The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
2
|
sequence length |
46
|
structure length |
46
|
Chain Sequence |
GAACLCKSDGPNTRGNSMSGTIWVFGCPSGWNNCEGRAIIGYCCKQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Sea anemone toxin
|
molecule keywords |
ATX IA
|
publication title |
Three-dimensional structure of the neurotoxin ATX Ia from Anemonia sulcata in aqueous solution determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb |
source organism |
Anemonia sulcata
|
total genus |
2
|
structure length |
46
|
sequence length |
46
|
ec nomenclature | |
pdb deposition date | 1990-05-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00706 | Toxin_4 | Anenome neurotoxin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A |
#chains in the Genus database with same CATH superfamily 1AHL A; 2H9X A; 1ZUF A; 1ZLH B; 2MN3 A; 2MUB A; 2RNG A; 1WQK A; 1BDS A; 2BDS A; 3LMS B; 1ATX A; 4GV5 A; 1ZUE A; 1SHI A; 3D4U B; 1ZLI B; 1D6B A; 1SH1 A; 2SH1 A; 1B8W A; 2JTO A; 1APF A; 1WXN A; 1Z99 A; 2K2X A; 1H5O A; #chains in the Genus database with same CATH topology 2QSH A; 1AHL A; 2JR3 A; 2H9X A; 2B9K A; 1GKU B; 2QSG A; 1ZUF A; 1ZLH B; 2HJE A; 2MN3 A; 2MUB A; 3IF4 A; 2RNG A; 1EL6 A; 1WQK A; 1BDS A; 2BDS A; 3LMS B; 3C30 A; 2IKE A; 2QSF A; 4GV5 A; 1ATX A; 1ZUE A; 1SHI A; 3MCX A; 3D4U B; 1ZLI B; 1GL9 B; 2HJ9 C; 1D6B A; 1SH1 A; 3C38 A; 2SH1 A; 4YIR A; 1B8W A; 2IKD A; 2DLA A; 2JTO A; 2XXL A; 1APF A; 1WXN A; 1Z99 A; 3KEZ A; 2K2X A; 1ZHH B; 1H5O A; 3MYV A; #chains in the Genus database with same CATH homology 2QSH A; 1AHL A; 2JR3 A; 2H9X A; 2B9K A; 2QSG A; 1ZUF A; 1ZLH B; 2HJE A; 2MN3 A; 2MUB A; 2RNG A; 1WQK A; 1BDS A; 2BDS A; 3LMS B; 3C30 A; 2IKE A; 2QSF A; 4GV5 A; 1ATX A; 1ZUE A; 1SHI A; 3MCX A; 3D4U B; 1ZLI B; 2HJ9 C; 1D6B A; 1SH1 A; 3C38 A; 2SH1 A; 4YIR A; 1B8W A; 2IKD A; 2DLA A; 2JTO A; 2XXL A; 1APF A; 1WXN A; 1Z99 A; 3KEZ A; 2K2X A; 1ZHH B; 1H5O A; 3MYV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...