ZI2 D;  4YSX A;  3JAD A;  5FNV E;  3I1A A;  4U33 A;  4LFB T;  4JEH B;  3N9P A;  5FXV A;  3KV6 A;  2XQ5 A;  1Y01 A;  5LNK A;  2EHO A;  2A72 A;  3SS1 A;  2E2A A;  2BG9 B;  5JRC A;  5ABG A;  4EOZ B;  2LRK A;  2CXF A;  2F4V T;  4KHP T;  1OED A;  5FXX A;  2X67 A;  2XM1 A;  4O4I E;  3F57 A;  2MOZ A;  5LBQ B;  1NWM X;  4YTN A;  2Q9Q B;  4HGA A;  2QGS A;  2JMH A;  5FL1 A;  2LHR A;  2G0U A;  1FMW A;  2X66 A;  3JCF A;  3NKZ A;  1YXR A;  3ZJ1 A;  1BR2 A;  3ZEF B;  4AQF A;  3PUV F;  1ZV4 X;  4ILB A;  2L9Q A;  3VU7 H;  4WBO A;  4NUU A;  3ZN1 B;  1D0Y A;  2H89 A;  3OJA A;  4EIW A;  2WSS V;  5DQV A;  3ESL A;  5LJN A;  3KBT A;  4ILC A;  4AQG A;  3UUN A;  2XQ3 A;  4G63 A;  2FJD A;  5LGU B;  2V7I A;  3AE3 A;  2CMR A;  4V1A v;  3U3I A;  2NW8 A;  1I6Z A;  2DI4 A;  3HA4 A;  4DBQ A;  4NPP A;  4ZZB A;  3UUM A;  5JR9 C;  4ZS3 A;  5JDQ A;  3CX7 B;  2YDS A;  3WI3 A;  5F8P A;  5GON E;  2XAS B;  3VRB A;  4GYS A;  4AKG A;  4IL4 A;  3SRZ A;  1MMA A;  1T8B A;  5LBM A;  4TWD A;  2W62 A;  1KNP A;  2WZI A;  5AQM B;  5C8Y E;  2W2U A;  2V7M A;  3A8Y C;  2WU2 A;  4B3T T;  2NTX A;  3NRY A;  2VKJ A;  3I0Q A;  2WQY A;  1UX4 A;  4O4J E;  3SOL A;  3QK6 A;  2W0G A;  3DTO A;  1MNE A;  5FY7 A;  3PE0 A;  3C64 A;  3LG7 A;  4OFZ A;  4O4H E;  4I4T E;  1ZEE A;  3TLW A;  4ADZ A;  3H37 A;  3PU8 A;  4DV6 T;  3OYX A;  4K0K T;  2LSK A;  1M62 A;  3TLS A;  3QB5 K;  5F5W A;  4EZ4 A;  2XPK A;  3UFG A;  4U74 A;  1D0Z A;  5JDG A;  3OVU A;  4ZZC A;  3RI5 A;  3B57 A;  4H9R C;  3AAE B;  2W67 A;  4K0U A;  3L09 A;  1JNR A;  3AEA A;  2XQ4 A;  2FBW A;  2H7O A;  1VRB A;  4ZS2 A;  5KX5 E;  2V6X A;  3A5X A;  4XAX B;  1KF6 A;  4AI6 A;  1LKX A;  2XQA A;  5AQO B;  5FKY A;  2N1G A;  3P8C D;  2DHR A;  3UT5 E;  3Q5X A;  5DAB A;  2YEV C;  1HFA A; 
#chains in the Genus database with same CATH homology
 3J7Y q;  1G73 A;  3RC3 A;  3VKH A;  3QUJ A;  3MA9 A;  2KZ7 B;  1BR0 A;  3N9Q A;  2BVL A;  1U5P A;  2ZMA A;  2C5I T;  4XBF B;  4TX5 A;  4DMW A;  5F3J A;  2XQY A;  1IJ6 A;  3ETV A;  3GA8 A;  3M65 A;  3Q2M A;  2KWH A;  3ZCI A;  2NOX A;  3JC6 C;  5LA6 E;  5AFU L;  2WBL A;  2LOP A;  3LFM A;  2W63 A;  2Y8D A;  3CVR A;  4MHC A;  4MAL A;  2V7L A;  2PBI A;  2KWI B;  3MZK B;  4M1P A;  2Q9Q D;  3FXD B;  3KV9 A;  3N9N A;  3ZMU B;  4ANJ A;  2D2S A;  5JDF A;  4U72 A;  2LT3 A;  2ZM8 A;  4IHJ E;  4PW8 A;  5CA1 E;  3N5L A;  5L3F B;  4HEA A;  3ZCJ A;  3UUL A;  1B7T A;  2VAS A;  4HE8 A;  1WLX A;  3PTR B;  4MFR A;  3BK9 A;  4BA9 A;  4O2B E;  2MYS A;  1UX5 A;  2CCQ A;  5J1G A;  3RRW A;  4IE6 A;  5CA0 E;  2K24 A;  2WAU A;  1IZN B;  3LBX B;  4OYK A;  3K3O A;  1D0X A;  3LBX A;  5TAO A;  5HWX A;  5LCY A;  3NZP A;  3T8O A;  5LGN B;  2Y48 B;  3FBZ A;  5HXE A;  4GIW A;  1G8X A;  3AA1 B;  4AKH A;  4H9O C;  3N9L A;  4WW0 A;  5ADX L;  3N9O A;  2V26 A;  4QX8 B;  4IE7 A;  2GK9 A;  4ILU A;  4G2A A;  5HXC A;  1ZHC A;  3RRC A;  2VK9 A;  5EK2 A;  2K9A A;  2K48 A;  1MIV A;  3NBX X;  3J9X 1;  3I0O A;  3U78 A;  3C50 A;  2H7V C;  2X0L B;  4YFS A;  2P9B A;  2W61 A;  5DQW A;  3RKO A;  4ZI3 C;  2V7J A;  3VHL A;  4BJN A;  5HXS A;  2J1D G;  1YW0 A;  4UEM A;  3S4U A;  3D0T A;  3I9W A;  3BQK A;  3MK7 C;  4IE4 A;  4UV9 B;  4Z8X A;  3AVR A;  1WYC A;  2WMO A;  2LOS A;  1CUN A;  4C90 A;  2YU2 A;  3ONX A;  4E7Z A;  4CQI A;  3AA7 B;  4YJ3 E;  4OYJ A;  4TUY E;  3DJB A;  3HKE E;  4FJO A;  1YKH B;  4X1I E;  5HXR A;  4CXX A;  5JH7 E;  2XAJ B;  2CLY B;  1SA0 E;  4ISS A;  4PJN A;  1VOM A;  4DND A;  2HPJ A;  2LJL A;  2OA5 A;  2Q9Q C;  2D0U A;  3C4X A;  3O1I A;  4O2A E;  1AJ3 A;  2CLY C;  3L3P A;  1Y64 B;  3K3N A;  3B13 A;  1HX8 A;  1KNZ A;  2ZM2 A;  4MBQ A;  1BR4 A;  3PDY A;  3PUQ A;  4QHO A;  2EHO D;  5CB4 E;  4AXP A;  5EZY E;  5LG4 A;  2KND A;  2LM9 A;  3ZC1 A;  5IHY A;  2IC6 A;  3AAI A;  3PUG A;  2JJ9 A;  3WAJ A;  2L3L A;  3CX8 B;  4O4L E;  2WMN A;  4H9Q C;  3E22 E;  2XAF B;  1HS7 A;  4H9S E;  3ZYL A;  4AKL A;  2ACX A;  4I43 B;  3ZMT B;  4DVD A;  2QA7 A;  3W15 B;  2HH7 A;  4EAH A;  2PFV A;  4GYR A;  5LXT E;  4JUY A;  4L5G A;  1US7 B;  2XAQ B;  2K5B B;  2XTL A;  3GN5 B;  3LK4 2;  4GK5 E;  4PK4 A;  4PK6 A;  3TKL B;  2X9Y A;  1FIO A;  3O1H A;  3FHN A;  4QXB B;  3AA6 B;  3MAC A;  2VKD A;  3KDS E;  5L3B B;  2Z6E A;  3DP7 A;  1YD8 G;  2YK0 A;  4ZOL E;  1WR6 A;  2VL8 A;  4PJJ A;  4PJL A;  2XAH B;  3R6N A;  4A56 A;  2LSI A;  3NRX A;  2MTQ A;  4PK5 A;  3UFE A;  4OK0 A;  3K3Q C;  2X9X A;  4PFP A;  4DBR A;  4DMV A;  4L9I A;  1UCU A;  5FMN A;  4DO0 A;  2XUE A;  3ZPO A;  1T98 A;  1HTJ F;  1U4Q A;  2RP4 A;  3O9X A;  3PUA A;  4EYU A;  3EUH A;  4NUV A;  4QWN B;  2VKH A;  2Y6X A;  3N2O A;  3K8P C;  3KV4 A;  3OKQ A;  2E9X D;  4CI2 B;  1Z0P A;  4I50 E;  3CX6 B;  3BQL A;  3ZMS B;  2CWO A;  3PU3 A;  1EZ3 A;  5LGT B;  1OWA A;  3RYC E;  4ZI2 D;  5FP3 A;  3HR0 A;  2LE8 A;  5JQG E;  4UXN B;  4BJM A;  2CM0 A;  2SPC A;  5FNV E;  3ZMZ B;  3P7I A;  1MND A;  2XHE B;  4H63 V;  3I1A A;  1D1C A;  3ZMV B;  1WRD A;  3F31 A;  4JEH B;  3ANW B;  3N9P A;  3IF8 B;  2VWA A;  3FB2 A;  3VKG A;  3HI2 A;  3MKD A;  4I55 E;  4PFO A;  3KVB A;  2KT9 A;  3KV6 A;  5FXV A;  2EHO B;  1LRZ A;  5LNK A;  3LK3 B;  2M67 A;  2EHO A;  2A72 A;  2NW9 A;  5JRC B;  3SS1 A;  5JRC A;  2DLR A;  3N2K E;  3OYZ A;  1S94 A;  3EVY A;  4QKN A;  4J2C A;  2C5K T;  5FY0 A;  1WYB A;  2EHO C;  5LJM A;  4EOZ B;  5FXW A;  2CXF A;  4F6R C;  3IHR A;  2A3D A;  2W00 A;  3Q9D A;  2N9D A;  5FXX A;  1HCI A;  2B1E A;  1MMN A;  1ZKE A;  2JMK A;  1QSD A;  2X67 A;  1S35 A;  3RC8 A;  2KXP B;  4AKI A;  4O4I E;  3F57 A;  2MOZ A;  4OHF A;  3UTK A;  2BDE A;  2NTY A;  5M4Y A;  2IW5 B;  4QXC B;  4EZH A;  5LBQ B;  1NWM X;  4N78 D;  2WWU A;  2Q9Q B;  4HGA A;  2QGS A;  2JMH A;  4HTE A;  2LHR A;  4KBM B;  2PG8 A;  1X79 A;  2I59 A;  2Q9Q A;  3CQG B;  4WNK A;  4CXW A;  4CI3 B;  2JPF A;  4GK0 E;  4UVA B;  2L8K A;  2C0S A;  1D1A A;  2G0U A;  2LSG A;  2IC9 A;  1FMW A;  2X66 A;  5H6Q B;  3R84 B;  2MBG A;  3OBV E;  2V7K A;  4HFV A;  5HXH A;  5ETW A;  5LHG B;  2DCF A;  2UXX B;  3CPZ A;  4TV8 E;  3EDU A;  3ZJ1 A;  4KMC A;  4UF0 B;  4X20 E;  3PUR A;  1BR2 A;  3ZEF B;  2E9X B;  4AQF A;  1ZV4 X;  4L0R A;  2E9X A;  2UXN B;  2LSJ A;  2V1D B;  2L9Q A;  3VU7 H;  4WBO A;  4NUU A;  3RPU A;  5LHH B;  1OXZ A;  3C51 A;  3ZN1 B;  3ZJ2 A;  1D0Y A;  5DJQ C;  1HF8 A;  3OJA A;  4AQF C;  4EIW A;  3ZN0 B;  3O1J A;  2WSS V;  4ZHQ E;  2E9X C;  5DQV A;  3ESL A;  5LJN A;  2E8I A;  3KBT A;  4TV9 E;  3ZC0 A;  4AQG A;  3UUN A;  2JQQ A;  4G63 A;  3HKB E;  5LGU B;  5EK4 A;  2N2N A;  2V7I A;  2IAK A;  4TN7 B;  5JVD E;  2CMR A;  4IIJ E;  2ES0 A;  5JDH A;  5FXZ A;  4HKA A;  4V1A v;  3U3I A;  5E0O A;  2NW8 A;  2X9W A;  2ZLY A;  3GN5 A;  2D5U A;  2DI4 A;  4QX7 B;  3HA4 A;  4DBQ A;  2LSY A;  2KIN B;  5JR9 B;  4H9N C;  2KLQ A;  5HWY A;  4PJM A;  4XZC A;  2YIN A;  5JR9 A;  4UV8 B;  3AB3 B;  2CWY A;  2HPL A;  3E0Z A;  4EYY R;  4TZ4 C;  3N2G E;  3UUM A;  1V9D A;  3F2E A;  4HN9 A;  3HL6 A;  2JRK A;  4ZS3 A;  2X9H A;  3CX7 B;  5JDQ A;  5JR9 C;  3C4W A;  5LP6 E;  3WI3 A;  3Q5W A;  5F8P A;  2XAS B;  5GON E;  5L3E B;  3AVS A;  3IEE A;  3RYI E;  4GYS A;  5A1L A;  3KBU A;  3N9M A;  1LVK A;  4AKG A;  3V5U A;  4ZI7 E;  3GWH A;  3SRZ A;  1KK7 A;  4P09 A;  4EB6 E;  3LK2 B;  1MMA A;  4WBN E;  5JRE A;  4QXH B;  3HKC E;  4P0B A;  5LBM A;  3RYF E;  2VKO A;  2A2F X;  4X1K E;  2CA5 A;  2KMF A;  2W62 A;  4IGU A;  3ZLI A;  3RH3 A;  5L3C B;  1D1B A;  4IE5 A;  4UIG A;  4CXY A;  3ZYM A;  5C8Y E;  2D0T A;  5LYJ E;  1MMG A;  1FMV A;  2V7M A;  4BAY B;  5FY1 A;  1SHZ C;  4CI1 B;  2RA1 A;  3ANW A;  1O3X A;  2ZM0 A;  5H6R B;  5HAX A;  2CE7 A;  2NTX A;  2WM9 A;  2ODU A;  2PJQ A;  2VKJ A;  3NRY A;  3E08 A;  3EDV A;  3I0Q A;  4IE0 A;  4EXT A;  3AAA B;  3CKD A;  3ZYK A;  1UX4 A;  4YJ2 E;  2CEA A;  5JDN A;  4MLK A;  1MIW A;  4O4J E;  1LVF A;  3QK6 A;  3SOL A;  2W0G A;  3NZQ A;  3DTO A;  1MNE A;  4PAG A;  3JC6 D;  3HKD E;  4FI5 A;  5FY7 A;  5LOV E;  3PE0 A;  3KIN B;  3QC9 A;  3C98 B;  3FBL A;  3O4X E;  4IST A;  3C64 A;  3LG7 A;  4OFZ A;  4O4H E;  3BQI A;  3LJC A;  4I4T E;  3RX6 A;  1ZEE A;  2YU1 A;  2C5J A;  4H9P C;  3V5S A;  4ADZ A;  1H7C A;  2LEH A;  5J2U E;  3H37 A;  1MMD A;  3CML A;  3PU8 A;  1YKE B;  3FXE B;  3OYX A;  1IAP A;  5L3G B;  2LSK A;  4UEL A;  2DWG A;  4ERR A;  5KMG P;  2NW7 A;  3I9Y A;  4AKR B;  4E7S A;  4EZ4 A;  2DNX A;  2X68 A;  4YLH A;  5LHI B;  2DWK A;  4U74 A;  3CQX C;  3MXZ A;  5L3D B;  1MIY A;  5JDL A;  1D0Z A;  5JDG A;  3CWZ B;  5FYM A;  3KFW X;  4KUM B;  2H3R A;  3GMI A;  5EK3 A;  1HG5 A;  3B57 A;  4UF0 A;  4H9R C;  3AAE B;  3ETU A;  2BZB A;  4K0U A;  3UUX B;  5JDM A;  4ASK A;  3L09 A;  3SWH A;  5L2L A;  4C91 A;  3CQC B;  1QUU A;  2H7O A;  3C4Z A;  2X51 A;  4IDZ A;  1VRB A;  4JEU B;  4ZS2 A;  3KV5 A;  2NWB A;  1BR1 A;  4JLE A;  4X1Y E;  4CZZ B;  5KX5 E;  3A5X A;  4KP3 C;  4XAX B;  3MJX A;  4B6X A;  4GOU A;  2VB6 A;  4H63 H;  4ZI2 C;  4YHJ A;  1FEW A;  4AI6 A;  2NP9 A;  2CXL A;  4PNI A;  3KVA A;  4P0A A;  1IJ5 A;  1LKX A;  1HG2 A;  3RYH E;  4O8S A;  5KDM C;  2N1G A;  2BVM A;  3IBP A;  2LHN A;  4UVB B;  3H3A A;  3WAK A;  4ZI3 D;  5BMV E;  2XAG B;  5IYZ E;  2CXD A;  3PUS A;  3P8C D;  2DHR A;  3UT5 E;  5J2T E;  1NAF A;  3Q5X A;  5DAB A;  2ODV A;  2YEV C;  3AA0 B;  5HYA A;  1E1H B;  4UVC B;  1HFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...