1AWEA

Human sos1 pleckstrin homology (ph) domain, nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
130
structure length
130
Chain Sequence
b'MNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOS1
publication title The solution structure of the pleckstrin homology domain of human SOS1. A possible structural role for the sequential association of diffuse B cell lymphoma and pleckstrin homology domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 17
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1aweA00
1UNQA 5DIFB 1UEFA 4MY6A 3X23A 1OQNA 1SHCA 4K17A 3GYPA 4HB0B 2COFA 2D4QA 1EVHA 4F7HA 4CHJA 2ELAA 1V88A 3PVWA 3CIKA 3P7ZA 2DKQA 2CY4A 1U5EA 1NI2A 1RRPB 3KRWA 4HDQA 1NTYA 4HAVB 1MK9B 4A5KA 1XR0B 5D27A 1M7EA 3U8ZA 2Q13A 1ZC3B 3A98B 2AEHA 2UZRA 3VIAA 2Z0PA 1UNRA 1FGZA 4KVGB 5DHAB 1P5TA 2RNRB 4KHAA 4HAWB 1MKEA 1DROA 1RJ2A 1NTVA 5DI9B 1Y5OA 3QBVB 2N23A 2J0JA 2XQNM 2MDXA 2YF0A 2R09A 1MK7B 3QIJA 4K2OA 5D3YA 2UVMA 4NSWA 4HB2B 1ZVRA 2G35A 1UPQA 2LYDA 5KQ4A 1U5GA 4WVFB 2EMTA 1FB8A 3KY9A 1KZGA 3KSYA 2W2XD 1X05A 2COCA 2DX1A 2OTXA 2HTHB 3BINA 1DBHA 4HB4B 3CXBB 3PVLA 3O96A 1GG3A 1W1HA 1TXDA 2W2WA 1MAIA 2DHJA 2D9XA 3TW1A 1XD4A 1P6SA 2HE7A 2YRYA 5C79A 1U5FA 2DHKA 1Z87A 2MKRA 2QKMA 2M14A 2Y8GA 1K5DB 2EC1A 3D8FA 3SYXA 1U2BA 5EFXA 3ULCA 3DXEA 2KGXB 2K2JA 3AU4A 2M38A 2BCJA 3G9WA 2J59M 5J3QA 3HQCA 2DTCA 4ZRIA 2R0DA 1MIXA 3SO6A 4EKUA 4P7IA 2MWNB 2DA0A 2GCLA 5JP4A 2EMSA 1MIZB 2LOZA 4MT7A 4HAZB 2LOXA 1IRSA 1UPRA 2L1CA 2YVCA 4F7GA 1B55A 2FJLA 2COAA 2V76A 1BTNA 5LONB 4KHBB 2N0YA 5KCVA 4KHOA 1WI1A 3PEGA 3FM8C 2YT0A 1XODA 2H7DA 1EGXA 4A6FB 4IFSA 2GJYA 2YT1A 4K2PA 2Y7BA 2YS3A 2CAYA 1WJ1A 4IAPA 4EMOA 4HDOA 1XCGA 1SGHA 5CLQB 3SUZA 1WGUA 5HE1A 3IVFA 2K2UA 5C5BB 2MFQA 4MK0A 3TVVA 2J0KA 1V5MA 1KI1B 4GMXB 2CY5A 3SV1A 2CODA 3RCPA 3A8PA 1BTKA 1DDVA 2LULA 2VKIA 4WJ7A 5JLJB 1MPHA 1J0WA 4H8SA 1X1FA 5JHHA 2D9ZA 2D9YA 2DYQA 3PG7A 4HAYB 4TYZA 5GOWB 3D8EA 1PFJA 2RUKB 5DH9B 1BAKA 2P0HA 3VOQA 3MDBC 1U27A 1E5WA 4NY0A 5FI0A 4IOYX 2RGNB 1X86A 3N7CA 1ZC4B 4CYEA 4WSFA 2NMBA 5HE0A 3OANA 1W1DA 4HATB 3NSUA 4L6EA 3ODOA 1P3RA 3D8DA 1K5GB 1FHOA 4CHMA 1W1GA 1LB1A 4PQ0A 3HK0A 2P8VA 3ML4A 4KAXB 5D3VA 2GS0A 1KZ7A 2D9WA 1FGYA 1H4RA 2Y8FA 4DXAB 4BBKA 4A6FA 2LG1A 2K00A 2ADZA 5J3TA 3T06A 1U29A 2P0FA 1FOEA 3FSSA 3ODXA 2DHIA 3TO1A 3ZVRA 3TCAA 2QKLA 3WYFB 4K81A 2UZSA 4GZUA 1AQCA 1DDWA 2D2QA 2YS1A 2KUPA 2D10A 5CLLB 5C5BA 4GXBA 1WJMA 4F7UP 3HW2B 1XX0A 3BJIA 1LW3A 2KCJA 4Z2MB 4YONA 3AU5A 2P0DA 3UZTA 1ZM0A 1V5UA 4ZRKA 1TJ6A 2D9VA 1V5PA 4EJNA 2IYBA 1DYNA 2J0MA 1FHWA 3ODWA 2VRWB 3FEHA 4GPTB 3QWMA 2Z0QA 1AWEA 1WVHA 1UNPA 2DYNA 5C16A 1N3HA 2Z0OA 2E2XA 4Z2NA 1QC6A 4A6HA 2DKPA 4Y94A 3V5WA 2IFSA 2DFKA 1WG7A 1I7AA 5D3WA 4A6KA 3F5RA 1FHXA 2PZ1A 1WGQA 5DHFB 4PNKA 3MPXA 3WA0A 4DX90 5KQ1A 2YS5A 4ZRJA 1BWNA 1Y19B 2RLOA 4HAUB 3AJ4A 5LOPB 1M7RA 1X11A 2ELBA 4HB3B 3M1IB 4C0AA 4YL8A 2ZPYA 2I1JA 1NU2A 3DXCA 2EJ8A 4GMVA 2D11A 2ROZB 2NZ8B 1PMSA 1QQGA 1XKEA 2JP2A 3ZDTA 3A8QA 2CRFA 1TQZA 2L2IA 5C6RA 1ZSQA 2ROVA 4D0NB 4GN1A 2GCJA 1GC6A 1U5DA 5J3YA 2DN6A 2I5FA 2W2XC 5FI1A 1Q67A 2RSGA 2VSZA 3P6AA 3GYOA 4DBBA 1DDMA 5JHGA 2I5CA 2X18A 2AL6A 2DX5A 1FAOA 3PVUA 3SNHA 1V61A 3F0WA 2OQBA 1J19A 4B6HA 2I1KA 3PP2A 5HE3A 4DX8A 5D3XA 2DLWA 2RVBB 1OMWA 3KZ1A 1V89A 3TFMA 3PSCA 1X1GA 4XWXA 1EAZA 3KRXA 3ULBA 3LJUX 4HHVA 5L81A 1GC7A 2H7EA 2LKOA 1H10A 4HAXB 1I2HA 4TKNA 3U7DA 5HE2A 1EF1A 1OY2A 1PLSA 3DXDA 1ISNA 2YSZA 3PZDA
chains in the Genus database with same CATH superfamily
1UNQA 5DIFB 1UEFA 4MY6A 3X23A 1OQNA 1SHCA 4K17A 3GYPA 4HB0B 2COFA 2Z4DA 2K8EA 2D4QA 1EVHA 4F7HA 4CHJA 2ELAA 1V88A 4HSIA 3PVWA 3CIKA 3P7ZA 2DKQA 2CY4A 1U5EA 1NI2A 1RRPB 3KRWA 4HDQA 1NTYA 4HAVB 1MK9B 4A5KA 1XR0B 5D27A 1M7EA 3U8ZA 2Q13A 1ZC3B 3A98B 2AEHA 2UZRA 3VIAA 2Z0PA 1UNRA 1FGZA 4KVGB 5DHAB 1P5TA 2RNRB 4KHAA 4HAWB 1MKEA 1DROA 2KUQA 1RJ2A 1NTVA 5DI9B 1Y5OA 3QBVB 3FVCA 2N23A 2J0JA 2MDXA 2XQNM 2YF0A 2R09A 1MK7B 3QIJA 4K2OA 5D3YA 2UVMA 4NSWA 4HB2B 1ZVRA 2G35A 1UPQA 4QXAB 2LYDA 5KQ4A 1U5GA 4WVFB 2EMTA 1FB8A 3KY9A 1KZGA 3KSYA 2W2XD 1X05A 2COCA 2DX1A 2OTXA 2HTHB 3BINA 1DBHA 4HB4B 3CXBB 3PVLA 3O96A 1GG3A 1W1HA 1TXDA 2W2WA 1MAIA 2DHJA 2Z13A 2D9XA 3TW1A 1XD4A 1P6SA 2HE7A 2YRYA 5C79A 1U5FA 2DHKA 1Z87A 2MKRA 2QKMA 2M14A 2Y8GA 1K5DB 2EC1A 3D8FA 3DCXA 3SYXA 1U2BA 5EFXA 4QJ3B 3ULCA 3DXEA 2GUMA 2KGXB 2K2JA 3AU4A 2KR0A 2M38A 2BCJA 1MI1A 2J59M 3G9WA 5J3QA 3HQCA 2DTCA 4ZRIA 2R0DA 1MIXA 3SO6A 4EKUA 4P7IA 2MWNB 2DA0A 2GCLA 5JP4A 2EMSA 1MIZB 2LOZA 2FJUB 3OHMB 4MT7A 4HAZB 2LOXA 1IRSA 1UPRA 2L1CA 2YVCA 5I2MA 4F7GA 1B55A 3HSAA 2FJLA 5M4YB 2COAA 2V76A 1ZYIA 1BTNA 5LONB 4KHBB 2N0YA 3NWAA 5KCVA 4KHOA 1WI1A 3PEGA 3FM8C 2YT0A 1XODA 2H7DA 4OT1A 1EGXA 4A6FB 4IFSA 2GJYA 2ZKMX 2YT1A 4K2PA 3NWFA 5I2SA 2Y7BA 2YS3A 2CAYA 1WJ1A 4IAPA 2KIGA 4EMOA 4HDOA 1T77A 1SGHA 1XCGA 5CLQB 1WGUA 3SUZA 5HE1A 3IVFA 2K2UA 5C5BB 2MFQA 4MK0A 3TVVA 2J0KA 1V5MA 1KI1B 4GMXB 2CY5A 3SV1A 2CODA 3RCPA 3A8PA 1BTKA 1DDVA 2LULA 2VKIA 4WJ7A 2RRFA 5JLJB 4GOUA 1MPHA 1J0WA 4H8SA 1X1FA 5JHHA 2D9ZA 2D9YA 2DYQA 3PG7A 4HAYB 4TYZA 5GOWB 3D8EA 1PFJA 2RUKB 5DH9B 1BAKA 2P0HA 3VOQA 3MDBC 1U27A 1E5WA 4NY0A 5FI0A 4IOYX 2RGNB 1X86A 3N7CA 1ZC4B 4CYEA 5IRSA 4WSFA 5LG4B 2Z14A 2NMBA 5HE0A 3OANA 1W1DA 4HATB 3NSUA 4L6EA 3ODOA 1P3RA 3D8DA 1K5GB 3NWDA 1FHOA 4CHMA 1W1GA 2Z59A 1LB1A 4PQ0A 2YT2A 3A58A 3HK0A 2P8VA 3ML4A 4OSNA 4KAXB 5D3VA 2GS0A 1KZ7A 2D9WA 1FGYA 1H4RA 2Y8FA 4DXAB 4QJ4B 4BBKA 4A6FA 2LG1A 2NBVA 2K00A 2ADZA 5J3TA 3T06A 1U29A 3NW8A 2R2YA 2P0FA 1FOEA 3FSSA 3ODXA 2DHIA 3TO1A 3ZVRA 3TCAA 2QKLA 3WYFB 4K81A 2UZSA 4GZUA 1AQCA 1DDWA 4CSQA 2D2QA 2YS1A 2KUPA 2D10A 5CLLB 4DIXA 5C5BA 4GXBA 1WJMA 4F7UP 3HW2B 1XX0A 3BJIA 1LW3A 2KCJA 4Z2MB 4YONA 3AU5A 2P0DA 3UZTA 1ZM0A 1V5UA 4ZRKA 1TJ6A 2D9VA 1V5PA 4EJNA 2IYBA 1DYNA 2J0MA 1FHWA 3ODWA 2VRWB 3FEHA 4GPTB 3QWMA 2Z0QA 1AWEA 1WVHA 1UNPA 2DYNA 4D6WA 5C16A 1N3HA 3HIEA 2Z0OA 2E2XA 4Z2NA 1QC6A 4A6HA 2DKPA 4Y94A 3V5WA 2IFSA 2DFKA 1WG7A 1I7AA 5D3WA 4A6KA 3F5RA 1FHXA 2PZ1A 1WGQA 5DHFB 4PNKA 3MPXA 3WA0A 4DX90 5KQ1A 2K49A 2YS5A 2KIEA 4ZRJA 1BWNA 1Y19B 2RLOA 4HAUB 3AJ4A 5LOPB 1M7RA 1X11A 2ELBA 4HB3B 3M1IB 4C0AA 4YL8A 2ZPYA 2I1JA 1NU2A 3DXCA 2EJ8A 4GMVA 2D11A 2ROZB 3U12A 2NZ8B 1PMSA 4L1RA 1QQGA 1XKEA 2JP2A 3ZDTA 3A8QA 2CRFA 1TQZA 2L2IA 5C6RA 1ZSQA 2ROVA 4D0NB 4GN1A 3B77A 2GCJA 1GC6A 1U5DA 5J3YA 2DN6A 2I5FA 2W2XC 5FI1A 1Q67A 2RSGA 2VSZA 3P6AA 3GYOA 4DBBA 1DDMA 4KHBA 5JHGA 2I5CA 2X18A 2AL6A 2DX5A 1FAOA 3PVUA 3SNHA 1V61A 3F0WA 2OQBA 1J19A 4B6HA 2I1KA 3PP2A 5HE3A 4DX8A 4GNKB 5D3XA 2DLWA 2RVBB 1OMWA 3KZ1A 1V89A 3TFMA 3PSCA 1X1GA 4XWXA 1EAZA 3KRXA 3ULBA 3LJUX 4HHVA 5L81A 1GC7A 2H7EA 2LKOA 1H10A 4HAXB 1I2HA 4TKNA 3U7DA 5HE2A 1EF1A 1OY2A 1PLSA 3DXDA 1ISNA 2YSZA 3PZDA 4QJ5B
chains in the Genus database with same CATH topology
1UNQA 5DIFB 1UEFA 4MY6A 3X23A 1OQNA 1SHCA 4K17A 3GYPA 4HB0B 2COFA 2D4QA 1EVHA 4F7HA 4CHJA 2ELAA 1V88A 3PVWA 3CIKA 3P7ZA 2DKQA 2CY4A 1U5EA 1NI2A 1RRPB 3KRWA 4HDQA 1NTYA 4HAVB 1MK9B 4A5KA 1XR0B 5D27A 1M7EA 3U8ZA 2Q13A 1ZC3B 3A98B 2AEHA 2UZRA 3VIAA 2Z0PA 1UNRA 1FGZA 4KVGB 5DHAB 1P5TA 2RNRB 4KHAA 4HAWB 1MKEA 1DROA 1RJ2A 1NTVA 5DI9B 1Y5OA 3QBVB 2N23A 2J0JA 2XQNM 2MDXA 2YF0A 2R09A 1MK7B 3QIJA 4K2OA 5D3YA 2UVMA 4NSWA 4HB2B 1ZVRA 2G35A 1UPQA 2LYDA 5KQ4A 1U5GA 4WVFB 2EMTA 1FB8A 3KY9A 1KZGA 3KSYA 2W2XD 1X05A 2COCA 2DX1A 2OTXA 2HTHB 3BINA 1DBHA 4HB4B 3CXBB 3PVLA 3O96A 1GG3A 1W1HA 1TXDA 2W2WA 1MAIA 2DHJA 2D9XA 3TW1A 1XD4A 1P6SA 2HE7A 2YRYA 5C79A 1U5FA 2DHKA 1Z87A 2MKRA 2QKMA 2M14A 2Y8GA 1K5DB 2EC1A 3D8FA 3SYXA 1U2BA 5EFXA 3ULCA 3DXEA 2KGXB 2K2JA 3AU4A 2M38A 2BCJA 3G9WA 2J59M 5J3QA 3HQCA 2DTCA 4ZRIA 2R0DA 1MIXA 3SO6A 4EKUA 4P7IA 2MWNB 2DA0A 2GCLA 5JP4A 2EMSA 1MIZB 2LOZA 4MT7A 4HAZB 2LOXA 1IRSA 1UPRA 2L1CA 2YVCA 4F7GA 1B55A 2FJLA 2COAA 2V76A 1BTNA 5LONB 4KHBB 2N0YA 5KCVA 4KHOA 1WI1A 3PEGA 3FM8C 2YT0A 1XODA 2H7DA 1EGXA 4A6FB 4IFSA 2GJYA 2YT1A 4K2PA 2Y7BA 2YS3A 2CAYA 1WJ1A 4IAPA 4EMOA 4HDOA 1XCGA 1SGHA 5CLQB 3SUZA 1WGUA 5HE1A 3IVFA 2K2UA 5C5BB 2MFQA 4MK0A 3TVVA 2J0KA 1V5MA 1KI1B 4GMXB 2CY5A 3SV1A 2CODA 3RCPA 3A8PA 1BTKA 1DDVA 2LULA 2VKIA 4WJ7A 5JLJB 1MPHA 1J0WA 4H8SA 1X1FA 5JHHA 2D9ZA 2D9YA 2DYQA 3PG7A 4HAYB 4TYZA 5GOWB 3D8EA 1PFJA 2RUKB 5DH9B 1BAKA 2P0HA 3VOQA 3MDBC 1U27A 1E5WA 4NY0A 5FI0A 4IOYX 2RGNB 1X86A 3N7CA 1ZC4B 4CYEA 4WSFA 2NMBA 5HE0A 3OANA 1W1DA 4HATB 3NSUA 4L6EA 3ODOA 1P3RA 3D8DA 1K5GB 1FHOA 4CHMA 1W1GA 1LB1A 4PQ0A 3HK0A 2P8VA 3ML4A 4KAXB 5D3VA 2GS0A 1KZ7A 2D9WA 1FGYA 1H4RA 2Y8FA 4DXAB 4BBKA 4A6FA 2LG1A 2K00A 2ADZA 5J3TA 3T06A 1U29A 2P0FA 1FOEA 3FSSA 3ODXA 2DHIA 3TO1A 3ZVRA 3TCAA 2QKLA 3WYFB 4K81A 2UZSA 4GZUA 1AQCA 1DDWA 2D2QA 2YS1A 2KUPA 2D10A 5CLLB 5C5BA 4GXBA 1WJMA 4F7UP 3HW2B 1XX0A 3BJIA 1LW3A 2KCJA 4Z2MB 4YONA 3AU5A 2P0DA 3UZTA 1ZM0A 1V5UA 4ZRKA 1TJ6A 2D9VA 1V5PA 4EJNA 2IYBA 1DYNA 2J0MA 1FHWA 3ODWA 2VRWB 3FEHA 4GPTB 3QWMA 2Z0QA 1AWEA 1WVHA 1UNPA 2DYNA 5C16A 1N3HA 2Z0OA 2E2XA 4Z2NA 1QC6A 4A6HA 2DKPA 4Y94A 3V5WA 2IFSA 2DFKA 1WG7A 1I7AA 5D3WA 4A6KA 3F5RA 1FHXA 2PZ1A 1WGQA 5DHFB 4PNKA 3MPXA 3WA0A 4DX90 5KQ1A 2YS5A 4ZRJA 1BWNA 1Y19B 2RLOA 4HAUB 3AJ4A 5LOPB 1M7RA 1X11A 2ELBA 4HB3B 3M1IB 4C0AA 4YL8A 2ZPYA 2I1JA 1NU2A 3DXCA 2EJ8A 4GMVA 2D11A 2ROZB 2NZ8B 1PMSA 1QQGA 1XKEA 2JP2A 3ZDTA 3A8QA 2CRFA 1TQZA 2L2IA 5C6RA 1ZSQA 2ROVA 4D0NB 4GN1A 2GCJA 1GC6A 1U5DA 5J3YA 2DN6A 2I5FA 2W2XC 5FI1A 1Q67A 2RSGA 2VSZA 3P6AA 3GYOA 4DBBA 1DDMA 5JHGA 2I5CA 2X18A 2AL6A 2DX5A 1FAOA 3PVUA 3SNHA 1V61A 3F0WA 2OQBA 1J19A 4B6HA 2I1KA 3PP2A 5HE3A 4DX8A 5D3XA 2DLWA 2RVBB 1OMWA 3KZ1A 1V89A 3TFMA 3PSCA 1X1GA 4XWXA 1EAZA 3KRXA 3ULBA 3LJUX 4HHVA 5L81A 1GC7A 2H7EA 2LKOA 1H10A 4HAXB 1I2HA 4TKNA 3U7DA 5HE2A 1EF1A 1OY2A 1PLSA 3DXDA 1ISNA 2YSZA 3PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNQ A;  5DIF B;  1UEF A;  4MY6 A;  3X23 A;  1OQN A;  1SHC A;  4K17 A;  3GYP A;  4HB0 B;  2COF A;  2D4Q A;  1EVH A;  4F7H A;  4CHJ A;  2ELA A;  1V88 A;  3PVW A;  3CIK A;  3P7Z A;  2DKQ A;  2CY4 A;  1U5E A;  1NI2 A;  1RRP B;  3KRW A;  4HDQ A;  1NTY A;  4HAV B;  1MK9 B;  4A5K A;  1XR0 B;  5D27 A;  1M7E A;  3U8Z A;  2Q13 A;  1ZC3 B;  3A98 B;  2AEH A;  2UZR A;  3VIA A;  2Z0P A;  1UNR A;  1FGZ A;  4KVG B;  5DHA B;  1P5T A;  2RNR B;  4KHA A;  4HAW B;  1MKE A;  1DRO A;  1RJ2 A;  1NTV A;  5DI9 B;  1Y5O A;  3QBV B;  2N23 A;  2J0J A;  2XQN M;  2MDX A;  2YF0 A;  2R09 A;  1MK7 B;  3QIJ A;  4K2O A;  5D3Y A;  2UVM A;  4NSW A;  4HB2 B;  1ZVR A;  2G35 A;  1UPQ A;  2LYD A;  5KQ4 A;  1U5G A;  4WVF B;  2EMT A;  1FB8 A;  3KY9 A;  1KZG A;  3KSY A;  2W2X D;  1X05 A;  2COC A;  2DX1 A;  2OTX A;  2HTH B;  3BIN A;  1DBH A;  4HB4 B;  3CXB B;  3PVL A;  3O96 A;  1GG3 A;  1W1H A;  1TXD A;  2W2W A;  1MAI A;  2DHJ A;  2D9X A;  3TW1 A;  1XD4 A;  1P6S A;  2HE7 A;  2YRY A;  5C79 A;  1U5F A;  2DHK A;  1Z87 A;  2MKR A;  2QKM A;  2M14 A;  2Y8G A;  1K5D B;  2EC1 A;  3D8F A;  3SYX A;  1U2B A;  5EFX A;  3ULC A;  3DXE A;  2KGX B;  2K2J A;  3AU4 A;  2M38 A;  2BCJ A;  3G9W A;  2J59 M;  5J3Q A;  3HQC A;  2DTC A;  4ZRI A;  2R0D A;  1MIX A;  3SO6 A;  4EKU A;  4P7I A;  2MWN B;  2DA0 A;  2GCL A;  5JP4 A;  2EMS A;  1MIZ B;  2LOZ A;  4MT7 A;  4HAZ B;  2LOX A;  1IRS A;  1UPR A;  2L1C A;  2YVC A;  4F7G A;  1B55 A;  2FJL A;  2COA A;  2V76 A;  1BTN A;  5LON B;  4KHB B;  2N0Y A;  5KCV A;  4KHO A;  1WI1 A;  3PEG A;  3FM8 C;  2YT0 A;  1XOD A;  2H7D A;  1EGX A;  4A6F B;  4IFS A;  2GJY A;  2YT1 A;  4K2P A;  2Y7B A;  2YS3 A;  2CAY A;  1WJ1 A;  4IAP A;  4EMO A;  4HDO A;  1XCG A;  1SGH A;  5CLQ B;  3SUZ A;  1WGU A;  5HE1 A;  3IVF A;  2K2U A;  5C5B B;  2MFQ A;  4MK0 A;  3TVV A;  2J0K A;  1V5M A;  1KI1 B;  4GMX B;  2CY5 A;  3SV1 A;  2COD A;  3RCP A;  3A8P A;  1BTK A;  1DDV A;  2LUL A;  2VKI A;  4WJ7 A;  5JLJ B;  1MPH A;  1J0W A;  4H8S A;  1X1F A;  5JHH A;  2D9Z A;  2D9Y A;  2DYQ A;  3PG7 A;  4HAY B;  4TYZ A;  5GOW B;  3D8E A;  1PFJ A;  2RUK B;  5DH9 B;  1BAK A;  2P0H A;  3VOQ A;  3MDB C;  1U27 A;  1E5W A;  4NY0 A;  5FI0 A;  4IOY X;  2RGN B;  1X86 A;  3N7C A;  1ZC4 B;  4CYE A;  4WSF A;  2NMB A;  5HE0 A;  3OAN A;  1W1D A;  4HAT B;  3NSU A;  4L6E A;  3ODO A;  1P3R A;  3D8D A;  1K5G B;  1FHO A;  4CHM A;  1W1G A;  1LB1 A;  4PQ0 A;  3HK0 A;  2P8V A;  3ML4 A;  4KAX B;  5D3V A;  2GS0 A;  1KZ7 A;  2D9W A;  1FGY A;  1H4R A;  2Y8F A;  4DXA B;  4BBK A;  4A6F A;  2LG1 A;  2K00 A;  2ADZ A;  5J3T A;  3T06 A;  1U29 A;  2P0F A;  1FOE A;  3FSS A;  3ODX A;  2DHI A;  3TO1 A;  3ZVR A;  3TCA A;  2QKL A;  3WYF B;  4K81 A;  2UZS A;  4GZU A;  1AQC A;  1DDW A;  2D2Q A;  2YS1 A;  2KUP A;  2D10 A;  5CLL B;  5C5B A;  4GXB A;  1WJM A;  4F7U P;  3HW2 B;  1XX0 A;  3BJI A;  1LW3 A;  2KCJ A;  4Z2M B;  4YON A;  3AU5 A;  2P0D A;  3UZT A;  1ZM0 A;  1V5U A;  4ZRK A;  1TJ6 A;  2D9V A;  1V5P A;  4EJN A;  2IYB A;  1DYN A;  2J0M A;  1FHW A;  3ODW A;  2VRW B;  3FEH A;  4GPT B;  3QWM A;  2Z0Q A;  1AWE A;  1WVH A;  1UNP A;  2DYN A;  5C16 A;  1N3H A;  2Z0O A;  2E2X A;  4Z2N A;  1QC6 A;  4A6H A;  2DKP A;  4Y94 A;  3V5W A;  2IFS A;  2DFK A;  1WG7 A;  1I7A A;  5D3W A;  4A6K A;  3F5R A;  1FHX A;  2PZ1 A;  1WGQ A;  5DHF B;  4PNK A;  3MPX A;  3WA0 A;  4DX9 0;  5KQ1 A;  2YS5 A;  4ZRJ A;  1BWN A;  1Y19 B;  2RLO A;  4HAU B;  3AJ4 A;  5LOP B;  1M7R A;  1X11 A;  2ELB A;  4HB3 B;  3M1I B;  4C0A A;  4YL8 A;  2ZPY A;  2I1J A;  1NU2 A;  3DXC A;  2EJ8 A;  4GMV A;  2D11 A;  2ROZ B;  2NZ8 B;  1PMS A;  1QQG A;  1XKE A;  2JP2 A;  3ZDT A;  3A8Q A;  2CRF A;  1TQZ A;  2L2I A;  5C6R A;  1ZSQ A;  2ROV A;  4D0N B;  4GN1 A;  2GCJ A;  1GC6 A;  1U5D A;  5J3Y A;  2DN6 A;  2I5F A;  2W2X C;  5FI1 A;  1Q67 A;  2RSG A;  2VSZ A;  3P6A A;  3GYO A;  4DBB A;  1DDM A;  5JHG A;  2I5C A;  2X18 A;  2AL6 A;  2DX5 A;  1FAO A;  3PVU A;  3SNH A;  1V61 A;  3F0W A;  2OQB A;  1J19 A;  4B6H A;  2I1K A;  3PP2 A;  5HE3 A;  4DX8 A;  5D3X A;  2DLW A;  2RVB B;  1OMW A;  3KZ1 A;  1V89 A;  3TFM A;  3PSC A;  1X1G A;  4XWX A;  1EAZ A;  3KRX A;  3ULB A;  3LJU X;  4HHV A;  5L81 A;  1GC7 A;  2H7E A;  2LKO A;  1H10 A;  4HAX B;  1I2H A;  4TKN A;  3U7D A;  5HE2 A;  1EF1 A;  1OY2 A;  1PLS A;  3DXD A;  1ISN A;  2YSZ A;  3PZD A; 
#chains in the Genus database with same CATH topology
 1UNQ A;  5DIF B;  1UEF A;  4MY6 A;  3X23 A;  1OQN A;  1SHC A;  4K17 A;  3GYP A;  4HB0 B;  2COF A;  2Z4D A;  2K8E A;  2D4Q A;  1EVH A;  4F7H A;  4CHJ A;  2ELA A;  1V88 A;  4HSI A;  3PVW A;  3CIK A;  3P7Z A;  2DKQ A;  2CY4 A;  1U5E A;  1NI2 A;  1RRP B;  3KRW A;  4HDQ A;  1NTY A;  4HAV B;  1MK9 B;  4A5K A;  1XR0 B;  5D27 A;  1M7E A;  3U8Z A;  2Q13 A;  1ZC3 B;  3A98 B;  2AEH A;  2UZR A;  3VIA A;  2Z0P A;  1UNR A;  1FGZ A;  4KVG B;  5DHA B;  1P5T A;  2RNR B;  4KHA A;  4HAW B;  1MKE A;  1DRO A;  2KUQ A;  1RJ2 A;  1NTV A;  5DI9 B;  1Y5O A;  3QBV B;  3FVC A;  2N23 A;  2J0J A;  2MDX A;  2XQN M;  2YF0 A;  2R09 A;  1MK7 B;  3QIJ A;  4K2O A;  5D3Y A;  2UVM A;  4NSW A;  4HB2 B;  1ZVR A;  2G35 A;  1UPQ A;  4QXA B;  2LYD A;  5KQ4 A;  1U5G A;  4WVF B;  2EMT A;  1FB8 A;  3KY9 A;  1KZG A;  3KSY A;  2W2X D;  1X05 A;  2COC A;  2DX1 A;  2OTX A;  2HTH B;  3BIN A;  1DBH A;  4HB4 B;  3CXB B;  3PVL A;  3O96 A;  1GG3 A;  1W1H A;  1TXD A;  2W2W A;  1MAI A;  2DHJ A;  2Z13 A;  2D9X A;  3TW1 A;  1XD4 A;  1P6S A;  2HE7 A;  2YRY A;  5C79 A;  1U5F A;  2DHK A;  1Z87 A;  2MKR A;  2QKM A;  2M14 A;  2Y8G A;  1K5D B;  2EC1 A;  3D8F A;  3DCX A;  3SYX A;  1U2B A;  5EFX A;  4QJ3 B;  3ULC A;  3DXE A;  2GUM A;  2KGX B;  2K2J A;  3AU4 A;  2KR0 A;  2M38 A;  2BCJ A;  1MI1 A;  2J59 M;  3G9W A;  5J3Q A;  3HQC A;  2DTC A;  4ZRI A;  2R0D A;  1MIX A;  3SO6 A;  4EKU A;  4P7I A;  2MWN B;  2DA0 A;  2GCL A;  5JP4 A;  2EMS A;  1MIZ B;  2LOZ A;  2FJU B;  3OHM B;  4MT7 A;  4HAZ B;  2LOX A;  1IRS A;  1UPR A;  2L1C A;  2YVC A;  5I2M A;  4F7G A;  1B55 A;  3HSA A;  2FJL A;  5M4Y B;  2COA A;  2V76 A;  1ZYI A;  1BTN A;  5LON B;  4KHB B;  2N0Y A;  3NWA A;  5KCV A;  4KHO A;  1WI1 A;  3PEG A;  3FM8 C;  2YT0 A;  1XOD A;  2H7D A;  4OT1 A;  1EGX A;  4A6F B;  4IFS A;  2GJY A;  2ZKM X;  2YT1 A;  4K2P A;  3NWF A;  5I2S A;  2Y7B A;  2YS3 A;  2CAY A;  1WJ1 A;  4IAP A;  2KIG A;  4EMO A;  4HDO A;  1T77 A;  1SGH A;  1XCG A;  5CLQ B;  1WGU A;  3SUZ A;  5HE1 A;  3IVF A;  2K2U A;  5C5B B;  2MFQ A;  4MK0 A;  3TVV A;  2J0K A;  1V5M A;  1KI1 B;  4GMX B;  2CY5 A;  3SV1 A;  2COD A;  3RCP A;  3A8P A;  1BTK A;  1DDV A;  2LUL A;  2VKI A;  4WJ7 A;  2RRF A;  5JLJ B;  4GOU A;  1MPH A;  1J0W A;  4H8S A;  1X1F A;  5JHH A;  2D9Z A;  2D9Y A;  2DYQ A;  3PG7 A;  4HAY B;  4TYZ A;  5GOW B;  3D8E A;  1PFJ A;  2RUK B;  5DH9 B;  1BAK A;  2P0H A;  3VOQ A;  3MDB C;  1U27 A;  1E5W A;  4NY0 A;  5FI0 A;  4IOY X;  2RGN B;  1X86 A;  3N7C A;  1ZC4 B;  4CYE A;  5IRS A;  4WSF A;  5LG4 B;  2Z14 A;  2NMB A;  5HE0 A;  3OAN A;  1W1D A;  4HAT B;  3NSU A;  4L6E A;  3ODO A;  1P3R A;  3D8D A;  1K5G B;  3NWD A;  1FHO A;  4CHM A;  1W1G A;  2Z59 A;  1LB1 A;  4PQ0 A;  2YT2 A;  3A58 A;  3HK0 A;  2P8V A;  3ML4 A;  4OSN A;  4KAX B;  5D3V A;  2GS0 A;  1KZ7 A;  2D9W A;  1FGY A;  1H4R A;  2Y8F A;  4DXA B;  4QJ4 B;  4BBK A;  4A6F A;  2LG1 A;  2NBV A;  2K00 A;  2ADZ A;  5J3T A;  3T06 A;  1U29 A;  3NW8 A;  2R2Y A;  2P0F A;  1FOE A;  3FSS A;  3ODX A;  2DHI A;  3TO1 A;  3ZVR A;  3TCA A;  2QKL A;  3WYF B;  4K81 A;  2UZS A;  4GZU A;  1AQC A;  1DDW A;  4CSQ A;  2D2Q A;  2YS1 A;  2KUP A;  2D10 A;  5CLL B;  4DIX A;  5C5B A;  4GXB A;  1WJM A;  4F7U P;  3HW2 B;  1XX0 A;  3BJI A;  1LW3 A;  2KCJ A;  4Z2M B;  4YON A;  3AU5 A;  2P0D A;  3UZT A;  1ZM0 A;  1V5U A;  4ZRK A;  1TJ6 A;  2D9V A;  1V5P A;  4EJN A;  2IYB A;  1DYN A;  2J0M A;  1FHW A;  3ODW A;  2VRW B;  3FEH A;  4GPT B;  3QWM A;  2Z0Q A;  1AWE A;  1WVH A;  1UNP A;  2DYN A;  4D6W A;  5C16 A;  1N3H A;  3HIE A;  2Z0O A;  2E2X A;  4Z2N A;  1QC6 A;  4A6H A;  2DKP A;  4Y94 A;  3V5W A;  2IFS A;  2DFK A;  1WG7 A;  1I7A A;  5D3W A;  4A6K A;  3F5R A;  1FHX A;  2PZ1 A;  1WGQ A;  5DHF B;  4PNK A;  3MPX A;  3WA0 A;  4DX9 0;  5KQ1 A;  2K49 A;  2YS5 A;  2KIE A;  4ZRJ A;  1BWN A;  1Y19 B;  2RLO A;  4HAU B;  3AJ4 A;  5LOP B;  1M7R A;  1X11 A;  2ELB A;  4HB3 B;  3M1I B;  4C0A A;  4YL8 A;  2ZPY A;  2I1J A;  1NU2 A;  3DXC A;  2EJ8 A;  4GMV A;  2D11 A;  2ROZ B;  3U12 A;  2NZ8 B;  1PMS A;  4L1R A;  1QQG A;  1XKE A;  2JP2 A;  3ZDT A;  3A8Q A;  2CRF A;  1TQZ A;  2L2I A;  5C6R A;  1ZSQ A;  2ROV A;  4D0N B;  4GN1 A;  3B77 A;  2GCJ A;  1GC6 A;  1U5D A;  5J3Y A;  2DN6 A;  2I5F A;  2W2X C;  5FI1 A;  1Q67 A;  2RSG A;  2VSZ A;  3P6A A;  3GYO A;  4DBB A;  1DDM A;  4KHB A;  5JHG A;  2I5C A;  2X18 A;  2AL6 A;  2DX5 A;  1FAO A;  3PVU A;  3SNH A;  1V61 A;  3F0W A;  2OQB A;  1J19 A;  4B6H A;  2I1K A;  3PP2 A;  5HE3 A;  4DX8 A;  4GNK B;  5D3X A;  2DLW A;  2RVB B;  1OMW A;  3KZ1 A;  1V89 A;  3TFM A;  3PSC A;  1X1G A;  4XWX A;  1EAZ A;  3KRX A;  3ULB A;  3LJU X;  4HHV A;  5L81 A;  1GC7 A;  2H7E A;  2LKO A;  1H10 A;  4HAX B;  1I2H A;  4TKN A;  3U7D A;  5HE2 A;  1EF1 A;  1OY2 A;  1PLS A;  3DXD A;  1ISN A;  2YSZ A;  3PZD A;  4QJ5 B; 
#chains in the Genus database with same CATH homology
 1UNQ A;  5DIF B;  1UEF A;  4MY6 A;  3X23 A;  1OQN A;  1SHC A;  4K17 A;  3GYP A;  4HB0 B;  2COF A;  2D4Q A;  1EVH A;  4F7H A;  4CHJ A;  2ELA A;  1V88 A;  3PVW A;  3CIK A;  3P7Z A;  2DKQ A;  2CY4 A;  1U5E A;  1NI2 A;  1RRP B;  3KRW A;  4HDQ A;  1NTY A;  4HAV B;  1MK9 B;  4A5K A;  1XR0 B;  5D27 A;  1M7E A;  3U8Z A;  2Q13 A;  1ZC3 B;  3A98 B;  2AEH A;  2UZR A;  3VIA A;  2Z0P A;  1UNR A;  1FGZ A;  4KVG B;  5DHA B;  1P5T A;  2RNR B;  4KHA A;  4HAW B;  1MKE A;  1DRO A;  1RJ2 A;  1NTV A;  5DI9 B;  1Y5O A;  3QBV B;  2N23 A;  2J0J A;  2XQN M;  2MDX A;  2YF0 A;  2R09 A;  1MK7 B;  3QIJ A;  4K2O A;  5D3Y A;  2UVM A;  4NSW A;  4HB2 B;  1ZVR A;  2G35 A;  1UPQ A;  2LYD A;  5KQ4 A;  1U5G A;  4WVF B;  2EMT A;  1FB8 A;  3KY9 A;  1KZG A;  3KSY A;  2W2X D;  1X05 A;  2COC A;  2DX1 A;  2OTX A;  2HTH B;  3BIN A;  1DBH A;  4HB4 B;  3CXB B;  3PVL A;  3O96 A;  1GG3 A;  1W1H A;  1TXD A;  2W2W A;  1MAI A;  2DHJ A;  2D9X A;  3TW1 A;  1XD4 A;  1P6S A;  2HE7 A;  2YRY A;  5C79 A;  1U5F A;  2DHK A;  1Z87 A;  2MKR A;  2QKM A;  2M14 A;  2Y8G A;  1K5D B;  2EC1 A;  3D8F A;  3SYX A;  1U2B A;  5EFX A;  3ULC A;  3DXE A;  2KGX B;  2K2J A;  3AU4 A;  2M38 A;  2BCJ A;  3G9W A;  2J59 M;  5J3Q A;  3HQC A;  2DTC A;  4ZRI A;  2R0D A;  1MIX A;  3SO6 A;  4EKU A;  4P7I A;  2MWN B;  2DA0 A;  2GCL A;  5JP4 A;  2EMS A;  1MIZ B;  2LOZ A;  4MT7 A;  4HAZ B;  2LOX A;  1IRS A;  1UPR A;  2L1C A;  2YVC A;  4F7G A;  1B55 A;  2FJL A;  2COA A;  2V76 A;  1BTN A;  5LON B;  4KHB B;  2N0Y A;  5KCV A;  4KHO A;  1WI1 A;  3PEG A;  3FM8 C;  2YT0 A;  1XOD A;  2H7D A;  1EGX A;  4A6F B;  4IFS A;  2GJY A;  2YT1 A;  4K2P A;  2Y7B A;  2YS3 A;  2CAY A;  1WJ1 A;  4IAP A;  4EMO A;  4HDO A;  1XCG A;  1SGH A;  5CLQ B;  3SUZ A;  1WGU A;  5HE1 A;  3IVF A;  2K2U A;  5C5B B;  2MFQ A;  4MK0 A;  3TVV A;  2J0K A;  1V5M A;  1KI1 B;  4GMX B;  2CY5 A;  3SV1 A;  2COD A;  3RCP A;  3A8P A;  1BTK A;  1DDV A;  2LUL A;  2VKI A;  4WJ7 A;  5JLJ B;  1MPH A;  1J0W A;  4H8S A;  1X1F A;  5JHH A;  2D9Z A;  2D9Y A;  2DYQ A;  3PG7 A;  4HAY B;  4TYZ A;  5GOW B;  3D8E A;  1PFJ A;  2RUK B;  5DH9 B;  1BAK A;  2P0H A;  3VOQ A;  3MDB C;  1U27 A;  1E5W A;  4NY0 A;  5FI0 A;  4IOY X;  2RGN B;  1X86 A;  3N7C A;  1ZC4 B;  4CYE A;  4WSF A;  2NMB A;  5HE0 A;  3OAN A;  1W1D A;  4HAT B;  3NSU A;  4L6E A;  3ODO A;  1P3R A;  3D8D A;  1K5G B;  1FHO A;  4CHM A;  1W1G A;  1LB1 A;  4PQ0 A;  3HK0 A;  2P8V A;  3ML4 A;  4KAX B;  5D3V A;  2GS0 A;  1KZ7 A;  2D9W A;  1FGY A;  1H4R A;  2Y8F A;  4DXA B;  4BBK A;  4A6F A;  2LG1 A;  2K00 A;  2ADZ A;  5J3T A;  3T06 A;  1U29 A;  2P0F A;  1FOE A;  3FSS A;  3ODX A;  2DHI A;  3TO1 A;  3ZVR A;  3TCA A;  2QKL A;  3WYF B;  4K81 A;  2UZS A;  4GZU A;  1AQC A;  1DDW A;  2D2Q A;  2YS1 A;  2KUP A;  2D10 A;  5CLL B;  5C5B A;  4GXB A;  1WJM A;  4F7U P;  3HW2 B;  1XX0 A;  3BJI A;  1LW3 A;  2KCJ A;  4Z2M B;  4YON A;  3AU5 A;  2P0D A;  3UZT A;  1ZM0 A;  1V5U A;  4ZRK A;  1TJ6 A;  2D9V A;  1V5P A;  4EJN A;  2IYB A;  1DYN A;  2J0M A;  1FHW A;  3ODW A;  2VRW B;  3FEH A;  4GPT B;  3QWM A;  2Z0Q A;  1AWE A;  1WVH A;  1UNP A;  2DYN A;  5C16 A;  1N3H A;  2Z0O A;  2E2X A;  4Z2N A;  1QC6 A;  4A6H A;  2DKP A;  4Y94 A;  3V5W A;  2IFS A;  2DFK A;  1WG7 A;  1I7A A;  5D3W A;  4A6K A;  3F5R A;  1FHX A;  2PZ1 A;  1WGQ A;  5DHF B;  4PNK A;  3MPX A;  3WA0 A;  4DX9 0;  5KQ1 A;  2YS5 A;  4ZRJ A;  1BWN A;  1Y19 B;  2RLO A;  4HAU B;  3AJ4 A;  5LOP B;  1M7R A;  1X11 A;  2ELB A;  4HB3 B;  3M1I B;  4C0A A;  4YL8 A;  2ZPY A;  2I1J A;  1NU2 A;  3DXC A;  2EJ8 A;  4GMV A;  2D11 A;  2ROZ B;  2NZ8 B;  1PMS A;  1QQG A;  1XKE A;  2JP2 A;  3ZDT A;  3A8Q A;  2CRF A;  1TQZ A;  2L2I A;  5C6R A;  1ZSQ A;  2ROV A;  4D0N B;  4GN1 A;  2GCJ A;  1GC6 A;  1U5D A;  5J3Y A;  2DN6 A;  2I5F A;  2W2X C;  5FI1 A;  1Q67 A;  2RSG A;  2VSZ A;  3P6A A;  3GYO A;  4DBB A;  1DDM A;  5JHG A;  2I5C A;  2X18 A;  2AL6 A;  2DX5 A;  1FAO A;  3PVU A;  3SNH A;  1V61 A;  3F0W A;  2OQB A;  1J19 A;  4B6H A;  2I1K A;  3PP2 A;  5HE3 A;  4DX8 A;  5D3X A;  2DLW A;  2RVB B;  1OMW A;  3KZ1 A;  1V89 A;  3TFM A;  3PSC A;  1X1G A;  4XWX A;  1EAZ A;  3KRX A;  3ULB A;  3LJU X;  4HHV A;  5L81 A;  1GC7 A;  2H7E A;  2LKO A;  1H10 A;  4HAX B;  1I2H A;  4TKN A;  3U7D A;  5HE2 A;  1EF1 A;  1OY2 A;  1PLS A;  3DXD A;  1ISN A;  2YSZ A;  3PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...