1APFA

Anthopleurin-b, nmr, 20 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
49
structure length
49
Chain Sequence
b'GVPCLCDSDGPRPRGNTLSGILWFYPSGCPSGWHNCKAHGPNIGWCCKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTHOPLEURIN-B
publication title Solution structure of the cardiostimulant polypeptide anthopleurin-B and comparison with anthopleurin-A.
pubmed doi rcsb
molecule tags Cardiac stimulant
total genus 7
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1995-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00706 Toxin_4 Anenome neurotoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.20.10 Mainly Beta Single Sheet Anthopleurin-A Anthopleurin-A 1apfA00
2JTOA 1B8WA 1APFA 1ZLHB 1BDSA 2H9XA 3D4UB 2MUBA 4GV5A 1H5OA 1D6BA 1WQKA 2MN3A 3LMSB 1SHIA 1ZLIB 2K2XA 2BDSA 1ATXA 2SH1A 1SH1A 1WXNA 1ZUFA 1ZUEA 1Z99A 1AHLA 2RNGA
chains in the Genus database with same CATH superfamily
3IF4A 2JTOA 2JR3A 3C38A 2QSFA 1B8WA 2HJ9C 1APFA 1ZLHB 1BDSA 2H9XA 3C30A 3D4UB 3KEZA 1ZHHB 2MUBA 1GKUB 4GV5A 4YIRA 2QSHA 1H5OA 1D6BA 1EL6A 1WQKA 2MN3A 3LMSB 1SHIA 1ZLIB 2K2XA 2DLAA 2IKEA 2QSGA 2BDSA 1ATXA 2B9KA 2SH1A 2HJEA 3MCXA 2XXLA 1SH1A 1WXNA 1ZUFA 1ZUEA 1Z99A 3MYVA 1GL9B 1AHLA 2IKDA 2RNGA
chains in the Genus database with same CATH topology
2JTOA 2JR3A 3C38A 2QSFA 1B8WA 2HJ9C 1APFA 1ZLHB 1BDSA 2H9XA 3C30A 3D4UB 3KEZA 1ZHHB 2MUBA 4GV5A 4YIRA 1H5OA 2QSHA 1D6BA 1WQKA 2MN3A 3LMSB 1SHIA 1ZLIB 2K2XA 2DLAA 2IKEA 2QSGA 2BDSA 1ATXA 2B9KA 2SH1A 2HJEA 3MCXA 2XXLA 1SH1A 1WXNA 1ZUFA 1ZUEA 1Z99A 3MYVA 1AHLA 2IKDA 2RNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTO A;  1B8W A;  1APF A;  1ZLH B;  1BDS A;  2H9X A;  3D4U B;  2MUB A;  4GV5 A;  1H5O A;  1D6B A;  1WQK A;  2MN3 A;  3LMS B;  1SHI A;  1ZLI B;  2K2X A;  2BDS A;  1ATX A;  2SH1 A;  1SH1 A;  1WXN A;  1ZUF A;  1ZUE A;  1Z99 A;  1AHL A;  2RNG A; 
#chains in the Genus database with same CATH topology
 3IF4 A;  2JTO A;  2JR3 A;  3C38 A;  2QSF A;  1B8W A;  2HJ9 C;  1APF A;  1ZLH B;  1BDS A;  2H9X A;  3C30 A;  3D4U B;  3KEZ A;  1ZHH B;  2MUB A;  1GKU B;  4GV5 A;  4YIR A;  2QSH A;  1H5O A;  1D6B A;  1EL6 A;  1WQK A;  2MN3 A;  3LMS B;  1SHI A;  1ZLI B;  2K2X A;  2DLA A;  2IKE A;  2QSG A;  2BDS A;  1ATX A;  2B9K A;  2SH1 A;  2HJE A;  3MCX A;  2XXL A;  1SH1 A;  1WXN A;  1ZUF A;  1ZUE A;  1Z99 A;  3MYV A;  1GL9 B;  1AHL A;  2IKD A;  2RNG A; 
#chains in the Genus database with same CATH homology
 2JTO A;  2JR3 A;  3C38 A;  2QSF A;  1B8W A;  2HJ9 C;  1APF A;  1ZLH B;  1BDS A;  2H9X A;  3C30 A;  3D4U B;  3KEZ A;  1ZHH B;  2MUB A;  4GV5 A;  4YIR A;  1H5O A;  2QSH A;  1D6B A;  1WQK A;  2MN3 A;  3LMS B;  1SHI A;  1ZLI B;  2K2X A;  2DLA A;  2IKE A;  2QSG A;  2BDS A;  1ATX A;  2B9K A;  2SH1 A;  2HJE A;  3MCX A;  2XXL A;  1SH1 A;  1WXN A;  1ZUF A;  1ZUE A;  1Z99 A;  3MYV A;  1AHL A;  2IKD A;  2RNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...