1AK7A

Destrin, nmr, 20 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
174
structure length
174
Chain Sequence
b'TMITPSSGNSASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DESTRIN
publication title Tertiary structure of destrin and structural similarity between two actin-regulating protein families.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Actin depolymerization factor
total genus 19
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 1997-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1ak7A00
1T2LA 2NUTB 4KEDA 4BEX1 5DD2A 5L6WC 1J72A 1YVNG 2FF3A 3CJBG 2LJ8A 1D4XG 3EG9A 2FH1A 1C0FS 2KVKA 1PCXA 2LLFA 2FH3A 3A5NS 2I2QA 2LXXA 3EH1A 1MDUA 2MOTA 1SVYA 1M2VA 3A5OS 3TU5B 1AK7A 5KYUB 2NUTA 4KEFA 3L50A 1KCQA 1YAGG 1NM1G 1EQYS 1PD0A 1CNUA 1F7SA 2FH4A 1X67A 4PKIG 3EFOB 4Z94G 3FG6A 2NUPA 3FG7A 5HVKB 5KYWA 1UDMA 2FGHA 1H1VG 1T3XA 1T3YA 5KYXB 3EH2A 1P8ZG 1CFYA 1VFQA 1Q8XA 1NLVG 1VKKA 5KYUA 5HVKD 5IVUA 1TMWA 2FF6G 4S10C 1SVQA 2VIKA 3FFNA 3Q2BA 2XF1A 5A1MA 1AK6A 1COFA 4PKHB 3EGDB 1T44G 1C0GS 5KYYB 1HQZ1 1Q8GA 4CBXG 3FFKA 3EG9B 1QPVA 4CBUG 5FAEA 1M4JA 1TVJA 4JD2H 3EGXB 2VILA 2XFAA 5FAFA 1JHWA 3CIPG 3A5MS 1M2VB 1NMDG 3CJCG 1NPHA 1RGIG 3A5LS 4PKGG 1M2OA 2L72A 4CBWG 1AHQA 3EGDA 3DAWB 1WFSA 1SVRA 5KYYA 2MV2A 1D0NA 2MP4A 5KYNA 1DEJS 3EFOA 1PD1A 1P8XA 1V6FA 3CI5G 2D8BA 2NUPB 2QTVA 5KYWB 3EGXA 5KYXA 2W0IA 1ESVS 1WM4A 4KEEA 2FH2A 4LIZA 2VACA 2HD7A 1WNJA
chains in the Genus database with same CATH superfamily
1T2LA 2NUTB 4KEDA 4BEX1 5DD2A 5L6WC 1J72A 1YVNG 2FF3A 3CJBG 2LJ8A 1D4XG 3EG9A 2FH1A 1C0FS 2KVKA 1PCXA 2LLFA 2FH3A 3A5NS 2I2QA 2LXXA 3EH1A 1MDUA 2MOTA 1SVYA 1M2VA 3A5OS 3TU5B 1AK7A 5KYUB 2NUTA 4KEFA 3L50A 1KCQA 1YAGG 1NM1G 1EQYS 1PD0A 1CNUA 1F7SA 2FH4A 1X67A 4PKIG 3EFOB 4Z94G 3FG6A 2NUPA 3FG7A 5HVKB 5KYWA 1UDMA 2FGHA 1H1VG 1T3XA 1T3YA 5KYXB 3EH2A 1P8ZG 1CFYA 1VFQA 1Q8XA 1NLVG 1VKKA 5KYUA 5HVKD 5IVUA 1TMWA 2FF6G 4S10C 1SVQA 2VIKA 3FFNA 3Q2BA 2XF1A 5A1MA 1AK6A 1COFA 4PKHB 3EGDB 1T44G 1C0GS 5KYYB 1HQZ1 1Q8GA 4CBXG 3FFKA 3EG9B 1QPVA 4CBUG 5FAEA 1M4JA 1TVJA 4JD2H 3EGXB 2VILA 2XFAA 5FAFA 1JHWA 3CIPG 3A5MS 1M2VB 1NMDG 3CJCG 1NPHA 1RGIG 3A5LS 4PKGG 1M2OA 2L72A 4CBWG 1AHQA 3EGDA 3DAWB 1WFSA 1SVRA 5KYYA 2MV2A 1D0NA 2MP4A 5KYNA 1DEJS 3EFOA 1PD1A 1P8XA 1V6FA 3CI5G 2D8BA 2NUPB 2QTVA 5KYWB 3EGXA 5KYXA 2W0IA 1ESVS 1WM4A 3DA7A 4KEEA 2FH2A 4LIZA 2VACA 2HD7A 1WNJA
chains in the Genus database with same CATH topology
1T2LA 2NUTB 4KEDA 4BEX1 5DD2A 5L6WC 1J72A 1YVNG 2FF3A 3CJBG 2LJ8A 1D4XG 3EG9A 2FH1A 1C0FS 2KVKA 1PCXA 2LLFA 2FH3A 3A5NS 2I2QA 2LXXA 3EH1A 1MDUA 2MOTA 1SVYA 1M2VA 3A5OS 3TU5B 1AK7A 5KYUB 2NUTA 4KEFA 3L50A 1KCQA 1YAGG 1NM1G 1EQYS 1PD0A 1CNUA 1F7SA 2FH4A 1X67A 4PKIG 3EFOB 4Z94G 3FG6A 2NUPA 3FG7A 5HVKB 5KYWA 1UDMA 2FGHA 1H1VG 1T3XA 1T3YA 5KYXB 3EH2A 1P8ZG 1CFYA 1VFQA 1Q8XA 1NLVG 1VKKA 5KYUA 5HVKD 5IVUA 1TMWA 2FF6G 4S10C 1SVQA 2VIKA 3FFNA 3Q2BA 2XF1A 5A1MA 1AK6A 1COFA 4PKHB 3EGDB 1T44G 1C0GS 5KYYB 1HQZ1 1Q8GA 4CBXG 3FFKA 3EG9B 1QPVA 4CBUG 5FAEA 1M4JA 1TVJA 4JD2H 3EGXB 2VILA 2XFAA 5FAFA 1JHWA 3CIPG 3A5MS 1M2VB 1NMDG 3CJCG 1NPHA 1RGIG 3A5LS 4PKGG 1M2OA 2L72A 4CBWG 1AHQA 3EGDA 3DAWB 1WFSA 1SVRA 5KYYA 2MV2A 1D0NA 2MP4A 5KYNA 1DEJS 3EFOA 1PD1A 1P8XA 1V6FA 3CI5G 2D8BA 2NUPB 2QTVA 5KYWB 3EGXA 5KYXA 2W0IA 1ESVS 1WM4A 3DA7A 4KEEA 2FH2A 4LIZA 2VACA 2HD7A 1WNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2L A;  2NUT B;  4KED A;  4BEX 1;  5DD2 A;  5L6W C;  1J72 A;  1YVN G;  2FF3 A;  3CJB G;  2LJ8 A;  1D4X G;  3EG9 A;  2FH1 A;  1C0F S;  2KVK A;  1PCX A;  2LLF A;  2FH3 A;  3A5N S;  2I2Q A;  2LXX A;  3EH1 A;  1MDU A;  2MOT A;  1SVY A;  1M2V A;  3A5O S;  3TU5 B;  1AK7 A;  5KYU B;  2NUT A;  4KEF A;  3L50 A;  1KCQ A;  1YAG G;  1NM1 G;  1EQY S;  1PD0 A;  1CNU A;  1F7S A;  2FH4 A;  1X67 A;  4PKI G;  3EFO B;  4Z94 G;  3FG6 A;  2NUP A;  3FG7 A;  5HVK B;  5KYW A;  1UDM A;  2FGH A;  1H1V G;  1T3X A;  1T3Y A;  5KYX B;  3EH2 A;  1P8Z G;  1CFY A;  1VFQ A;  1Q8X A;  1NLV G;  1VKK A;  5KYU A;  5HVK D;  5IVU A;  1TMW A;  2FF6 G;  4S10 C;  1SVQ A;  2VIK A;  3FFN A;  3Q2B A;  2XF1 A;  5A1M A;  1AK6 A;  1COF A;  4PKH B;  3EGD B;  1T44 G;  1C0G S;  5KYY B;  1HQZ 1;  1Q8G A;  4CBX G;  3FFK A;  3EG9 B;  1QPV A;  4CBU G;  5FAE A;  1M4J A;  1TVJ A;  4JD2 H;  3EGX B;  2VIL A;  2XFA A;  5FAF A;  1JHW A;  3CIP G;  3A5M S;  1M2V B;  1NMD G;  3CJC G;  1NPH A;  1RGI G;  3A5L S;  4PKG G;  1M2O A;  2L72 A;  4CBW G;  1AHQ A;  3EGD A;  3DAW B;  1WFS A;  1SVR A;  5KYY A;  2MV2 A;  1D0N A;  2MP4 A;  5KYN A;  1DEJ S;  3EFO A;  1PD1 A;  1P8X A;  1V6F A;  3CI5 G;  2D8B A;  2NUP B;  2QTV A;  5KYW B;  3EGX A;  5KYX A;  2W0I A;  1ESV S;  1WM4 A;  4KEE A;  2FH2 A;  4LIZ A;  2VAC A;  2HD7 A;  1WNJ A; 
#chains in the Genus database with same CATH topology
 1T2L A;  2NUT B;  4KED A;  4BEX 1;  5DD2 A;  5L6W C;  1J72 A;  1YVN G;  2FF3 A;  3CJB G;  2LJ8 A;  1D4X G;  3EG9 A;  2FH1 A;  1C0F S;  2KVK A;  1PCX A;  2LLF A;  2FH3 A;  3A5N S;  2I2Q A;  2LXX A;  3EH1 A;  1MDU A;  2MOT A;  1SVY A;  1M2V A;  3A5O S;  3TU5 B;  1AK7 A;  5KYU B;  2NUT A;  4KEF A;  3L50 A;  1KCQ A;  1YAG G;  1NM1 G;  1EQY S;  1PD0 A;  1CNU A;  1F7S A;  2FH4 A;  1X67 A;  4PKI G;  3EFO B;  4Z94 G;  3FG6 A;  2NUP A;  3FG7 A;  5HVK B;  5KYW A;  1UDM A;  2FGH A;  1H1V G;  1T3X A;  1T3Y A;  5KYX B;  3EH2 A;  1P8Z G;  1CFY A;  1VFQ A;  1Q8X A;  1NLV G;  1VKK A;  5KYU A;  5HVK D;  5IVU A;  1TMW A;  2FF6 G;  4S10 C;  1SVQ A;  2VIK A;  3FFN A;  3Q2B A;  2XF1 A;  5A1M A;  1AK6 A;  1COF A;  4PKH B;  3EGD B;  1T44 G;  1C0G S;  5KYY B;  1HQZ 1;  1Q8G A;  4CBX G;  3FFK A;  3EG9 B;  1QPV A;  4CBU G;  5FAE A;  1M4J A;  1TVJ A;  4JD2 H;  3EGX B;  2VIL A;  2XFA A;  5FAF A;  1JHW A;  3CIP G;  3A5M S;  1M2V B;  1NMD G;  3CJC G;  1NPH A;  1RGI G;  3A5L S;  4PKG G;  1M2O A;  2L72 A;  4CBW G;  1AHQ A;  3EGD A;  3DAW B;  1WFS A;  1SVR A;  5KYY A;  2MV2 A;  1D0N A;  2MP4 A;  5KYN A;  1DEJ S;  3EFO A;  1PD1 A;  1P8X A;  1V6F A;  3CI5 G;  2D8B A;  2NUP B;  2QTV A;  5KYW B;  3EGX A;  5KYX A;  2W0I A;  1ESV S;  1WM4 A;  3DA7 A;  4KEE A;  2FH2 A;  4LIZ A;  2VAC A;  2HD7 A;  1WNJ A; 
#chains in the Genus database with same CATH homology
 1T2L A;  2NUT B;  4KED A;  4BEX 1;  5DD2 A;  5L6W C;  1J72 A;  1YVN G;  2FF3 A;  3CJB G;  2LJ8 A;  1D4X G;  3EG9 A;  2FH1 A;  1C0F S;  2KVK A;  1PCX A;  2LLF A;  2FH3 A;  3A5N S;  2I2Q A;  2LXX A;  3EH1 A;  1MDU A;  2MOT A;  1SVY A;  1M2V A;  3A5O S;  3TU5 B;  1AK7 A;  5KYU B;  2NUT A;  4KEF A;  3L50 A;  1KCQ A;  1YAG G;  1NM1 G;  1EQY S;  1PD0 A;  1CNU A;  1F7S A;  2FH4 A;  1X67 A;  4PKI G;  3EFO B;  4Z94 G;  3FG6 A;  2NUP A;  3FG7 A;  5HVK B;  5KYW A;  1UDM A;  2FGH A;  1H1V G;  1T3X A;  1T3Y A;  5KYX B;  3EH2 A;  1P8Z G;  1CFY A;  1VFQ A;  1Q8X A;  1NLV G;  1VKK A;  5KYU A;  5HVK D;  5IVU A;  1TMW A;  2FF6 G;  4S10 C;  1SVQ A;  2VIK A;  3FFN A;  3Q2B A;  2XF1 A;  5A1M A;  1AK6 A;  1COF A;  4PKH B;  3EGD B;  1T44 G;  1C0G S;  5KYY B;  1HQZ 1;  1Q8G A;  4CBX G;  3FFK A;  3EG9 B;  1QPV A;  4CBU G;  5FAE A;  1M4J A;  1TVJ A;  4JD2 H;  3EGX B;  2VIL A;  2XFA A;  5FAF A;  1JHW A;  3CIP G;  3A5M S;  1M2V B;  1NMD G;  3CJC G;  1NPH A;  1RGI G;  3A5L S;  4PKG G;  1M2O A;  2L72 A;  4CBW G;  1AHQ A;  3EGD A;  3DAW B;  1WFS A;  1SVR A;  5KYY A;  2MV2 A;  1D0N A;  2MP4 A;  5KYN A;  1DEJ S;  3EFO A;  1PD1 A;  1P8X A;  1V6F A;  3CI5 G;  2D8B A;  2NUP B;  2QTV A;  5KYW B;  3EGX A;  5KYX A;  2W0I A;  1ESV S;  1WM4 A;  3DA7 A;  4KEE A;  2FH2 A;  4LIZ A;  2VAC A;  2HD7 A;  1WNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...