1AXJA

Fmn-binding protein from desulfovibrio vulgaris (miyazaki f), nmr, 20 structures
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
122
Chain Sequence
b'MLPGTFFEVLKNEGVVAIATQGEDGPHLVNTWNSYLKVLDGNRIVVPVGGMHKTEANVARDERVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGPEFEAIARFKWARAALVITVVSAEQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-BINDING PROTEIN
publication title Pathway of chymotrypsin evolution suggested by the structure of the FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)
pubmed doi rcsb
source organism Desulfovibrio vulgaris str. 'miyazaki f'
molecule tags Binding protein
total genus 32
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 1axjA00
3VY5A 3R5PA 4Y9IA 5CHEC 3R5YA 3E4VA 3FGEA 1WLIA 4YBNA 3IN6A 4N7RC 2QCKA 1CI0A 1USFA 4ZKYA 2PTFA 1JNWA 2ASFA 3CP3A 1TY9A 1WLKA 5ESCA 1Y30A 1W3OA 4IRAA 3PFTA 2X1JA 3NFWA 3RH7A 4XHYA 1RZ1A 3SWJA 4HMVA 5CHOA 1EJEA 1VL7A 2IABA 1G76A 1W3PA 2A2JA 2ARZA 2ECRA 2OL5A 2R6VA 3DB0A 2IMLA 3F7EA 3HMZA 4F07A 2HHZA 3BA3A 1W9AA 2E83A 1W3QA 3U35A 1T9MA 3AWHA 3ZOFA 4QVBA 3R5LA 3A20A 3EC6A 2NR4A 3H96A 2Q9KA 3R5WA 1G79A 4Z85A 2D5MA 4HMWA 1WV4A 3K87A 3ZODA 2D38A 2RE7A 1FLMA 3AMFA 5BNCA 1AXJA 1I0SA 3HY8A 1YOAA 2X1KA 1I0RA 2HTIA 3U5WA 2OU5A 4HMSA 1RFEA 3U0IA 3K86A 3K88A 3KYGA 2IG6A 3DMBA 3ZOCA 2QEAA 4HMXA 3A6RA 2I51A 3VY2A 1WGBA 2I02A 2FHQA 2AQ6A 3BPKA 1USCA 3FKHA 1NRGA 2GJGA 4HMUA 2D37A 3DNHA 3GASA 3ZOHA 3ZOEA 1G78A 3KYFA 3BNKA 1YLNA 3VYAA 2HQ9A 2D36A 3A6QA 3U34A 4HMTA 2HQ7A 2HTDA 1RZ0A 2FG9A 1XHNA 2VPAA 4HX6A 2FURA 1XXOA 4XJ2A 1DNLA 4R82A 5JABA 2RDEA 2ECUA 3CB0A 1W3RA 3R5ZA 3B5MA 2R0XA 2ED4A 3R5RA 4YWNA 1G77A 4L82A 3ZOGA 3TGVA
chains in the Genus database with same CATH superfamily
3VY5A 3R5PA 4Y9IA 5CHEC 3R5YA 3E4VA 3FGEA 1WLIA 4YBNA 3IN6A 4N7RC 2QCKA 1CI0A 1USFA 1Y12A 4ZKYA 2PTFA 1JNWA 2ASFA 3CP3A 1TY9A 1WLKA 5ESCA 4UHVA 1Y30A 1W3OA 4IRAA 3PFTA 2X1JA 3NFWA 3RH7A 4XHYA 1RZ1A 3SWJA 4HMVA 5CHOA 1EJEA 1VL7A 2IABA 1G76A 1W3PA 2A2JA 2ARZA 2ECRA 2OL5A 2R6VA 3DB0A 2IMLA 3F7EA 3HMZA 4TV4A 4F07A 2HHZA 3BA3A 1W9AA 2E83A 1W3QA 3U35A 1T9MA 3AWHA 3ZOFA 4HKHA 4QVBA 3R5LA 3A20A 3EC6A 2NR4A 3H96A 3EAAA 2Q9KA 4W64A 3R5WA 1G79A 4Z85A 2D5MA 4HMWA 1WV4A 3K87A 3ZODA 2D38A 2RE7A 1FLMA 3AMFA 5BNCA 1AXJA 1I0SA 3HY8A 1YOAA 2X1KA 1I0RA 2HTIA 2K4QA 3U5WA 2GUJA 2OU5A 4HMSA 1RFEA 3U0IA 3K86A 3K88A 3KYGA 2IG6A 3DMBA 3ZOCA 2QEAA 4HMXA 3A6RA 2I51A 3VY2A 1WGBA 2I02A 2FHQA 2AQ6A 3BPKA 1USCA 3FKHA 1NRGA 2GJGA 4HMUA 2D37A 3DNHA 3GASA 3ZOHA 3ZOEA 1G78A 3KYFA 3BNKA 1YLNA 3VYAA 2HQ9A 4MTKA 3V4HA 2D36A 3A6QA 3U34A 4HMTA 2HQ7A 2L1TA 2HTDA 1RZ0A 2FG9A 1XHNA 2VPAA 3HE1A 4HX6A 2FURA 1XXOA 4XJ2A 1DNLA 4R82A 5JABA 2P5ZX 2RDEA 2ECUA 3CB0A 1W3RA 3R5ZA 3B5MA 2R0XA 2ED4A 3R5RA 4YWNA 1G77A 4L82A 3ZOGA 3TGVA
chains in the Genus database with same CATH topology
3VY5A 3R5PA 4Y9IA 5CHEC 3R5YA 3E4VA 3FGEA 1WLIA 4YBNA 3IN6A 4N7RC 2QCKA 1CI0A 1USFA 4ZKYA 2PTFA 1JNWA 2ASFA 3CP3A 1TY9A 1WLKA 5ESCA 1Y30A 1W3OA 4IRAA 3PFTA 2X1JA 3NFWA 3RH7A 4XHYA 1RZ1A 3SWJA 4HMVA 5CHOA 1EJEA 1VL7A 2IABA 1G76A 1W3PA 2A2JA 2ARZA 2ECRA 2OL5A 2R6VA 3DB0A 2IMLA 3F7EA 3HMZA 4F07A 2HHZA 3BA3A 1W9AA 2E83A 1W3QA 3U35A 1T9MA 3AWHA 3ZOFA 4QVBA 3R5LA 3A20A 3EC6A 2NR4A 3H96A 2Q9KA 3R5WA 1G79A 4Z85A 2D5MA 4HMWA 1WV4A 3K87A 3ZODA 2D38A 2RE7A 1FLMA 3AMFA 5BNCA 1AXJA 1I0SA 3HY8A 1YOAA 2X1KA 1I0RA 2HTIA 3U5WA 2OU5A 4HMSA 1RFEA 3U0IA 3K86A 3K88A 3KYGA 2IG6A 3DMBA 3ZOCA 2QEAA 4HMXA 3A6RA 2I51A 3VY2A 1WGBA 2I02A 2FHQA 2AQ6A 3BPKA 1USCA 3FKHA 1NRGA 2GJGA 4HMUA 2D37A 3DNHA 3GASA 3ZOHA 3ZOEA 1G78A 3KYFA 3BNKA 1YLNA 3VYAA 2HQ9A 2D36A 3A6QA 3U34A 4HMTA 2HQ7A 2HTDA 1RZ0A 2FG9A 1XHNA 2VPAA 4HX6A 2FURA 1XXOA 4XJ2A 1DNLA 4R82A 5JABA 2RDEA 2ECUA 3CB0A 1W3RA 3R5ZA 3B5MA 2R0XA 2ED4A 3R5RA 4YWNA 1G77A 4L82A 3ZOGA 3TGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VY5 A;  3R5P A;  4Y9I A;  5CHE C;  3R5Y A;  3E4V A;  3FGE A;  1WLI A;  4YBN A;  3IN6 A;  4N7R C;  2QCK A;  1CI0 A;  1USF A;  4ZKY A;  2PTF A;  1JNW A;  2ASF A;  3CP3 A;  1TY9 A;  1WLK A;  5ESC A;  1Y30 A;  1W3O A;  4IRA A;  3PFT A;  2X1J A;  3NFW A;  3RH7 A;  4XHY A;  1RZ1 A;  3SWJ A;  4HMV A;  5CHO A;  1EJE A;  1VL7 A;  2IAB A;  1G76 A;  1W3P A;  2A2J A;  2ARZ A;  2ECR A;  2OL5 A;  2R6V A;  3DB0 A;  2IML A;  3F7E A;  3HMZ A;  4F07 A;  2HHZ A;  3BA3 A;  1W9A A;  2E83 A;  1W3Q A;  3U35 A;  1T9M A;  3AWH A;  3ZOF A;  4QVB A;  3R5L A;  3A20 A;  3EC6 A;  2NR4 A;  3H96 A;  2Q9K A;  3R5W A;  1G79 A;  4Z85 A;  2D5M A;  4HMW A;  1WV4 A;  3K87 A;  3ZOD A;  2D38 A;  2RE7 A;  1FLM A;  3AMF A;  5BNC A;  1AXJ A;  1I0S A;  3HY8 A;  1YOA A;  2X1K A;  1I0R A;  2HTI A;  3U5W A;  2OU5 A;  4HMS A;  1RFE A;  3U0I A;  3K86 A;  3K88 A;  3KYG A;  2IG6 A;  3DMB A;  3ZOC A;  2QEA A;  4HMX A;  3A6R A;  2I51 A;  3VY2 A;  1WGB A;  2I02 A;  2FHQ A;  2AQ6 A;  3BPK A;  1USC A;  3FKH A;  1NRG A;  2GJG A;  4HMU A;  2D37 A;  3DNH A;  3GAS A;  3ZOH A;  3ZOE A;  1G78 A;  3KYF A;  3BNK A;  1YLN A;  3VYA A;  2HQ9 A;  2D36 A;  3A6Q A;  3U34 A;  4HMT A;  2HQ7 A;  2HTD A;  1RZ0 A;  2FG9 A;  1XHN A;  2VPA A;  4HX6 A;  2FUR A;  1XXO A;  4XJ2 A;  1DNL A;  4R82 A;  5JAB A;  2RDE A;  2ECU A;  3CB0 A;  1W3R A;  3R5Z A;  3B5M A;  2R0X A;  2ED4 A;  3R5R A;  4YWN A;  1G77 A;  4L82 A;  3ZOG A;  3TGV A; 
#chains in the Genus database with same CATH topology
 3VY5 A;  3R5P A;  4Y9I A;  5CHE C;  3R5Y A;  3E4V A;  3FGE A;  1WLI A;  4YBN A;  3IN6 A;  4N7R C;  2QCK A;  1CI0 A;  1USF A;  1Y12 A;  4ZKY A;  2PTF A;  1JNW A;  2ASF A;  3CP3 A;  1TY9 A;  1WLK A;  5ESC A;  4UHV A;  1Y30 A;  1W3O A;  4IRA A;  3PFT A;  2X1J A;  3NFW A;  3RH7 A;  4XHY A;  1RZ1 A;  3SWJ A;  4HMV A;  5CHO A;  1EJE A;  1VL7 A;  2IAB A;  1G76 A;  1W3P A;  2A2J A;  2ARZ A;  2ECR A;  2OL5 A;  2R6V A;  3DB0 A;  2IML A;  3F7E A;  3HMZ A;  4TV4 A;  4F07 A;  2HHZ A;  3BA3 A;  1W9A A;  2E83 A;  1W3Q A;  3U35 A;  1T9M A;  3AWH A;  3ZOF A;  4HKH A;  4QVB A;  3R5L A;  3A20 A;  3EC6 A;  2NR4 A;  3H96 A;  3EAA A;  2Q9K A;  4W64 A;  3R5W A;  1G79 A;  4Z85 A;  2D5M A;  4HMW A;  1WV4 A;  3K87 A;  3ZOD A;  2D38 A;  2RE7 A;  1FLM A;  3AMF A;  5BNC A;  1AXJ A;  1I0S A;  3HY8 A;  1YOA A;  2X1K A;  1I0R A;  2HTI A;  2K4Q A;  3U5W A;  2GUJ A;  2OU5 A;  4HMS A;  1RFE A;  3U0I A;  3K86 A;  3K88 A;  3KYG A;  2IG6 A;  3DMB A;  3ZOC A;  2QEA A;  4HMX A;  3A6R A;  2I51 A;  3VY2 A;  1WGB A;  2I02 A;  2FHQ A;  2AQ6 A;  3BPK A;  1USC A;  3FKH A;  1NRG A;  2GJG A;  4HMU A;  2D37 A;  3DNH A;  3GAS A;  3ZOH A;  3ZOE A;  1G78 A;  3KYF A;  3BNK A;  1YLN A;  3VYA A;  2HQ9 A;  4MTK A;  3V4H A;  2D36 A;  3A6Q A;  3U34 A;  4HMT A;  2HQ7 A;  2L1T A;  2HTD A;  1RZ0 A;  2FG9 A;  1XHN A;  2VPA A;  3HE1 A;  4HX6 A;  2FUR A;  1XXO A;  4XJ2 A;  1DNL A;  4R82 A;  5JAB A;  2P5Z X;  2RDE A;  2ECU A;  3CB0 A;  1W3R A;  3R5Z A;  3B5M A;  2R0X A;  2ED4 A;  3R5R A;  4YWN A;  1G77 A;  4L82 A;  3ZOG A;  3TGV A; 
#chains in the Genus database with same CATH homology
 3VY5 A;  3R5P A;  4Y9I A;  5CHE C;  3R5Y A;  3E4V A;  3FGE A;  1WLI A;  4YBN A;  3IN6 A;  4N7R C;  2QCK A;  1CI0 A;  1USF A;  4ZKY A;  2PTF A;  1JNW A;  2ASF A;  3CP3 A;  1TY9 A;  1WLK A;  5ESC A;  1Y30 A;  1W3O A;  4IRA A;  3PFT A;  2X1J A;  3NFW A;  3RH7 A;  4XHY A;  1RZ1 A;  3SWJ A;  4HMV A;  5CHO A;  1EJE A;  1VL7 A;  2IAB A;  1G76 A;  1W3P A;  2A2J A;  2ARZ A;  2ECR A;  2OL5 A;  2R6V A;  3DB0 A;  2IML A;  3F7E A;  3HMZ A;  4F07 A;  2HHZ A;  3BA3 A;  1W9A A;  2E83 A;  1W3Q A;  3U35 A;  1T9M A;  3AWH A;  3ZOF A;  4QVB A;  3R5L A;  3A20 A;  3EC6 A;  2NR4 A;  3H96 A;  2Q9K A;  3R5W A;  1G79 A;  4Z85 A;  2D5M A;  4HMW A;  1WV4 A;  3K87 A;  3ZOD A;  2D38 A;  2RE7 A;  1FLM A;  3AMF A;  5BNC A;  1AXJ A;  1I0S A;  3HY8 A;  1YOA A;  2X1K A;  1I0R A;  2HTI A;  3U5W A;  2OU5 A;  4HMS A;  1RFE A;  3U0I A;  3K86 A;  3K88 A;  3KYG A;  2IG6 A;  3DMB A;  3ZOC A;  2QEA A;  4HMX A;  3A6R A;  2I51 A;  3VY2 A;  1WGB A;  2I02 A;  2FHQ A;  2AQ6 A;  3BPK A;  1USC A;  3FKH A;  1NRG A;  2GJG A;  4HMU A;  2D37 A;  3DNH A;  3GAS A;  3ZOH A;  3ZOE A;  1G78 A;  3KYF A;  3BNK A;  1YLN A;  3VYA A;  2HQ9 A;  2D36 A;  3A6Q A;  3U34 A;  4HMT A;  2HQ7 A;  2HTD A;  1RZ0 A;  2FG9 A;  1XHN A;  2VPA A;  4HX6 A;  2FUR A;  1XXO A;  4XJ2 A;  1DNL A;  4R82 A;  5JAB A;  2RDE A;  2ECU A;  3CB0 A;  1W3R A;  3R5Z A;  3B5M A;  2R0X A;  2ED4 A;  3R5R A;  4YWN A;  1G77 A;  4L82 A;  3ZOG A;  3TGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...