1B2TA

Solution structure of the cx3c chemokine domain of fractalkine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
b'MQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FRACTALKINE)
publication title Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b2tA00
2RSOA 3IFDA 1DOKA 2KUMA 1WTPA 4IUTA 2L4NA 2K03A 2R3ZA 2NZ1D 1CM9A 3P7JA 3I91A 2B2UC 2JYOA 2NWGA 1EOTA 1F9SA 5E4WC 1B3AA 1ICWA 1U4PA 1HUMA 1PFMA 2B2WC 2K04A 1ZXTA 2HDMA 4DN4M 4ZK9B 2EOTA 1RTOA 1PFBA 2RA4A 4X3TA 1XX8A 1HA6A 1HUNA 2N88A 2X6LA 5AFWA 3H91A 1S4ZA 4CJ0B 5JJZA 1VMPA 2B2TC 3FPUB 2B2UA 1NR4A 1DOMA 1B4OA 1RHPA 4O42A 3G7LA 1PLFA 3UI2A 1BNZA 1MI2A 1MSHA 1QG7A 3DEPA 4OIJA 4IUVA 4U68A 2B2WA 4X3KA 5CBAE 1ILQA 2Q8RE 1AZPA 1NAPA 2SDFA 2B2VC 1X32A 5E4XA 5EPLA 1CA5A 4QUCA 2MJ8A 1RODA 1CA6A 1IKMA 1O7YA 1J8IA 5EPJA 3ONAB 4IUQA 5T1IA 4HAEA 1A15A 1B50A 4XT3B 2B2VA 1SDFA 2HDLA 5CORA 1JICA 2RVLA 3HP3A 1GUWA 1BO0A 2K01A 5CBEE 2HUGA 3GV6A 1HHVA 1J9OA 3SVMA 1U4MA 4X3SA 1NR2A 2JP1A 2MPMA 2N55A 5DNFA 1Q3LA 4ZKCB 5EPKA 2L11A 2CVRA 1AP0A 2D9UA 3IL8A 4QUFA 3DEOA 4IUPA 4HEDA 1PFNA 1X3QA 2M2LA 2KVMA 2H1EA 1G2SA 2KOLA 4NW2A 2B2TA 5COYA 4R8IA 2L9HA 2X6GA 3MTSA 3LWEA 4RA8A 3N52A 4ZKBB 1B53A 3Q6SA 1WTRA 1QNKA 4RWSC 4MN3A 1WTXA 2KEEA 2EPBA 3I90A 1F9RA 1F9QA 2K1BA 5EJWA 4CJ2C 1WTVA 1IL8A 2RSNA 3MWYW 1BF4A 2FHTA 4IURA 3I8ZA 2BDNA 1O80A 1F2LA 2DY7A 2K28A 3GV3A 1DZ1A 2EE1A 4ZLTF 3KBXA 4IUUA 5D14A 2B2YC 4XT1B 3TN2A 2HCCA 1U4RA 1RJTA 1X3PA 2FFKB 3TZDA 1MSGA 1EL0A 1PDQA 1XYIA 3F2UA 1G2TA 1AZQA 2MP1A 1U4LA 2HCIA 1HRJA 2L12A 2IL8A 4ZAIA 2Q8TA 2B2YA 2DY8A 2L1BA 2FMMA 1MGSA 3DM1A 1O7ZA 1KNEA 4HSVA 3KUPA 4X3UA 3R93A 1SAPA 5EKIA 1JE4A 1ESRA 1IKLA 1M8AA 4CJ1B 1WVLA 1G6ZA 1HFNA 1WTQA 2VXWA 1WTOA 1RTNA 4HCSA 5EQ0A 1DONA 3FDTA 2FINB 3QO2A 1VMCA 2FJ2A 2K05A 1BBXC 1E0BA 1KNAA 3D6WA 1SSOA 4RAUC 1HFGA 2XIWA 4R9WA 4MHEA 4XDXA 1G91A 2MGSA 2X69A 1WTWA 1WD1A 1B2TA 1EIHA 1EQTA 1C8CA 1ILPA 1LV9A 1EIGA 4OIKA 4UAIA 1QE6A 1WD0A 2KECA 4LMQD 5T1GA 1ML0D 3I3CA 5D65A 1F9PA 2NYZD 2KEDA 1TVXA 1DOLA 2J7ZA 5CMDA 1NCVA
chains in the Genus database with same CATH superfamily
3S15B 4KK7A 1ZYRD 1CKMA 1AW7A 2L4NA 2A69C 2R3ZA 4FP5D 3E9IA 4IPCA 1N36Q 1N33L 2EY1A 5A2QL 1SYCA 1JJGA 2ZTCA 3RLNA 1UNSA 4RH6A 4DV0L 4L8JA 4B3RL 2I5LX 2X6LA 3KLRA 3NBIA 2ES2A 2B2TC 5IT9E 1QWYA 5LMUQ 4DR2Q 2B8GA 1MSHA 1L0WA 1Y69U 2F0PA 3CAMA 1VQ9A 4WJ3M 3HOVG 3H15A 4TSSA 3UDIA 2MJ8A 3DHQA 2D0PA 3OW2A 3SGIA 1AE3A 4HAEA 5T1IA 2A68C 3E6ZX 3RN5A 3NSWA 2OTLA 4OX9L 1BO0A 2IT1A 4C2MB 3S16H 4A3BB 1Q1BA 4JI0Q 2IX3A 1BVSA 2N55A 4JOIA 5KRUA 2CVRA 4TRDA 2JA8G 1LT3D 3GTKB 3SXHA 4KI0A 1SLJA 1NMGA 3HOZB 1YJWA 4NW2A 2Q8IB 2B2TA 2E2HB 4R8IA 1E2VA 3T53B 3PF5A 3JAMc 1SE8A 4K0KL 2KEEA 1F9RA 1IL8A 4K5XA 1FL0A 4O1NA 1VQEA 5KNBA 1SMYC 1A3TA 1TWGH 4IQZA 2EVBA 4LUZA 2QILA 2E8GA 3OMCA 3H3VC 2UU9L 3J81L 3TRZA 1KDBA 1KQSA 3CC7A 3GTOH 4DAVA 4DR3Q 3R93A 3Q0AA 1SAPA 3NBHB 1JE4A 1EIFA 1ESRA 4JI5L 4A4IA 2JE6I 5IYDH 1WTQA 1RD9D 3EIVA 4DAMA 1UE1A 5JOBA 2XSCA 3S2HB 5EAYA 4P71A 2K5QA 1TWCB 1W6KA 4MHEA 5GAGC 4QB4A 1D1KA 4LFBQ 1D1IA 1C8CA 3O13A 4X6AH 3SE0A 2F0SA 2E76C 3OPOA 1LT5D 5D65A 3TBIB 3JAMi 2H5XA 1BR9A 4X65Q 3FVQA 3T4AC 1WTPA 1A62A 2ZTDA 3D3RA 1XPOA 1CK1A 4DXFA 2OWOA 5KGUA 2EOTA 1SNQA 1XX8A 2YTYA 2QKIC 3A8JE 1GUSA 5EBDA 5C4XG 1CKNA 1LTRD 1PYBA 5I6WA 3A8KE 1WCMG 3WDNA 2QEXA 1S5CD 3KLSX 4JYAQ 2YYZA 3HOYG 3HOWH 4J15A 3P20A 3K7AH 2O5IC 3HZXA 2MQHA 1MJEA 1GUTA 3E0EA 1JICA 2O5JC 4HIMA 2OT2A 5JPMC 4A3JG 3AFPA 2CW0D 4HIKA 1STYA 4C3IB 2L11A 4A3MH 1KLUD 3I4LA 2I5MX 3KOJA 1N32Q 2IPKD 1JJ2A 4UP7A 2F52A 3EN2A 5CR3A 1ASYA 5M3MG 1I3QB 1Z9FA 5JVH3 3ULLA 1WTVA 3L0OA 4BBSH 1XWEA 1GUGA 4IURA 1IYVA 2K28A 1W6JA 4ZLTF 4DV6L 4LWCA 3K5OA 1YVCA 4IUNA 1SXTA 1X3PA 1MSGA 3S15H 1VQAA 4DV3L 1HR0Q 1U4LA 4JI7Q 2ZM6Q 2L1BA 1BBWA 3DM1A 2E75C 4YCUA 2R7ZH 1JWUD 1M8AA 1BCPD 1HNWL 1IBML 1RTNA 3MXPA 4G7ZC 1EWIA 1RF2D 2IJ0A 1PTOC 3CU7A 4B3SQ 2ICEC 1ONLA 4C3HG 4JI1Q 2QF7A 4DUYQ 5DEHA 3SK5A 1EIYB 1KD1C 4OO1H 1SYGA 1NSNS 3BJUA 5T1GA 1ML0D 3QOJA 2KEDA 4GKKL 4Y52H 4BY7G 4EQOA 2C35B 4C2MH 1SNPA 3CCLA 4A3BH 4DR6Q 4A93H 3IFDA 3BVMA 4HIOA 2ASBA 1F9SA 3K5NA 1PH4A 1VQ8A 3C46A 4FF2A 4DR5L 1K3BC 4CDCC 1B8AA 1E1TA 1K83B 3A5ZB 3F8TA 2E2HH 1VQJA 2UUCQ 1I6HH 1LTLA 4U68A 3DM3A 4ME5A 1ILQA 2LY7A 4E6IA 4GZYC 3QB3A 2B2VC 5E4XA 1KRTA 1YNJD 5M3FH 1K0RA 4XYQA 2G5DA 4WRDA 1IYUA 4O2DA 4B3TL 1RL2A 1LACA 3JAML 1TU2B 3VR3A 1EU4A 2BOSA 2AKWB 4UY8C 4ID6A 1ZKOA 4XIGS 1TWAH 2MPMA 1E7ZA 2IX1A 3MC0B 5A35A 1YEZA 1QVCA 3MEHA 4HEDA 2D2CC 2M2LA 2VB3X 3AU7A 3PUVA 2CH4A 3GD7A 5C0XI 3BVGA 3T56B 3X3NA 2BH2A 4QCLA 3EA6A 2Q2UA 4IPHA 1HNXQ 1SNDA 2I5HA 4CJ2C 2AWOA 1EYGA 4CKBA 3M4OB 4IUUA 4X64Q 2NVYH 1WTOA 2QEJC 1GO3E 4JI6Q 4XQQA 3NTIA 4JI2L 3HEJA 1JB7A 3K8AA 5JVG3 4L63B 1EQRA 4X3UA 3DXJC 3S1RB 5KIXA 2Y0SB 2JA5G 1N34L 1XNQL 2MHVA 1N33Q 4KD4A 4POGA 4GKJQ 2K5NA 3FDTA 3DMUA 3BG3A 4DV0Q 1Y1WG 1E0BA 3OIQA 4RAUC 4B3RQ 1C0AA 4GNXC 2H4OA 3DUZA 4C3JG 2JA8H 4BXXG 2K5WA 4CKCA 2ZJQA 2WKCA 1U0LA 1K8MA 4XXEA 1EIGA 4LF8L 5LL6X 5IYBH 2RF4A 1TWFB 4BS9A 5C5LA 1PYWD 2ZJPA 2DUDA 3P7JA 1CM9A 1M90C 3RZDB 2JA7B 3H0GB 2B2UC 2JYOA 5C3EB 3NWSA 4C3IH 2JEBI 3PUXA 2ID0A 4KHVA 2K04A 3SK6A 4DV4L 4X3TA 3CC4A 1O78A 4HJ7A 3D8GA 4O42A 2WIIB 3I72A 1XTCD 1CZGA 1QNUA 5CBAE 5IODA 1EY4A 1EYCA 1I3QH 2RDGA 4IFDI 2R61A 4AQYL 5C44G 4K0KQ 3QOLA 1A15A 2N78A 2VB2X 5BN3A 1IBLL 1HH2P 1PMRA 1QCBD 1TR5A 2JXMB 2EDGA 1ICFB 2J0TD 1EYAA 2MO1A 2MFIA 2UU9Q 3RLOA 2NBFA 4IJHA 5IGBA 3CCMA 3W1GA 2E2IB 5E1FA 2B63G 4JI5Q 1EY5A 1SN8A 2Z4HA 1LUZA 1STGA 2L9HA 5F2DA 1VQFA 4FXGC 4CKEA 1HR0W 3PMFA 4DFAA 2UUBL 4XQJA 3K6OA 4NXML 2FFKB 4IPDA 3HOYH 1V1QA 1ET6A 1PFSA 5GADC 2KA7A 4H02A 1CI3M 1PRTF 4HSVA 4ZYSA 1EZ8A 3TS0A 4CJ1B 1QZGA 3OMGA 2F3IA 4A3JH 2AUJD 3S9WA 2YU9H 1ENAA 2K05A 2A69D 1SSOA 5C5MA 2NVTB 4QF4A 1GD7A 4PZ7A 1EEFD 2X69A 1KDCA 2A19A 3DWAA 2EYHA 4B3ML 1PVOA 3S16B 4LMQD 1DYQA 1EFWA 5M3MH 2PI2E 3TQYA 1FGBD 5LL6S 2Z0SA 2Z6KC 4CHTB 4OWXB 1A3VA 2R92G 3CF5A 3UE0A 1C7YA 1IW7C 2UUAL 3U9OA 2A6EC 1X55A 4PQXA 4GOPB 1B3AA 3RZOH 2VL6A 1Y1VG 2R6GA 4KN7C 4DN4M 2A68D 5A2QE 2I0QA 1SYEA 5IGFA 3FRPB 2A74C 4BY1G 4DAYB 2Z4IA 1X65A 1EYDA 1F77A 4AH6A 2QA4A 1QG7A 1X3FA 2CFMA 2G9DA 4X3KA 4IUVA 3PO2G 4ZCKA 4A3DB 2SDFA 1CFMA 4G4KA 1JC7A 1NE3A 1RODA 3BYYB 1TWGB 4MNOA 4GN4B 2WV6D 1L1OA 5FLMG 1B44D 4C3HH 1CSPA 2HDLA 3AFQA 3CCQA 4DV6Q 5C3WA 1RIPA 4NDXA 4A3CH 1BQQT 1PRTB 4AYBE 3SVMA 1VQ6A 1EY0A 3CC2A 2XN9C 4DV3Q 3RLFA 4BY7H 5IP7H 3SK4A 1XTDA 3KYHC 1SMYD 2HQEA 3FKIG 1MJCA 2B29A 3DEOA 4IUPA 2XTIA 2H1EA 4AYBB 1T9HA 3MVVA 1HNWQ 1IBMQ 4CBVA 2BCOA 3N52A 3LNNA 1VQGA 2F0OA 5DAUA 4A3EB 1KDAA 4DV1L 2WB1B 4F8MA 1DZ1A 1MBYA 4PZ6A 4R8NA 5H1SE 2ZJRA 1XMOL 1PH5A 3CCJA 1TWFH 3I4NB 4FXDA 3Q24A 5JJLA 4GKKQ 5K36G 3RZDH 2HCIA 5DM63 3H0GH 3J81E 5C0XG 2EYFA 3PSIA 4JPBW 1LTGD 1QJOA 3K5MA 4K6LA 2O4XA 4YCVA 3KK7A 1STBA 4LFAL 1C9OA 4R4IA 4WJWA 2RDHA 2IHFA 3M9BA 1KNAA 4DR5Q 3HOWB 3I56A 3K7AB 2A5HA 2EQSA 3TMEA 3R3OA 3K0XA 2SNMA 4PMBA 2EPBA 1VDZA 2K32A 3IFTA 3A56A 2LFNA 4F88A 4Z9CB 4FDBA 4OGQC 1D7QA 1VQKA 4APVA 4WJ4A 4DR7L 2A6HC 2FMCA 3GTMB 2OTJA 2CHBD 5FKAC 1KHIA 1I4XA 3L3OC 1B9NA 1BUVT 1B1ZA 2K7VA 3IKJA 1ZEQX 2JA5H 4KJNA 4JI6L 5KNDA 3K5LA 1AZPA 1LYLA 3G71A 1VQIA 5EPLA 3K80C 5IIFA 3M4PA 4C3JH 4A3IG 2BA0A 4XT3B 5HGQA 4BXXH 4I7ZC 4JOIC 3I2ZA 3S1NB 3HP3A 4GKJL 3ND9A 1VQ7A 1X3EA 2K52A 2R7ZB 1J9OA 1H9JA 4DXGA 4HN7A 1X9NA 4LF4L 4JI2Q 2ZXRA 1OXSC 3JC66 1OTCA 1Q1EA 4LF9L 5IGEA 4EVOA 4IFDG 1T5EA 3BVZA 1N34Q 1XNQQ 1EQQA 2UXBL 1N8RC 3ICEA 4V190 2NVTH 3PIP3 3B6YA 2K5VA 2OXPA 4RA8A 3SDZA 1QNKA 2OF1A 3VYRA 4DV2L 1MKHA 4GOPA 5EJWA 1AEXA 4DPGA 2IHEA 2BH8A 1F2LA 1A0IA 2RHQB 3UE1A 4A93B 4UPAA 3R2TA 3KLWA 1PTOD 1ESFA 3A8IE 2K33A 2OEOA 3MZ5A 1XYIA 4LF8Q 2F0HA 2B3GA 5C44H 2Q8TA 1SNMA 3LWUA 2K14A 2UXCL 5EKIA 1I6HB 1FD7D 1LTSD 3LGJA 3K7UC 1JOQA 2K5DA 4ABNA 1Z7TA 3MXNB 4DV4Q 3M7GA 3NTHA 5M3FB 2JSOA 4A3DH 3VA5A 1GKHA 5BR8L 2B63H 2VQEL 1LV9A 4UP9A 3E3XA 4FF1A 3A7LA 3MXUA 3TREA 3HOXG 3C2PA 1WOCA 2A8VA 1TWAB 4AQYQ 2VNUD 4IZ8A 3ULPA 1DOKA 2SOBA 1PH2A 3GTLB 1D5XC 1OO9B 5I2YA 4R4CA 3S1QB 1WI5A 2PZTA 4RKBA 1IBLQ 1H9KA 4FF4A 1S5DD 3MFYA 1HUNA 1IL2A 5HGTA 2AHOB 3P1HA 3DWQA 3QWNA 3G7LA 1SNCA 3TSSA 3CXCA 4M1UB 1STEA 2NTSA 5FLXc 3I4OA 2JN4A 3HKZG 2CWPA 4A3EH 1VQMA 2NVYB 3D4WA 5CV6A 3HOVB 4OHJA 5IGGA 4K5VA 4K2LA 1JMCA 3CPFA 4KY5A 3AEVA 2QDBA 1B50A 4WFN3 1SROA 3NXWA 2UUBQ 3I4NH 3V96A 1SE2A 3JAME 4A3GG 4NXMQ 4X3SA 1HZ9A 1VF7A 2JP1A 4KKUA 3CQZB 1Q3LA 4IO9A 1VCIA 4BBRG 2JK8A 2RQXA 2R92H 3R2IA 1GVPA 2PPBC 3HGBA 3K57A 2DJGC 2JA8B 3VR4A 2F0NA 4NKLA 1Y1VH 1QVFA 5E3FA 3CP0A 3MEFA 1SYBA 3GTQH 4B9XA 1HTPA 2RDFA 5JJKA 3D4RA 5EKKA 3S24A 3GV3A 1JE5A 1DCZA 3PO2H 1EL0A 4DU9A 2HD3A 4B3MQ 5G3LD 3H3VH 2MP1A 3D31A 1DD2A 1D2BA 3U58A 2PNHA 3HOUG 3T13A 4DV5L 1KL9A 1XNRL 3GTMH 3BDOA 1NMFA 2UUAQ 2PNRC 2Q2TA 1KAWA 1TT2A 4JBKA 1IBKL 1SE3A 1BBXC 2FJ2A 2L55A 1R4PB 3Q23A 1GHJA 1SMXA 2KHSA 2NVQB 3PF4A 1EIHA 2HQLA 3URYA 3MXGA 3PUWA 1VQHA 2WKDA 3J7AF 4RGNA 3G6JB 1FJGL 1LO5D 1BCPF 4GN3B 5C6AA 3KJPA 2D5DA 5M5YB 1F9PA 2NZOA 3Q8DA 1JR0D 3AQQA 4ZK9B 5CMDA 4CJ0B 2A1AA 3S1NH 2R7DA 2EY6A 4RFBA 2NZ1D 1OXXK 3NK9A 3KJOA 4M8AA 2HT1A 3D4DA 1ZXTA 1Q86C 1XPUA 2DNEA 2F0MA 1S4ZA 1K8AC 3RNUA 4B9WA 5C0XH 1B4OA 1STNA 1LLRD 1PLFA 3C3LA 2CWAA 3T1YQ 4DUZL 3PO3G 4GNXB 1VQDA 5C4XB 2P5ZX 1WCMB 1X32A 4ZUIA 2JQOA 4RGOS 4QUCA 4JG2A 1O7YA 1TS5A 3HOYB 4CGYB 3GP7A 4DV1Q 3MXNA 5M9OA 1QOHA 3G4SA 5CORA 2EYJA 3QIAA 3NP8A 2VS1A 1XMOQ 1EY8A 1VS0A 1C48A 2AUKA 4A3JB 3KDFB 3EROA 2YU9B 2JA6G 5JEAG 1CSQA 1AP0A 4U673 2EYLA 2F0IA 2F4IA 1W2BA 3TEHB 1B7YB 2KOLA 4R4QA 1VQLA 2LS01 3KF8B 1EU3A 2L15A 4P73A 3NBHA 4LFAQ 1R9TH 3PIPA 1E24A 2K4KA 2XGTA 5IP9G 4A3FG 3W1BA 5M3MB 1Z6HA 1YHAA 1BCPB 3DLLA 2RSNA 1Y8NB 2LSSA 2WAQG 1K8GA 2KCNA 5D14A 3NHHA 4HJ9A 4J1MA 3CCEA 3GTLH 3RZOB 4A3IH 3S1QH 2IL8A 2B2YA 4LJZC 2AQ2B 2XWBB 2HHHL 2PMZE 4DNTB 5HY6A 2ZT9C 4HCSA 1DONA 4DR7Q 4LAAA 1IW7D 1PTOH 3H6MA 3A55A 2A6ED 3VYTA 5I2XA 1K8OA 1PV4A 1WD1A 1XXGA 2PMZB 4V0BA 3HOVH 1A2UA 4C3HB 1I4HA 3NTKA 4G7OC 2F0TA 1FNWA 2ZXOA 3I7FA 3I3CA 3EQLC 4LF7L 2MUYA 1W3SA 5FLXL 2F0LA 3IAYA 2RSOA 4BY7B 2XVSA 1YBYA 4IUTA 1HCZA 4JI4L 3CQZH 1B9MA 2I07B 1HUMA 2HDMA 2HIXA 2F0QA 4LF4Q 1RTOA 1PFBA 2IX0A 2F3VA 2V4DA 4JW0A 3SEBA 3BZDB 3S14H 1D5ZC 1A6XA 1BOSA 3UI2A 5ISRA 4LF9Q 4OEMB 1MI2A 3ULJA 4H0LC 3CCSA 4CDDC 1NAPA 3FHWA 2UXBQ 1IHZA 2R93G 1E22A 1MD2D 5GROA 2CCZA 4DV2Q 5D3DA 3OHXC 4A3KG 1V9PA 4HTHA 3UDFA 1TY0A 1GXDC 1HHVA 3N6RA 1P16A 2BE5C 3MHBA 5DLQE 3A5UA 1Q82C 1CKOA 1HNZL 4KKTA 2ZTEA 1NUCA 2UXCQ 5EKLA 1Y8OB 4ULLA 3STBD 4QL5A 3I4MG 2AWNA 1GUNA 4DK6C 4RGMA 1HQRD 5COYA 4RCOA 4H44C 1PZKD 4ZRZA 1A8VA 4N8X1 5JPNC 1ENCA 2NVQH 4A3LG 2NVXB 1O7LA 3J7ZC 3I8ZA 1TWHH 1PH6A 5M5YH 1I94L 4DV7L 2PYKA 5BR8Q 2YTVA 2VQEQ 1J5EQ 1K28A 1UE5A 3U50C 5E7NA 4DGZA 2ENBA 1I6VC 1STHA 3W5OA 5LMNL 4C56C 3V05A 1KLGD 1KRSA 4WORA 1IKLA 1TKWB 2JA5B 1EOVA 5C3XA 4A3GH 1HZBA 2EJMA 3BDCA 4FYDA 3QO2A 1YNNC 4DK0A 4KKSA 3SHLA 2XIWA 5C4XH 1Y1WB 5EGTA 1WCMH 1S5FD 2A6HD 4C3JB 3KDFA 1K73C 3CKIB 3NEMA 4JI8L 3A0JA 5AJ3L 2PQAB 4UAIA 4S3SA 4BWGB 5IGCA 3OW7A 2NYZD 4BA1I 3KF8A 2R93B 4K8JA 4TKOB 4PMCA 2M9VA 1DXMA 3V2TA 2NWGA 3SK8A 1U4PA 5ELCA 5CV8A 1K9MC 1HA6A 1LM0A 3PUYA 1UE6A 5AFWA 2PW5A 5JJZA 3FPUB 5FO9B 1M4VA 4KY6A 2CKZB 1HXYD 4R4OA 4JVZA 2F0KA 1L1OC 2C5CA 1AH9A 3CCVA 3KLSA 1F2YA 1X56A 5I9PA 1S5BD 3PV0A 1XMQL 2RCFA 5C44B 4DR4L 2LXJA 3BZCA 4N8FA 1PH9A 1GUOA 1PH3A 5I6YA 2ZXPA 4HMJA 1U4MA 1NR2A 1V1OA 3OIPA 1E2WA 4K8IA 4J6HA 4JBWA 2EIFA 3MA2B 3IL8A 4LFCL 5K5PA 2D0OA 4DV5Q 1XNRQ 2VQFQ 2YTXA 1E3PA 3OTOL 2NZHA 4XTCS 2B63B 2F1MA 5HURA 4FNFA 3ZYYX 1S72A 1IBKQ 2F0UA 4RWSC 4MN3A 2EXDA 1A2TA 5M5XB 2B39A 5ELDA 3D6CA 1LT4D 1VF5C 4YWKA 4YHHL 3TP6A 2SEBD 4KTAA 2VUMG 1KIXA 1FJGQ 4QY7A 1AZQA 3CMEA 2VY3A 3HG9A 5CV9A 4ZAIA 3T1YL 3C1EA 1EFID 4JBMA 4EX5A 3J80c 1MGSA 1G8ZD 4A3MG 3S2DH 1YITA 4DNIA 3GO5A 4NB3A 3KBGA 2VXWA 4YIJA 1VMCA 3W3AA 2JA6H 1HFGA 1STAA 5JEAH 1G91A 4XDXA 3GTGH 1Q90A 3X3MA 2OCEA 3F2DA 4GN5A 3RD4A 4BBSG 5CV4A 4DUZQ 1N9WA 2E5LL 3W2DA 2GVBA 3STBC 2DN8A 3L7ZC 3WWVA 1Q81C 1TVXA 5IP9H 4A3FH 3FP9A 3OOCA 5IYCG 1V8QA 2L0CA 1YHBA 4MIUA 3NQIA 1F2MA 2KHIA 2R92B 4KLKA 4XYOA 3OYYA 3GTPB 3VR2A 1Y1VB 2V1CC 3OWFA 5CGKA 3GTQB 4FF3A 2OQ0A 2OQKA 5BN4A 4UP8A 4BY1B 1PH1A 2K6AA 4K2KA 2B2WA 2I46A 3J80i 4QQBX 4OELB 2JEAI 1SNOA 2NVXH 1PXUA 3PO2B 1TS3A 5I4DA 1QB5D 1LABA 3ZJYC 1A63A 4OXPA 4L5QA 4A3BG 1G6PA 1K0SA 1GUWA 1ET9A 3LX0A 5IT9c 1LTBD 2HUGA 1YI2A 4IOAA 1I50H 1YJNA 5DNFA 2B8FA 1RKNA 2NN6I 4HIDA 3UDXA 1YNXA 5EPKA 4IOCA 1CUKA 4UDUC 1G51A 4EQPA 3HS0C 3RR5A 4QUFA 4MTKA 4RKLA 3FKIB 1TXYA 3HOZG 2IW3A 4GOPC 4HSPA 3TDQA 2DJFC 2HHHQ 4JI3Q 2IWHA 2N49A 4K5WA 1Y1WH 3TP8A 2X6GA 3MTSA 4LF6L 1WTRA 1HJPA 1I4QA 5FO8B 1KTKA 3CMAA 1JT8A 4KMUC 1F9QA 1GOZA 2K1BA 3HKSA 3U9SA 1PZID 1O80A 2GN5A 3F1ZA 4MTNA 2PO4A 3TN2A 2R93H 3S1MB 1KAAA 4Q5VA 3M4QA 3J7YW 4LF7Q 1WJJA 4A3KH 4IN3A 3PIO3 4J8QA 3HFZB 1PH7A 4NXNL 3KUPA 1PRTC 5BN5A 4JI4Q 3VYUA 5J1ZA 1PTOF 2G9HD 2QCPX 2RCNA 2FINB 5EQ0A 1EWHA 1NJIC 3ND8A 3CD6A 5IY0A 2PI2A 1H9MA 5FJ8G 4AIMA 4KY7A 3CCRA 4IJLA 1WYDA 2CQAA 4DAYA 1EQTA 1QZHA 3I4MH 5IOCA 1Q8IA 3GTJH 2CQOA 2F4VL 1IZ6A 3S17H 4X66L 1MIUA 4A3LH 4KHZA 4ODGA 1S40A 2EYOA 3RN2A 1FGUA 2A73B 1L0XB 1D8LA 3NQTA 2ICIA 1K3RA 2RA4A 5IE8A 2RBMA 4L5SA 1R9TB 5JAVA 4ALPA 1P8LA 1VMPA 5GQOA 1HNZQ 3NUCA 5ELEA 1J5EL 1BDOA 3TP5A 5KEEA 2IY5B 3WOFA 1H9SB 1FYCA 1SRUA 4GS3A 5M5XH 1Q12A 1CA6A 1EWCA 3EBEA 5IYBG 5LHY1 4KD3A 2WINB 3CHBD 3TP7A 4A3IB 1VQOA 3R8BA 3ERSX 5CBEE 1I94Q 4DV7Q 1VQBA 3EFXD 4LF5L 1SR3A 4POFA 4Y7NH 4C3IG 4DR1L 1CT1D 1KXLA 2PCFB 3AYHB 4X62L 5LMNQ 1X6OA 1NBWA 1PTOB 2F03A 3M7NA 2ALYB 1Q46A 1LTAD 1X3QA 4RHRA 1AFPA 1HPCA 4GLVB 1DGSA 1G2SA 3OSOA 4HR7B 4QMGA 1JJCB 3J80L 4G7HC 3UDGA 4DKAC 1YHQA 1VQPA 1CQFA 2KCTA 3P75A 1BF4A 2K75A 3MWYW 4QJFA 4O0AA 2DY7A 1IYJB 4JI8Q 4RCNA 3TZDA 4L5RC 5FOBB 5AJ3Q 1SYFA 1SFOB 4K14A 1QVGA 3E0JA 5C4ZA 1LTID 3QG1A 2L12A 3S14B 4FXKC 1R4QB 3WOEA 1T5XD 2DNCA 3L2PA 4JBJA 5ELFA 1EQVA 4YY3L 3GTPH 1WVLA 1LTTD 1OXTA 4EGVA 1AN8A 1FR3A 1TS2A 4H13C 4BY1H 4N9TA 1BKBA 5G3LF 3NELA 3SR1A 2PZUA 4JV5L 3E5SA 1B2TA 2ATWA 1SYDA 2F3WA 2F0DA 1HA5A 4IALA 1JB3A 3ER0A 4BA2I 3HOXB 1ENFA 5FLMH 1PA6A 4I7AA 1XMQQ 2E2JH 2VQFL 5FLXE 1RCVD 4DR4Q 4RMFA 4LK1C 2KJXA 2C9OA 4H7BA 2VUMH 4RGTA 3EVQA 1RDPD 1L2FA 3HKZE 5IT9L 3FKIH 3BDLA 3VA7A 4HJ5A 5I9OA 1RHPA 4NPSA 1BNZA 2KCCA 3I73A 4OIJA 5KYLA 2KHJA 3EJIA 4LFCQ 1GHKA 2BE5D 2CH4W 2F0WA 1ZYRC 1TWHB 2LMCB 4Q0FA 3OTOQ 1I4PA 5DM73 1CA5A 3HKZB 3OWEB 4DAPA 1QILA 1HZAA 2BA1A 1GJXA 4F87A 3H94A 5IGDA 4LW1A 4XQNA 1BXTA 3S1MH 4A75A 3I70A 2K01A 4YHHQ 1EEID 5K36H 4A3GB 5IYCH 1GM5A 2YV5A 5M5WB 2VW9A 1H9RA 2D9UA 5GAHC 4LUVA 1WFQA 4BBRB 1YJ9A 2KVMA 5C4JB 5FK9C 2DGYA 3M3YB 4ZKBB 2N3SA 1SJED 1D6EC 2AQ3B 2SNSA 1UEBA 2NUCA 4ME3A 1UAPA 2FHTA 2TSSA 2BDNA 1YNND 2Z9HA 2B2YC 4XT1B 2NN6G 4ZQ3A 5C0XJ 2E5LQ 1JOKA 4DK1A 1PDQA 4A3CG 3F2UA 4F7XA 1CZWA 3T16A 2Y0SG 4C1NK 5IP7G 1H9SA 5IWAL 3PIOA 1KNEA 2N8NA 1EY9A 3HOUB 3H3VI 1G6ZA 1JORA 2GA4B 2VZAA 2LKVA 1QUQB 2KQ3A 4JK1C 2RKSA 1XPRA 3GTKH 1FNUA 2E2DC 3T1HL 2WFWA 2L5TA 4RG1A 3HOZH 1VQNA 4OONA 1QE6A 3K81C 1PHJA 3CPWA 4B08A 5TSSA 4QIWE 1Z47A 1IXRA 1E1OA 3RUZA 4DK3C 4G57A 3ITPA 3GQBA 2KUMA 3H0GG 2JA7G 5C3EG 2EY5A 4JI3L 1OXVA 3Q22A 3CCUA 1KABA 1U9RA 4ILWA 2Z1CA 4DNRB 3KFUA 1ICWA 4QIWB 3BU2A 3M4YA 4FVMA 4P2CB 3NE5B 5CC4A 1NR4A 4IFDH 3DEPA 2UXDL 4DF7A 4ZUJA 4OWWB 2NB0A 3PO3B 3S2HH 3MFGA 4KHPL 4YCWA 1TWCH 1VQCA 1D5MC 4LF6Q 1IKMA 4C1NI 2WACA 4OO1I 5FJ8H 4PV1C 2WP8J 2B2VA 1X3GA 3QR8A 1SFOH 1N36L 5LMNW 4PZ8A 4GLXA 2F0FA 3S2DB 1UWVA 2Y0SE 5NUCA 4IFDJ 2PW7A 5L37A 1EY6A 4HJ8A 4PNYA 3VYSA 5LMUL 4DR2L 2JA6B 3GTGB 1MHWC 4NXNQ 1FVIA 3U4VA 3AMUA 2WAQE 1L1OB 2EJGC 4NMZA 1WTXA 3I90A 2LXKA 1I4GA 3C1FA 4A3FB 2CW0C 2EE1A 3I55A 3VDYA 5EBCA 3HOXH 2WAQB 1RJTA 4JI0L 4OWTB 3K58A 2K5HA 2F4VQ 2JA9A 4JCVE 4X66Q 5GAEC 2KENA 1HRJA 1SBBB 2F0JA 4HMIA 2R7FA 1Y8PB 3VR5A 2XRSD 2F0VA 4OX9Q 4LNQA 1SJHD 2EYMA 3IRBA 4HJAA 3FPPA 1JWSD 3RMHA 4DA2A 1WTWA 5KYIA 3K0YA 3PUZA 2XRQD 4L6TB 1PYSB 1WD0A 1YIJA 5J39A 1B3QA 4GNXA 2EYPA 2QDLA 1TQOA 4P75A 1SE4A 1AE2A 3HRZC 1DOLA 1BCPC 3GV6A 4GLAC 4LUOA 3KF6B 1I50B 4DR3L 1CQVA 1SEBD 2KCMA 1H95A 3I91A 4TQUS 4LF5Q 3E9HA 1PFMA 5M5WH 1CHPD 4BBRH 5KNCA 1F2ZA 4DR1Q 4JC0A 5C4HA 2TMPA 5C4JH 1G2TA 2B2UA 1KC8C 3M3YH 4X62Q 2RHSB 4LFBL 4A3DG 2Q8RE 2JJQA 5ELBA 3TZUA 3TS2A 3VR6A 3AB9A 1UE7A 1NNXA 2BDOA 4P74A 4HCEA 1DM0B 1JCKB 4L5TA 5EPJA 4X65L 3L9AX 1QUQA 3FEWX 2J4XA 2EJFC 4PMWA 3PQIA 1SDFA 2MNAA 4A3KB 1M1KC 5IYDG 3K59A 3QJYA 3CW2C 4EQ5A 4ZKCB 3HOUH 2FXQA 2AQ1B 1TIID 1YNJC 4CDFC 3J7A5 4AYBG 1CTMA 1V1PB 4YY3Q 2Z6BA 2O2LD 5CV7A 1HZCA 4MZ9A 5ELOA 3I4MB 4JYAL 2GVAA 4A76A 3LWEA 4A3EG 1K83H 3GTJB 2KBNA 2WB1G 3S17B 1PRTD 3M85A 2XNAC 3J81j 4JV5Q 5CV5A 1PZJD 3NWTA 3KBXA 4CDEC 1C4QA 1U4RA 3I4NG 1V43A 1Q7YC 2QW7A 1S3OA 2EY2A 1O7ZA 4P72A 2NTTA 3NENA 1VQ5A 1HFNA 4KN4C 1N32L 5D3IB 2HIVA 3NPPA 3HOWG 3DWPA 3D6WA 4EQNA 4R9WA 1II3A 2E74C 2MGSA 3U4ZA 3PO3H 2K50A 3J81c 1JWMD 1X54A 3CRKC 4OIKA 5J3BA 1Y14B 2KECA 2PZWA 4TVAB 1HR0L 2J7ZA 3ERQA 2ZM6L 4JI7L 1NCVA 1A3UA 2D62A 4Y7NB 3M4OH 2K03A 3F2BA 1HTLD 2NN6H 1EOTA 5E4WC 1S5ED 3GTOB 3A7AB 3D0FA 2Z6KA 2B2WC 2EXZA 2N88A 3H91A 3S1RH 4B3SL 1DOMA 1FNVA 1YZ6A 4JI1L 5FO7B 1PH8A 3FMCA 4DUYL 1JOOA 2WB1E 3GDEA 2M00A 1HQMC 2AMCB 4RHSA 4UHVA 5ELNA 1J8IA 1O7IA 2QGQA 4KV6A 3ONAB 1WTHA 2Q2HA 4IUQA 4DR6L 1G291 3BZKA 1BBUA 2RVLA 2R7ZG 1ASZA 3H09A 5JEAJ 4K6DA 3J81i 3T51B 3MAQA 4N9PA 1DJRD 1J6QA 1TY2A 3PGZA 1B70B 2UUCL 2JA7H 5C3EH 1PFNA 5IWAQ 1LT6D 1U5KA 1I4RA 3KF6A 3A74A 1UEAB 4OO1G 2XWJB 3PCOB 1B53A 3Q6SA 3G6EA 4YWLA 4QGUA 3J80E 2Q2IA 3T1HQ 1L0YB 4A93G 5J22A 1VQ4A 1EZ6A 3G48A 2E2JB 4R4TA 1EUJA 2HCCA 2F0GA 4PG3A 3BYTB 2PQAA 5CYUA 2VUMB 3BS1A 1CKNB 4YWMA 4IPGA 1EY7A 2DY8A 1UUPA 2FMMA 4B3TQ 3J7AV 4R1JA 2EZVA 4I65A 4A3MB 4KJOA 3A54A 4NP5A 1E2ZA 5JJIA 4OL7A 3F2CA 5M3FG 2F0EA 1OXUA 1HNXL 3CRLC 1JQYD 2MO0A 2E2IH 1CHQD 1XJVA 1TS4A 4FO2A 4X64L 2UXDQ 1ILPA 4BBSB 2PQEA 4KHPQ 1V1PA 2Z8LA 1NY4A 1NTGA 1Q8KA 1I5FA
chains in the Genus database with same CATH topology
3S15B 4KK7A 1ZYRD 1AW7A 2L4NA 2A69C 2R3ZA 4FP5D 2EY1A 5A2QL 1SYCA 1UNSA 4RH6A 4L8JA 2X6LA 3KLRA 3NBIA 2B2TC 5IT9E 1QWYA 2B8GA 1MSHA 1Y69U 2F0PA 4TSSA 2MJ8A 3DHQA 5T1IA 4HAEA 2A68C 3E6ZX 3NSWA 1BO0A 2IT1A 4C2MB 4A3BB 1Q1BA 2IX3A 2N55A 5KRUA 2CVRA 4TRDA 1LT3D 3GTKB 3SXHA 4KI0A 3HOZB 4NW2A 2Q8IB 2B2TA 2E2HB 4R8IA 1E2VA 3T53B 2KEEA 1F9RA 1IL8A 4K5XA 4O1NA 5KNBA 1SMYC 1A3TA 4IQZA 2EVBA 2QILA 3OMCA 3H3VC 3J81L 1KDBA 4DAVA 3R93A 3Q0AA 1SAPA 1JE4A 1ESRA 2JE6I 1WTQA 1RD9D 5JOBA 2XSCA 3S2HB 2K5QA 1TWCB 1W6KA 4MHEA 4QB4A 1D1KA 1D1IA 1C8CA 3O13A 3SE0A 2F0SA 2E76C 3OPOA 1LT5D 5D65A 3TBIB 1BR9A 3FVQA 3T4AC 1WTPA 3D3RA 1CK1A 4DXFA 5KGUA 2EOTA 1SNQA 1XX8A 2QKIC 3A8JE 1GUSA 5EBDA 1LTRD 5I6WA 3A8KE 3WDNA 1S5CD 3KLSX 2YYZA 3P20A 2O5IC 3HZXA 1GUTA 1JICA 2O5JC 2OT2A 5JPMC 2CW0D 1STYA 4C3IB 2L11A 1KLUD 3I4LA 2IPKD 5CR3A 1I3QB 5JVH3 1WTVA 1XWEA 1GUGA 4IURA 1IYVA 2K28A 1W6JA 4ZLTF 3K5OA 4IUNA 1SXTA 1X3PA 1MSGA 1U4LA 2L1BA 3DM1A 2E75C 1JWUD 1M8AA 1BCPD 1RTNA 3MXPA 4G7ZC 1RF2D 2IJ0A 1PTOC 3CU7A 2ICEC 1ONLA 4C3HG 2QF7A 5DEHA 3SK5A 4OO1H 1SYGA 1NSNS 5T1GA 1ML0D 3QOJA 2KEDA 4EQOA 1SNPA 3IFDA 3BVMA 1F9SA 3K5NA 3C46A 4FF2A 1K83B 4U68A 4ME5A 1ILQA 2LY7A 4E6IA 4GZYC 3QB3A 2B2VC 5E4XA 1YNJD 4XYQA 4WRDA 1IYUA 1LACA 3JAML 1TU2B 3VR3A 1EU4A 2BOSA 4ID6A 1ZKOA 4XIGS 2MPMA 2IX1A 3MC0B 5A35A 3MEHA 4HEDA 2D2CC 2M2LA 2VB3X 3AU7A 3PUVA 3GD7A 5C0XI 3BVGA 3T56B 3X3NA 4QCLA 3EA6A 1SNDA 4CJ2C 2AWOA 4CKBA 3M4OB 4IUUA 1WTOA 2QEJC 4XQQA 3NTIA 3HEJA 5JVG3 4L63B 4X3UA 3DXJC 3S1RB 5KIXA 2Y0SB 2MHVA 4KD4A 3FDTA 3DMUA 3BG3A 1E0BA 3OIQA 4RAUC 2H4OA 3DUZA 4C3JG 2K5WA 4CKCA 2WKCA 1K8MA 4XXEA 1EIGA 5LL6X 1TWFB 4BS9A 5C5LA 1PYWD 3P7JA 1CM9A 3RZDB 2JA7B 3H0GB 2B2UC 2JYOA 5C3EB 3NWSA 2JEBI 3PUXA 2ID0A 4KHVA 2K04A 3SK6A 4X3TA 1O78A 3D8GA 4O42A 2WIIB 3I72A 1XTCD 1CZGA 1QNUA 5CBAE 5IODA 1EY4A 1EYCA 2RDGA 4IFDI 2R61A 3QOLA 1A15A 2VB2X 5BN3A 1PMRA 1QCBD 1TR5A 2JXMB 2EDGA 2J0TD 1EYAA 2NBFA 5IGBA 2E2IB 5E1FA 1EY5A 2Z4HA 1STGA 2L9HA 5F2DA 4FXGC 4CKEA 3PMFA 4DFAA 4XQJA 3K6OA 2FFKB 1ET6A 2KA7A 1CI3M 1PRTF 4HSVA 4ZYSA 1EZ8A 4CJ1B 3OMGA 2AUJD 3S9WA 1ENAA 2K05A 2A69D 1SSOA 5C5MA 2NVTB 4QF4A 1EEFD 2X69A 1KDCA 3DWAA 2EYHA 3S16B 4LMQD 1DYQA 1FGBD 5LL6S 4CHTB 1A3VA 1IW7C 3U9OA 2A6EC 4PQXA 1B3AA 2R6GA 4KN7C 4DN4M 2A68D 5A2QE 1SYEA 5IGFA 3FRPB 2A74C 2Z4IA 1EYDA 1F77A 1QG7A 2G9DA 4X3KA 4IUVA 4A3DB 2SDFA 1CFMA 4G4KA 1JC7A 1RODA 3BYYB 1TWGB 2WV6D 1B44D 2HDLA 5C3WA 4NDXA 1BQQT 1PRTB 3SVMA 1EY0A 2XN9C 3RLFA 3SK4A 1SMYD 2HQEA 3DEOA 4IUPA 2H1EA 4AYBB 3MVVA 4CBVA 2BCOA 3N52A 3LNNA 5DAUA 2F0OA 4A3EB 1KDAA 2WB1B 4F8MA 1DZ1A 1MBYA 4R8NA 3I4NB 4FXDA 3Q24A 5K36G 2HCIA 5DM63 3J81E 5C0XG 2EYFA 1LTGD 1QJOA 3K5MA 4K6LA 2O4XA 3KK7A 1STBA 4WJWA 2RDHA 1KNAA 3HOWB 3K7AB 2A5HA 3TMEA 3R3OA 2SNMA 4PMBA 2EPBA 1VDZA 2K32A 3IFTA 3A56A 2LFNA 4F88A 4Z9CB 4OGQC 2A6HC 2FMCA 3GTMB 2CHBD 5FKAC 1I4XA 3L3OC 1B9NA 1BUVT 1B1ZA 2K7VA 3IKJA 1ZEQX 4KJNA 5KNDA 3K5LA 1AZPA 5EPLA 5IIFA 2BA0A 4XT3B 4I7ZC 3S1NB 3HP3A 3ND9A 2R7ZB 1J9OA 1H9JA 4DXGA 4HN7A 2ZXRA 1OXSC 1Q1EA 5IGEA 4EVOA 4IFDG 1T5EA 3BVZA 4V190 3PIP3 2OXPA 4RA8A 3SDZA 1QNKA 2OF1A 3VYRA 5EJWA 1AEXA 1F2LA 4A93B 3R2TA 1PTOD 1ESFA 3A8IE 2K33A 2OEOA 3MZ5A 1XYIA 2F0HA 2Q8TA 1SNMA 3LWUA 5EKIA 1I6HB 1FD7D 1LTSD 1JOQA 2K5DA 4ABNA 1Z7TA 3M7GA 3NTHA 5M3FB 2JSOA 3VA5A 1LV9A 4FF1A 3A7LA 3MXUA 3C2PA 1TWAB 2VNUD 4IZ8A 1DOKA 2SOBA 3GTLB 1D5XC 1OO9B 5I2YA 3S1QB 2PZTA 4RKBA 1H9KA 4FF4A 1S5DD 3MFYA 1HUNA 5HGTA 3P1HA 3DWQA 3QWNA 3G7LA 1SNCA 3TSSA 4M1UB 1STEA 2NTSA 2NVYB 3D4WA 5CV6A 3HOVB 4OHJA 5IGGA 4K5VA 4K2LA 4KY5A 2QDBA 1B50A 4WFN3 3NXWA 3V96A 1SE2A 3JAME 4X3SA 4KKUA 1VF7A 2JP1A 3CQZB 1Q3LA 1VCIA 2RQXA 3R2IA 2PPBC 3HGBA 3K57A 2JA8B 3VR4A 2F0NA 4NKLA 5E3FA 1SYBA 4B9XA 1HTPA 2RDFA 3D4RA 5EKKA 3GV3A 1DCZA 1EL0A 4DU9A 5G3LD 2MP1A 3D31A 1DD2A 1D2BA 3T13A 3BDOA 2PNRC 1TT2A 1SE3A 1BBXC 2FJ2A 2L55A 1R4PB 3Q23A 1GHJA 2KHSA 2NVQB 1EIHA 3URYA 3MXGA 3PUWA 2WKDA 3J7AF 4RGNA 3G6JB 1LO5D 1BCPF 5C6AA 2D5DA 5M5YB 1F9PA 1JR0D 4ZK9B 4CJ0B 5CMDA 2EY6A 4RFBA 2NZ1D 1OXXK 3NK9A 4M8AA 3D4DA 1ZXTA 2DNEA 2F0MA 1S4ZA 4B9WA 5C0XH 1B4OA 1STNA 1LLRD 1PLFA 3C3LA 5C4XB 1WCMB 1X32A 4ZUIA 4RGOS 4QUCA 1O7YA 1TS5A 3HOYB 4CGYB 3GP7A 3MXNA 5M9OA 1QOHA 5CORA 2EYJA 3QIAA 3NP8A 1EY8A 1C48A 2AUKA 4A3JB 3EROA 2YU9B 5JEAG 1AP0A 4U673 2EYLA 2F0IA 2F4IA 2KOLA 2LS01 1EU3A 3NBHA 5M3MB 1Z6HA 1BCPB 2RSNA 1Y8NB 2KCNA 5D14A 3NHHA 4J1MA 3RZOB 2IL8A 2B2YA 4LJZC 2AQ2B 2XWBB 4DNTB 2ZT9C 4HCSA 1DONA 4LAAA 1IW7D 1PTOH 3H6MA 3A55A 2A6ED 3VYTA 5I2XA 1K8OA 1WD1A 1XXGA 2PMZB 4V0BA 1A2UA 4C3HB 1I4HA 3NTKA 4G7OC 2F0TA 1FNWA 2ZXOA 3I3CA 3EQLC 2MUYA 5FLXL 2F0LA 3IAYA 2RSOA 4BY7B 2XVSA 4IUTA 1HCZA 1B9MA 2I07B 1HUMA 2HDMA 2F0QA 1RTOA 1PFBA 2IX0A 2F3VA 2V4DA 3SEBA 3BZDB 1D5ZC 1A6XA 1BOSA 3UI2A 5ISRA 1MI2A 4H0LC 1NAPA 1IHZA 1MD2D 5D3DA 3OHXC 4HTHA 1TY0A 1GXDC 1HHVA 3N6RA 2BE5C 3MHBA 4KKTA 1NUCA 5EKLA 1Y8OB 4ULLA 2AWNA 1GUNA 4RGMA 1HQRD 5COYA 4RCOA 4H44C 1PZKD 4ZRZA 5JPNC 1ENCA 2NVXB 1O7LA 3I8ZA 2PYKA 4DGZA 2ENBA 1I6VC 1STHA 4C56C 3V05A 1KLGD 4WORA 1IKLA 1TKWB 2JA5B 5C3XA 2EJMA 3BDCA 4FYDA 3QO2A 1YNNC 4DK0A 4KKSA 3SHLA 2XIWA 1Y1WB 5EGTA 1S5FD 2A6HD 4C3JB 3CKIB 4UAIA 4S3SA 4BWGB 5IGCA 3OW7A 2NYZD 4BA1I 3KF8A 2R93B 4K8JA 4TKOB 4PMCA 2M9VA 1DXMA 3V2TA 2NWGA 3SK8A 1U4PA 5ELCA 5CV8A 1HA6A 3PUYA 5AFWA 2PW5A 5JJZA 3FPUB 5FO9B 1M4VA 4KY6A 1HXYD 2F0KA 2C5CA 3KLSA 1F2YA 5I9PA 1S5BD 3PV0A 5C44B 1GUOA 5I6YA 2ZXPA 4HMJA 1U4MA 1NR2A 1V1OA 3OIPA 1E2WA 4K8IA 4J6HA 4JBWA 3MA2B 3IL8A 5K5PA 4XTCS 2B63B 2F1MA 5HURA 3ZYYX 4FNFA 2F0UA 4RWSC 4MN3A 1A2TA 5M5XB 2B39A 5ELDA 3D6CA 1LT4D 1VF5C 3TP6A 2SEBD 4KTAA 1AZQA 3HG9A 5CV9A 4ZAIA 3C1EA 1EFID 1MGSA 1G8ZD 3GO5A 3KBGA 2VXWA 4YIJA 1VMCA 3W3AA 1HFGA 1STAA 5JEAH 1G91A 4XDXA 1Q90A 3X3MA 3RD4A 5CV4A 3W2DA 2DN8A 3L7ZC 1TVXA 3OOCA 1V8QA 2L0CA 4MIUA 3NQIA 1F2MA 2R92B 4XYOA 3GTPB 3VR2A 1Y1VB 3OWFA 5CGKA 3GTQB 4FF3A 5BN4A 4BY1B 2K6AA 4K2KA 2B2WA 2I46A 2JEAI 1SNOA 1PXUA 3PO2B 1TS3A 5I4DA 1QB5D 1LABA 1GUWA 1ET9A 3LX0A 1LTBD 2HUGA 5DNFA 2B8FA 1RKNA 2NN6I 5EPKA 4UDUC 4EQPA 3HS0C 4QUFA 4RKLA 3FKIB 2IW3A 4HSPA 3TDQA 2IWHA 4K5WA 3TP8A 2X6GA 3MTSA 1WTRA 1I4QA 5FO8B 1KTKA 4KMUC 1F9QA 1GOZA 2K1BA 3U9SA 1PZID 1O80A 2PO4A 3TN2A 3S1MB 1KAAA 4Q5VA 3J7YW 4IN3A 3PIO3 4J8QA 3KUPA 1PRTC 5BN5A 3VYUA 5J1ZA 5EQ0A 1PTOF 2G9HD 2QCPX 2FINB 1EWHA 3ND8A 1H9MA 4KY7A 2CQAA 4DAYA 1EQTA 5IOCA 1Q8IA 4KHZA 4ODGA 2EYOA 2A73B 1L0XB 3NQTA 2ICIA 2RA4A 2RBMA 1R9TB 5JAVA 1VMPA 3NUCA 5ELEA 1BDOA 3TP5A 5KEEA 3WOFA 1H9SB 1FYCA 1Q12A 1CA6A 1EWCA 5LHY1 4KD3A 2WINB 3CHBD 3TP7A 4A3IB 3R8BA 5CBEE 3EFXD 4C3IG 1CT1D 2PCFB 1PTOB 2F03A 3M7NA 1X3QA 1LTAD 4RHRA 1AFPA 1HPCA 1G2SA 3OSOA 4HR7B 4QMGA 3J80L 4G7HC 1CQFA 3P75A 1BF4A 3MWYW 2DY7A 4RCNA 3TZDA 5FOBB 1SYFA 1SFOB 4K14A 3E0JA 5C4ZA 1LTID 3QG1A 2L12A 3S14B 4FXKC 3WOEA 1R4QB 1T5XD 2DNCA 5ELFA 1EQVA 1WVLA 1LTTD 1OXTA 4EGVA 1AN8A 1FR3A 1TS2A 4H13C 4N9TA 5G3LF 3SR1A 2PZUA 3E5SA 1B2TA 1SYDA 2F3WA 2F0DA 1HA5A 4IALA 1JB3A 4BA2I 3HOXB 1ENFA 5FLXE 1RCVD 4LK1C 2KJXA 2C9OA 4H7BA 4RGTA 3EVQA 1RDPD 5IT9L 3BDLA 3VA7A 5I9OA 1RHPA 1BNZA 2KCCA 3I73A 4OIJA 5KYLA 3EJIA 1GHKA 2BE5D 2F0WA 1ZYRC 1TWHB 2LMCB 4Q0FA 1I4PA 5DM73 1CA5A 3HKZB 3OWEB 4DAPA 1QILA 2BA1A 1GJXA 4F87A 3H94A 5IGDA 4XQNA 1BXTA 3I70A 2K01A 1EEID 5K36H 4A3GB 5M5WB 1H9RA 2D9UA 4BBRB 2KVMA 5C4JB 5FK9C 3M3YB 4ZKBB 1SJED 1D6EC 2AQ3B 2SNSA 2NUCA 1UAPA 2FHTA 2TSSA 2BDNA 1YNND 2B2YC 4XT1B 2NN6G 4ZQ3A 5C0XJ 1JOKA 4DK1A 1PDQA 3F2UA 4F7XA 1CZWA 3T16A 4C1NK 1H9SA 1KNEA 1EY9A 3HOUB 1G6ZA 1JORA 2GA4B 2LKVA 2KQ3A 4JK1C 2RKSA 1FNUA 2E2DC 2L5TA 1QE6A 4B08A 5TSSA 1Z47A 3RUZA 4G57A 3ITPA 3GQBA 2KUMA 3Q22A 2EY5A 1OXVA 1KABA 1U9RA 4ILWA 2Z1CA 4DNRB 1ICWA 4QIWB 3M4YA 4FVMA 4P2CB 3NE5B 5CC4A 1NR4A 4IFDH 3DEPA 4DF7A 4ZUJA 2NB0A 3PO3B 3MFGA 1D5MC 1IKMA 4C1NI 2WACA 4OO1I 4PV1C 2WP8J 2B2VA 2F0FA 3S2DB 5NUCA 4IFDJ 2PW7A 1EY6A 4PNYA 3VYSA 2JA6B 3GTGB 3AMUA 2EJGC 4NMZA 1WTXA 3I90A 1I4GA 3C1FA 4A3FB 2CW0C 2EE1A 5EBCA 2WAQB 1RJTA 3K58A 1HRJA 1SBBB 2F0JA 4HMIA 1Y8PB 3VR5A 2XRSD 2F0VA 1SJHD 2EYMA 3FPPA 1JWSD 3RMHA 4DA2A 1WTWA 5KYIA 3K0YA 3PUZA 2XRQD 4L6TB 1WD0A 5J39A 2EYPA 1TQOA 1SE4A 3HRZC 1DOLA 1BCPC 3GV6A 1I50B 1CQVA 1SEBD 3I91A 4TQUS 1PFMA 1CHPD 5KNCA 1F2ZA 5C4HA 2TMPA 1G2TA 2B2UA 2Q8RE 5ELBA 3TZUA 3VR6A 3AB9A 2BDOA 4HCEA 1DM0B 1JCKB 5EPJA 3L9AX 3FEWX 2J4XA 2EJFC 4PMWA 1SDFA 4A3KB 3K59A 3QJYA 4ZKCB 2AQ1B 1TIID 1YNJC 1CTMA 1V1PB 2O2LD 5CV7A 3I4MB 3LWEA 3GTJB 3S17B 1PRTD 3M85A 2XNAC 5CV5A 1PZJD 3NWTA 3KBXA 1C4QA 1U4RA 1V43A 2EY2A 1O7ZA 2NTTA 1HFNA 4KN4C 5D3IB 3NPPA 3DWPA 3D6WA 4EQNA 4R9WA 1II3A 2E74C 2MGSA 1JWMD 3CRKC 4OIKA 2KECA 2PZWA 2J7ZA 3ERQA 1NCVA 1A3UA 2D62A 4Y7NB 2K03A 1HTLD 2NN6H 1EOTA 5E4WC 1S5ED 3GTOB 3A7AB 2B2WC 2EXZA 2N88A 3H91A 1DOMA 1FNVA 5FO7B 3FMCA 1JOOA 2M00A 1HQMC 4RHSA 1J8IA 4KV6A 3ONAB 4IUQA 1G291 2RVLA 3H09A 5JEAJ 4K6DA 3T51B 3MAQA 4N9PA 1DJRD 1TY2A 1PFNA 1LT6D 1I4RA 1UEAB 4OO1G 2XWJB 1B53A 3Q6SA 3J80E 1L0YB 5J22A 1EZ6A 2E2JB 2HCCA 2F0GA 3BYTB 5CYUA 2VUMB 3BS1A 1EY7A 2DY8A 1UUPA 2FMMA 3J7AV 2EZVA 4I65A 4A3MB 4KJOA 3A54A 4NP5A 1E2ZA 4OL7A 2F0EA 1OXUA 3CRLC 1JQYD 1CHQD 1TS4A 4FO2A 1ILPA 4BBSB 2PQEA 1V1PA 2Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSO A;  3IFD A;  1DOK A;  2KUM A;  1WTP A;  4IUT A;  2L4N A;  2K03 A;  2R3Z A;  2NZ1 D;  1CM9 A;  3P7J A;  3I91 A;  2B2U C;  2JYO A;  2NWG A;  1EOT A;  1F9S A;  5E4W C;  1B3A A;  1ICW A;  1U4P A;  1HUM A;  1PFM A;  2B2W C;  2K04 A;  1ZXT A;  2HDM A;  4DN4 M;  4ZK9 B;  2EOT A;  1RTO A;  1PFB A;  2RA4 A;  4X3T A;  1XX8 A;  1HA6 A;  1HUN A;  2N88 A;  2X6L A;  5AFW A;  3H91 A;  1S4Z A;  4CJ0 B;  5JJZ A;  1VMP A;  2B2T C;  3FPU B;  2B2U A;  1NR4 A;  1DOM A;  1B4O A;  1RHP A;  4O42 A;  3G7L A;  1PLF A;  3UI2 A;  1BNZ A;  1MI2 A;  1MSH A;  1QG7 A;  3DEP A;  4OIJ A;  4IUV A;  4U68 A;  2B2W A;  4X3K A;  5CBA E;  1ILQ A;  2Q8R E;  1AZP A;  1NAP A;  2SDF A;  2B2V C;  1X32 A;  5E4X A;  5EPL A;  1CA5 A;  4QUC A;  2MJ8 A;  1ROD A;  1CA6 A;  1IKM A;  1O7Y A;  1J8I A;  5EPJ A;  3ONA B;  4IUQ A;  5T1I A;  4HAE A;  1A15 A;  1B50 A;  4XT3 B;  2B2V A;  1SDF A;  2HDL A;  5COR A;  1JIC A;  2RVL A;  3HP3 A;  1GUW A;  1BO0 A;  2K01 A;  5CBE E;  2HUG A;  3GV6 A;  1HHV A;  1J9O A;  3SVM A;  1U4M A;  4X3S A;  1NR2 A;  2JP1 A;  2MPM A;  2N55 A;  5DNF A;  1Q3L A;  4ZKC B;  5EPK A;  2L11 A;  2CVR A;  1AP0 A;  2D9U A;  3IL8 A;  4QUF A;  3DEO A;  4IUP A;  4HED A;  1PFN A;  1X3Q A;  2M2L A;  2KVM A;  2H1E A;  1G2S A;  2KOL A;  4NW2 A;  2B2T A;  5COY A;  4R8I A;  2L9H A;  2X6G A;  3MTS A;  3LWE A;  4RA8 A;  3N52 A;  4ZKB B;  1B53 A;  3Q6S A;  1WTR A;  1QNK A;  4RWS C;  4MN3 A;  1WTX A;  2KEE A;  2EPB A;  3I90 A;  1F9R A;  1F9Q A;  2K1B A;  5EJW A;  4CJ2 C;  1WTV A;  1IL8 A;  2RSN A;  3MWY W;  1BF4 A;  2FHT A;  4IUR A;  3I8Z A;  2BDN A;  1O80 A;  1F2L A;  2DY7 A;  2K28 A;  3GV3 A;  1DZ1 A;  2EE1 A;  4ZLT F;  3KBX A;  4IUU A;  5D14 A;  2B2Y C;  4XT1 B;  3TN2 A;  2HCC A;  1U4R A;  1RJT A;  1X3P A;  2FFK B;  3TZD A;  1MSG A;  1EL0 A;  1PDQ A;  1XYI A;  3F2U A;  1G2T A;  1AZQ A;  2MP1 A;  1U4L A;  2HCI A;  1HRJ A;  2L12 A;  2IL8 A;  4ZAI A;  2Q8T A;  2B2Y A;  2DY8 A;  2L1B A;  2FMM A;  1MGS A;  3DM1 A;  1O7Z A;  1KNE A;  4HSV A;  3KUP A;  4X3U A;  3R93 A;  1SAP A;  5EKI A;  1JE4 A;  1ESR A;  1IKL A;  1M8A A;  4CJ1 B;  1WVL A;  1G6Z A;  1HFN A;  1WTQ A;  2VXW A;  1WTO A;  1RTN A;  4HCS A;  5EQ0 A;  1DON A;  3FDT A;  2FIN B;  3QO2 A;  1VMC A;  2FJ2 A;  2K05 A;  1BBX C;  1E0B A;  1KNA A;  3D6W A;  1SSO A;  4RAU C;  1HFG A;  2XIW A;  4R9W A;  4MHE A;  4XDX A;  1G91 A;  2MGS A;  2X69 A;  1WTW A;  1WD1 A;  1B2T A;  1EIH A;  1EQT A;  1C8C A;  1ILP A;  1LV9 A;  1EIG A;  4OIK A;  4UAI A;  1QE6 A;  1WD0 A;  2KEC A;  4LMQ D;  5T1G A;  1ML0 D;  3I3C A;  5D65 A;  1F9P A;  2NYZ D;  2KED A;  1TVX A;  1DOL A;  2J7Z A;  5CMD A;  1NCV A; 
#chains in the Genus database with same CATH topology
 3S15 B;  4KK7 A;  1ZYR D;  1CKM A;  1AW7 A;  2L4N A;  2A69 C;  2R3Z A;  4FP5 D;  3E9I A;  4IPC A;  1N36 Q;  1N33 L;  2EY1 A;  5A2Q L;  1SYC A;  1JJG A;  2ZTC A;  3RLN A;  1UNS A;  4RH6 A;  4DV0 L;  4L8J A;  4B3R L;  2I5L X;  2X6L A;  3KLR A;  3NBI A;  2ES2 A;  2B2T C;  5IT9 E;  1QWY A;  5LMU Q;  4DR2 Q;  2B8G A;  1MSH A;  1L0W A;  1Y69 U;  2F0P A;  3CAM A;  1VQ9 A;  4WJ3 M;  3HOV G;  3H15 A;  4TSS A;  3UDI A;  2MJ8 A;  3DHQ A;  2D0P A;  3OW2 A;  3SGI A;  1AE3 A;  4HAE A;  5T1I A;  2A68 C;  3E6Z X;  3RN5 A;  3NSW A;  2OTL A;  4OX9 L;  1BO0 A;  2IT1 A;  4C2M B;  3S16 H;  4A3B B;  1Q1B A;  4JI0 Q;  2IX3 A;  1BVS A;  2N55 A;  4JOI A;  5KRU A;  2CVR A;  4TRD A;  2JA8 G;  1LT3 D;  3GTK B;  3SXH A;  4KI0 A;  1SLJ A;  1NMG A;  3HOZ B;  1YJW A;  4NW2 A;  2Q8I B;  2B2T A;  2E2H B;  4R8I A;  1E2V A;  3T53 B;  3PF5 A;  3JAM c;  1SE8 A;  4K0K L;  2KEE A;  1F9R A;  1IL8 A;  4K5X A;  1FL0 A;  4O1N A;  1VQE A;  5KNB A;  1SMY C;  1A3T A;  1TWG H;  4IQZ A;  2EVB A;  4LUZ A;  2QIL A;  2E8G A;  3OMC A;  3H3V C;  2UU9 L;  3J81 L;  3TRZ A;  1KDB A;  1KQS A;  3CC7 A;  3GTO H;  4DAV A;  4DR3 Q;  3R93 A;  3Q0A A;  1SAP A;  3NBH B;  1JE4 A;  1EIF A;  1ESR A;  4JI5 L;  4A4I A;  2JE6 I;  5IYD H;  1WTQ A;  1RD9 D;  3EIV A;  4DAM A;  1UE1 A;  5JOB A;  2XSC A;  3S2H B;  5EAY A;  4P71 A;  2K5Q A;  1TWC B;  1W6K A;  4MHE A;  5GAG C;  4QB4 A;  1D1K A;  4LFB Q;  1D1I A;  1C8C A;  3O13 A;  4X6A H;  3SE0 A;  2F0S A;  2E76 C;  3OPO A;  1LT5 D;  5D65 A;  3TBI B;  3JAM i;  2H5X A;  1BR9 A;  4X65 Q;  3FVQ A;  3T4A C;  1WTP A;  1A62 A;  2ZTD A;  3D3R A;  1XPO A;  1CK1 A;  4DXF A;  2OWO A;  5KGU A;  2EOT A;  1SNQ A;  1XX8 A;  2YTY A;  2QKI C;  3A8J E;  1GUS A;  5EBD A;  5C4X G;  1CKN A;  1LTR D;  1PYB A;  5I6W A;  3A8K E;  1WCM G;  3WDN A;  2QEX A;  1S5C D;  3KLS X;  4JYA Q;  2YYZ A;  3HOY G;  3HOW H;  4J15 A;  3P20 A;  3K7A H;  2O5I C;  3HZX A;  2MQH A;  1MJE A;  1GUT A;  3E0E A;  1JIC A;  2O5J C;  4HIM A;  2OT2 A;  5JPM C;  4A3J G;  3AFP A;  2CW0 D;  4HIK A;  1STY A;  4C3I B;  2L11 A;  4A3M H;  1KLU D;  3I4L A;  2I5M X;  3KOJ A;  1N32 Q;  2IPK D;  1JJ2 A;  4UP7 A;  2F52 A;  3EN2 A;  5CR3 A;  1ASY A;  5M3M G;  1I3Q B;  1Z9F A;  5JVH 3;  3ULL A;  1WTV A;  3L0O A;  4BBS H;  1XWE A;  1GUG A;  4IUR A;  1IYV A;  2K28 A;  1W6J A;  4ZLT F;  4DV6 L;  4LWC A;  3K5O A;  1YVC A;  4IUN A;  1SXT A;  1X3P A;  1MSG A;  3S15 H;  1VQA A;  4DV3 L;  1HR0 Q;  1U4L A;  4JI7 Q;  2ZM6 Q;  2L1B A;  1BBW A;  3DM1 A;  2E75 C;  4YCU A;  2R7Z H;  1JWU D;  1M8A A;  1BCP D;  1HNW L;  1IBM L;  1RTN A;  3MXP A;  4G7Z C;  1EWI A;  1RF2 D;  2IJ0 A;  1PTO C;  3CU7 A;  4B3S Q;  2ICE C;  1ONL A;  4C3H G;  4JI1 Q;  2QF7 A;  4DUY Q;  5DEH A;  3SK5 A;  1EIY B;  1KD1 C;  4OO1 H;  1SYG A;  1NSN S;  3BJU A;  5T1G A;  1ML0 D;  3QOJ A;  2KED A;  4GKK L;  4Y52 H;  4BY7 G;  4EQO A;  2C35 B;  4C2M H;  1SNP A;  3CCL A;  4A3B H;  4DR6 Q;  4A93 H;  3IFD A;  3BVM A;  4HIO A;  2ASB A;  1F9S A;  3K5N A;  1PH4 A;  1VQ8 A;  3C46 A;  4FF2 A;  4DR5 L;  1K3B C;  4CDC C;  1B8A A;  1E1T A;  1K83 B;  3A5Z B;  3F8T A;  2E2H H;  1VQJ A;  2UUC Q;  1I6H H;  1LTL A;  4U68 A;  3DM3 A;  4ME5 A;  1ILQ A;  2LY7 A;  4E6I A;  4GZY C;  3QB3 A;  2B2V C;  5E4X A;  1KRT A;  1YNJ D;  5M3F H;  1K0R A;  4XYQ A;  2G5D A;  4WRD A;  1IYU A;  4O2D A;  4B3T L;  1RL2 A;  1LAC A;  3JAM L;  1TU2 B;  3VR3 A;  1EU4 A;  2BOS A;  2AKW B;  4UY8 C;  4ID6 A;  1ZKO A;  4XIG S;  1TWA H;  2MPM A;  1E7Z A;  2IX1 A;  3MC0 B;  5A35 A;  1YEZ A;  1QVC A;  3MEH A;  4HED A;  2D2C C;  2M2L A;  2VB3 X;  3AU7 A;  3PUV A;  2CH4 A;  3GD7 A;  5C0X I;  3BVG A;  3T56 B;  3X3N A;  2BH2 A;  4QCL A;  3EA6 A;  2Q2U A;  4IPH A;  1HNX Q;  1SND A;  2I5H A;  4CJ2 C;  2AWO A;  1EYG A;  4CKB A;  3M4O B;  4IUU A;  4X64 Q;  2NVY H;  1WTO A;  2QEJ C;  1GO3 E;  4JI6 Q;  4XQQ A;  3NTI A;  4JI2 L;  3HEJ A;  1JB7 A;  3K8A A;  5JVG 3;  4L63 B;  1EQR A;  4X3U A;  3DXJ C;  3S1R B;  5KIX A;  2Y0S B;  2JA5 G;  1N34 L;  1XNQ L;  2MHV A;  1N33 Q;  4KD4 A;  4POG A;  4GKJ Q;  2K5N A;  3FDT A;  3DMU A;  3BG3 A;  4DV0 Q;  1Y1W G;  1E0B A;  3OIQ A;  4RAU C;  4B3R Q;  1C0A A;  4GNX C;  2H4O A;  3DUZ A;  4C3J G;  2JA8 H;  4BXX G;  2K5W A;  4CKC A;  2ZJQ A;  2WKC A;  1U0L A;  1K8M A;  4XXE A;  1EIG A;  4LF8 L;  5LL6 X;  5IYB H;  2RF4 A;  1TWF B;  4BS9 A;  5C5L A;  1PYW D;  2ZJP A;  2DUD A;  3P7J A;  1CM9 A;  1M90 C;  3RZD B;  2JA7 B;  3H0G B;  2B2U C;  2JYO A;  5C3E B;  3NWS A;  4C3I H;  2JEB I;  3PUX A;  2ID0 A;  4KHV A;  2K04 A;  3SK6 A;  4DV4 L;  4X3T A;  3CC4 A;  1O78 A;  4HJ7 A;  3D8G A;  4O42 A;  2WII B;  3I72 A;  1XTC D;  1CZG A;  1QNU A;  5CBA E;  5IOD A;  1EY4 A;  1EYC A;  1I3Q H;  2RDG A;  4IFD I;  2R61 A;  4AQY L;  5C44 G;  4K0K Q;  3QOL A;  1A15 A;  2N78 A;  2VB2 X;  5BN3 A;  1IBL L;  1HH2 P;  1PMR A;  1QCB D;  1TR5 A;  2JXM B;  2EDG A;  1ICF B;  2J0T D;  1EYA A;  2MO1 A;  2MFI A;  2UU9 Q;  3RLO A;  2NBF A;  4IJH A;  5IGB A;  3CCM A;  3W1G A;  2E2I B;  5E1F A;  2B63 G;  4JI5 Q;  1EY5 A;  1SN8 A;  2Z4H A;  1LUZ A;  1STG A;  2L9H A;  5F2D A;  1VQF A;  4FXG C;  4CKE A;  1HR0 W;  3PMF A;  4DFA A;  2UUB L;  4XQJ A;  3K6O A;  4NXM L;  2FFK B;  4IPD A;  3HOY H;  1V1Q A;  1ET6 A;  1PFS A;  5GAD C;  2KA7 A;  4H02 A;  1CI3 M;  1PRT F;  4HSV A;  4ZYS A;  1EZ8 A;  3TS0 A;  4CJ1 B;  1QZG A;  3OMG A;  2F3I A;  4A3J H;  2AUJ D;  3S9W A;  2YU9 H;  1ENA A;  2K05 A;  2A69 D;  1SSO A;  5C5M A;  2NVT B;  4QF4 A;  1GD7 A;  4PZ7 A;  1EEF D;  2X69 A;  1KDC A;  2A19 A;  3DWA A;  2EYH A;  4B3M L;  1PVO A;  3S16 B;  4LMQ D;  1DYQ A;  1EFW A;  5M3M H;  2PI2 E;  3TQY A;  1FGB D;  5LL6 S;  2Z0S A;  2Z6K C;  4CHT B;  4OWX B;  1A3V A;  2R92 G;  3CF5 A;  3UE0 A;  1C7Y A;  1IW7 C;  2UUA L;  3U9O A;  2A6E C;  1X55 A;  4PQX A;  4GOP B;  1B3A A;  3RZO H;  2VL6 A;  1Y1V G;  2R6G A;  4KN7 C;  4DN4 M;  2A68 D;  5A2Q E;  2I0Q A;  1SYE A;  5IGF A;  3FRP B;  2A74 C;  4BY1 G;  4DAY B;  2Z4I A;  1X65 A;  1EYD A;  1F77 A;  4AH6 A;  2QA4 A;  1QG7 A;  1X3F A;  2CFM A;  2G9D A;  4X3K A;  4IUV A;  3PO2 G;  4ZCK A;  4A3D B;  2SDF A;  1CFM A;  4G4K A;  1JC7 A;  1NE3 A;  1ROD A;  3BYY B;  1TWG B;  4MNO A;  4GN4 B;  2WV6 D;  1L1O A;  5FLM G;  1B44 D;  4C3H H;  1CSP A;  2HDL A;  3AFQ A;  3CCQ A;  4DV6 Q;  5C3W A;  1RIP A;  4NDX A;  4A3C H;  1BQQ T;  1PRT B;  4AYB E;  3SVM A;  1VQ6 A;  1EY0 A;  3CC2 A;  2XN9 C;  4DV3 Q;  3RLF A;  4BY7 H;  5IP7 H;  3SK4 A;  1XTD A;  3KYH C;  1SMY D;  2HQE A;  3FKI G;  1MJC A;  2B29 A;  3DEO A;  4IUP A;  2XTI A;  2H1E A;  4AYB B;  1T9H A;  3MVV A;  1HNW Q;  1IBM Q;  4CBV A;  2BCO A;  3N52 A;  3LNN A;  1VQG A;  2F0O A;  5DAU A;  4A3E B;  1KDA A;  4DV1 L;  2WB1 B;  4F8M A;  1DZ1 A;  1MBY A;  4PZ6 A;  4R8N A;  5H1S E;  2ZJR A;  1XMO L;  1PH5 A;  3CCJ A;  1TWF H;  3I4N B;  4FXD A;  3Q24 A;  5JJL A;  4GKK Q;  5K36 G;  3RZD H;  2HCI A;  5DM6 3;  3H0G H;  3J81 E;  5C0X G;  2EYF A;  3PSI A;  4JPB W;  1LTG D;  1QJO A;  3K5M A;  4K6L A;  2O4X A;  4YCV A;  3KK7 A;  1STB A;  4LFA L;  1C9O A;  4R4I A;  4WJW A;  2RDH A;  2IHF A;  3M9B A;  1KNA A;  4DR5 Q;  3HOW B;  3I56 A;  3K7A B;  2A5H A;  2EQS A;  3TME A;  3R3O A;  3K0X A;  2SNM A;  4PMB A;  2EPB A;  1VDZ A;  2K32 A;  3IFT A;  3A56 A;  2LFN A;  4F88 A;  4Z9C B;  4FDB A;  4OGQ C;  1D7Q A;  1VQK A;  4APV A;  4WJ4 A;  4DR7 L;  2A6H C;  2FMC A;  3GTM B;  2OTJ A;  2CHB D;  5FKA C;  1KHI A;  1I4X A;  3L3O C;  1B9N A;  1BUV T;  1B1Z A;  2K7V A;  3IKJ A;  1ZEQ X;  2JA5 H;  4KJN A;  4JI6 L;  5KND A;  3K5L A;  1AZP A;  1LYL A;  3G71 A;  1VQI A;  5EPL A;  3K80 C;  5IIF A;  3M4P A;  4C3J H;  4A3I G;  2BA0 A;  4XT3 B;  5HGQ A;  4BXX H;  4I7Z C;  4JOI C;  3I2Z A;  3S1N B;  3HP3 A;  4GKJ L;  3ND9 A;  1VQ7 A;  1X3E A;  2K52 A;  2R7Z B;  1J9O A;  1H9J A;  4DXG A;  4HN7 A;  1X9N A;  4LF4 L;  4JI2 Q;  2ZXR A;  1OXS C;  3JC6 6;  1OTC A;  1Q1E A;  4LF9 L;  5IGE A;  4EVO A;  4IFD G;  1T5E A;  3BVZ A;  1N34 Q;  1XNQ Q;  1EQQ A;  2UXB L;  1N8R C;  3ICE A;  4V19 0;  2NVT H;  3PIP 3;  3B6Y A;  2K5V A;  2OXP A;  4RA8 A;  3SDZ A;  1QNK A;  2OF1 A;  3VYR A;  4DV2 L;  1MKH A;  4GOP A;  5EJW A;  1AEX A;  4DPG A;  2IHE A;  2BH8 A;  1F2L A;  1A0I A;  2RHQ B;  3UE1 A;  4A93 B;  4UPA A;  3R2T A;  3KLW A;  1PTO D;  1ESF A;  3A8I E;  2K33 A;  2OEO A;  3MZ5 A;  1XYI A;  4LF8 Q;  2F0H A;  2B3G A;  5C44 H;  2Q8T A;  1SNM A;  3LWU A;  2K14 A;  2UXC L;  5EKI A;  1I6H B;  1FD7 D;  1LTS D;  3LGJ A;  3K7U C;  1JOQ A;  2K5D A;  4ABN A;  1Z7T A;  3MXN B;  4DV4 Q;  3M7G A;  3NTH A;  5M3F B;  2JSO A;  4A3D H;  3VA5 A;  1GKH A;  5BR8 L;  2B63 H;  2VQE L;  1LV9 A;  4UP9 A;  3E3X A;  4FF1 A;  3A7L A;  3MXU A;  3TRE A;  3HOX G;  3C2P A;  1WOC A;  2A8V A;  1TWA B;  4AQY Q;  2VNU D;  4IZ8 A;  3ULP A;  1DOK A;  2SOB A;  1PH2 A;  3GTL B;  1D5X C;  1OO9 B;  5I2Y A;  4R4C A;  3S1Q B;  1WI5 A;  2PZT A;  4RKB A;  1IBL Q;  1H9K A;  4FF4 A;  1S5D D;  3MFY A;  1HUN A;  1IL2 A;  5HGT A;  2AHO B;  3P1H A;  3DWQ A;  3QWN A;  3G7L A;  1SNC A;  3TSS A;  3CXC A;  4M1U B;  1STE A;  2NTS A;  5FLX c;  3I4O A;  2JN4 A;  3HKZ G;  2CWP A;  4A3E H;  1VQM A;  2NVY B;  3D4W A;  5CV6 A;  3HOV B;  4OHJ A;  5IGG A;  4K5V A;  4K2L A;  1JMC A;  3CPF A;  4KY5 A;  3AEV A;  2QDB A;  1B50 A;  4WFN 3;  1SRO A;  3NXW A;  2UUB Q;  3I4N H;  3V96 A;  1SE2 A;  3JAM E;  4A3G G;  4NXM Q;  4X3S A;  1HZ9 A;  1VF7 A;  2JP1 A;  4KKU A;  3CQZ B;  1Q3L A;  4IO9 A;  1VCI A;  4BBR G;  2JK8 A;  2RQX A;  2R92 H;  3R2I A;  1GVP A;  2PPB C;  3HGB A;  3K57 A;  2DJG C;  2JA8 B;  3VR4 A;  2F0N A;  4NKL A;  1Y1V H;  1QVF A;  5E3F A;  3CP0 A;  3MEF A;  1SYB A;  3GTQ H;  4B9X A;  1HTP A;  2RDF A;  5JJK A;  3D4R A;  5EKK A;  3S24 A;  3GV3 A;  1JE5 A;  1DCZ A;  3PO2 H;  1EL0 A;  4DU9 A;  2HD3 A;  4B3M Q;  5G3L D;  3H3V H;  2MP1 A;  3D31 A;  1DD2 A;  1D2B A;  3U58 A;  2PNH A;  3HOU G;  3T13 A;  4DV5 L;  1KL9 A;  1XNR L;  3GTM H;  3BDO A;  1NMF A;  2UUA Q;  2PNR C;  2Q2T A;  1KAW A;  1TT2 A;  4JBK A;  1IBK L;  1SE3 A;  1BBX C;  2FJ2 A;  2L55 A;  1R4P B;  3Q23 A;  1GHJ A;  1SMX A;  2KHS A;  2NVQ B;  3PF4 A;  1EIH A;  2HQL A;  3URY A;  3MXG A;  3PUW A;  1VQH A;  2WKD A;  3J7A F;  4RGN A;  3G6J B;  1FJG L;  1LO5 D;  1BCP F;  4GN3 B;  5C6A A;  3KJP A;  2D5D A;  5M5Y B;  1F9P A;  2NZO A;  3Q8D A;  1JR0 D;  3AQQ A;  4ZK9 B;  5CMD A;  4CJ0 B;  2A1A A;  3S1N H;  2R7D A;  2EY6 A;  4RFB A;  2NZ1 D;  1OXX K;  3NK9 A;  3KJO A;  4M8A A;  2HT1 A;  3D4D A;  1ZXT A;  1Q86 C;  1XPU A;  2DNE A;  2F0M A;  1S4Z A;  1K8A C;  3RNU A;  4B9W A;  5C0X H;  1B4O A;  1STN A;  1LLR D;  1PLF A;  3C3L A;  2CWA A;  3T1Y Q;  4DUZ L;  3PO3 G;  4GNX B;  1VQD A;  5C4X B;  2P5Z X;  1WCM B;  1X32 A;  4ZUI A;  2JQO A;  4RGO S;  4QUC A;  4JG2 A;  1O7Y A;  1TS5 A;  3HOY B;  4CGY B;  3GP7 A;  4DV1 Q;  3MXN A;  5M9O A;  1QOH A;  3G4S A;  5COR A;  2EYJ A;  3QIA A;  3NP8 A;  2VS1 A;  1XMO Q;  1EY8 A;  1VS0 A;  1C48 A;  2AUK A;  4A3J B;  3KDF B;  3ERO A;  2YU9 B;  2JA6 G;  5JEA G;  1CSQ A;  1AP0 A;  4U67 3;  2EYL A;  2F0I A;  2F4I A;  1W2B A;  3TEH B;  1B7Y B;  2KOL A;  4R4Q A;  1VQL A;  2LS0 1;  3KF8 B;  1EU3 A;  2L15 A;  4P73 A;  3NBH A;  4LFA Q;  1R9T H;  3PIP A;  1E24 A;  2K4K A;  2XGT A;  5IP9 G;  4A3F G;  3W1B A;  5M3M B;  1Z6H A;  1YHA A;  1BCP B;  3DLL A;  2RSN A;  1Y8N B;  2LSS A;  2WAQ G;  1K8G A;  2KCN A;  5D14 A;  3NHH A;  4HJ9 A;  4J1M A;  3CCE A;  3GTL H;  3RZO B;  4A3I H;  3S1Q H;  2IL8 A;  2B2Y A;  4LJZ C;  2AQ2 B;  2XWB B;  2HHH L;  2PMZ E;  4DNT B;  5HY6 A;  2ZT9 C;  4HCS A;  1DON A;  4DR7 Q;  4LAA A;  1IW7 D;  1PTO H;  3H6M A;  3A55 A;  2A6E D;  3VYT A;  5I2X A;  1K8O A;  1PV4 A;  1WD1 A;  1XXG A;  2PMZ B;  4V0B A;  3HOV H;  1A2U A;  4C3H B;  1I4H A;  3NTK A;  4G7O C;  2F0T A;  1FNW A;  2ZXO A;  3I7F A;  3I3C A;  3EQL C;  4LF7 L;  2MUY A;  1W3S A;  5FLX L;  2F0L A;  3IAY A;  2RSO A;  4BY7 B;  2XVS A;  1YBY A;  4IUT A;  1HCZ A;  4JI4 L;  3CQZ H;  1B9M A;  2I07 B;  1HUM A;  2HDM A;  2HIX A;  2F0Q A;  4LF4 Q;  1RTO A;  1PFB A;  2IX0 A;  2F3V A;  2V4D A;  4JW0 A;  3SEB A;  3BZD B;  3S14 H;  1D5Z C;  1A6X A;  1BOS A;  3UI2 A;  5ISR A;  4LF9 Q;  4OEM B;  1MI2 A;  3ULJ A;  4H0L C;  3CCS A;  4CDD C;  1NAP A;  3FHW A;  2UXB Q;  1IHZ A;  2R93 G;  1E22 A;  1MD2 D;  5GRO A;  2CCZ A;  4DV2 Q;  5D3D A;  3OHX C;  4A3K G;  1V9P A;  4HTH A;  3UDF A;  1TY0 A;  1GXD C;  1HHV A;  3N6R A;  1P16 A;  2BE5 C;  3MHB A;  5DLQ E;  3A5U A;  1Q82 C;  1CKO A;  1HNZ L;  4KKT A;  2ZTE A;  1NUC A;  2UXC Q;  5EKL A;  1Y8O B;  4ULL A;  3STB D;  4QL5 A;  3I4M G;  2AWN A;  1GUN A;  4DK6 C;  4RGM A;  1HQR D;  5COY A;  4RCO A;  4H44 C;  1PZK D;  4ZRZ A;  1A8V A;  4N8X 1;  5JPN C;  1ENC A;  2NVQ H;  4A3L G;  2NVX B;  1O7L A;  3J7Z C;  3I8Z A;  1TWH H;  1PH6 A;  5M5Y H;  1I94 L;  4DV7 L;  2PYK A;  5BR8 Q;  2YTV A;  2VQE Q;  1J5E Q;  1K28 A;  1UE5 A;  3U50 C;  5E7N A;  4DGZ A;  2ENB A;  1I6V C;  1STH A;  3W5O A;  5LMN L;  4C56 C;  3V05 A;  1KLG D;  1KRS A;  4WOR A;  1IKL A;  1TKW B;  2JA5 B;  1EOV A;  5C3X A;  4A3G H;  1HZB A;  2EJM A;  3BDC A;  4FYD A;  3QO2 A;  1YNN C;  4DK0 A;  4KKS A;  3SHL A;  2XIW A;  5C4X H;  1Y1W B;  5EGT A;  1WCM H;  1S5F D;  2A6H D;  4C3J B;  3KDF A;  1K73 C;  3CKI B;  3NEM A;  4JI8 L;  3A0J A;  5AJ3 L;  2PQA B;  4UAI A;  4S3S A;  4BWG B;  5IGC A;  3OW7 A;  2NYZ D;  4BA1 I;  3KF8 A;  2R93 B;  4K8J A;  4TKO B;  4PMC A;  2M9V A;  1DXM A;  3V2T A;  2NWG A;  3SK8 A;  1U4P A;  5ELC A;  5CV8 A;  1K9M C;  1HA6 A;  1LM0 A;  3PUY A;  1UE6 A;  5AFW A;  2PW5 A;  5JJZ A;  3FPU B;  5FO9 B;  1M4V A;  4KY6 A;  2CKZ B;  1HXY D;  4R4O A;  4JVZ A;  2F0K A;  1L1O C;  2C5C A;  1AH9 A;  3CCV A;  3KLS A;  1F2Y A;  1X56 A;  5I9P A;  1S5B D;  3PV0 A;  1XMQ L;  2RCF A;  5C44 B;  4DR4 L;  2LXJ A;  3BZC A;  4N8F A;  1PH9 A;  1GUO A;  1PH3 A;  5I6Y A;  2ZXP A;  4HMJ A;  1U4M A;  1NR2 A;  1V1O A;  3OIP A;  1E2W A;  4K8I A;  4J6H A;  4JBW A;  2EIF A;  3MA2 B;  3IL8 A;  4LFC L;  5K5P A;  2D0O A;  4DV5 Q;  1XNR Q;  2VQF Q;  2YTX A;  1E3P A;  3OTO L;  2NZH A;  4XTC S;  2B63 B;  2F1M A;  5HUR A;  4FNF A;  3ZYY X;  1S72 A;  1IBK Q;  2F0U A;  4RWS C;  4MN3 A;  2EXD A;  1A2T A;  5M5X B;  2B39 A;  5ELD A;  3D6C A;  1LT4 D;  1VF5 C;  4YWK A;  4YHH L;  3TP6 A;  2SEB D;  4KTA A;  2VUM G;  1KIX A;  1FJG Q;  4QY7 A;  1AZQ A;  3CME A;  2VY3 A;  3HG9 A;  5CV9 A;  4ZAI A;  3T1Y L;  3C1E A;  1EFI D;  4JBM A;  4EX5 A;  3J80 c;  1MGS A;  1G8Z D;  4A3M G;  3S2D H;  1YIT A;  4DNI A;  3GO5 A;  4NB3 A;  3KBG A;  2VXW A;  4YIJ A;  1VMC A;  3W3A A;  2JA6 H;  1HFG A;  1STA A;  5JEA H;  1G91 A;  4XDX A;  3GTG H;  1Q90 A;  3X3M A;  2OCE A;  3F2D A;  4GN5 A;  3RD4 A;  4BBS G;  5CV4 A;  4DUZ Q;  1N9W A;  2E5L L;  3W2D A;  2GVB A;  3STB C;  2DN8 A;  3L7Z C;  3WWV A;  1Q81 C;  1TVX A;  5IP9 H;  4A3F H;  3FP9 A;  3OOC A;  5IYC G;  1V8Q A;  2L0C A;  1YHB A;  4MIU A;  3NQI A;  1F2M A;  2KHI A;  2R92 B;  4KLK A;  4XYO A;  3OYY A;  3GTP B;  3VR2 A;  1Y1V B;  2V1C C;  3OWF A;  5CGK A;  3GTQ B;  4FF3 A;  2OQ0 A;  2OQK A;  5BN4 A;  4UP8 A;  4BY1 B;  1PH1 A;  2K6A A;  4K2K A;  2B2W A;  2I46 A;  3J80 i;  4QQB X;  4OEL B;  2JEA I;  1SNO A;  2NVX H;  1PXU A;  3PO2 B;  1TS3 A;  5I4D A;  1QB5 D;  1LAB A;  3ZJY C;  1A63 A;  4OXP A;  4L5Q A;  4A3B G;  1G6P A;  1K0S A;  1GUW A;  1ET9 A;  3LX0 A;  5IT9 c;  1LTB D;  2HUG A;  1YI2 A;  4IOA A;  1I50 H;  1YJN A;  5DNF A;  2B8F A;  1RKN A;  2NN6 I;  4HID A;  3UDX A;  1YNX A;  5EPK A;  4IOC A;  1CUK A;  4UDU C;  1G51 A;  4EQP A;  3HS0 C;  3RR5 A;  4QUF A;  4MTK A;  4RKL A;  3FKI B;  1TXY A;  3HOZ G;  2IW3 A;  4GOP C;  4HSP A;  3TDQ A;  2DJF C;  2HHH Q;  4JI3 Q;  2IWH A;  2N49 A;  4K5W A;  1Y1W H;  3TP8 A;  2X6G A;  3MTS A;  4LF6 L;  1WTR A;  1HJP A;  1I4Q A;  5FO8 B;  1KTK A;  3CMA A;  1JT8 A;  4KMU C;  1F9Q A;  1GOZ A;  2K1B A;  3HKS A;  3U9S A;  1PZI D;  1O80 A;  2GN5 A;  3F1Z A;  4MTN A;  2PO4 A;  3TN2 A;  2R93 H;  3S1M B;  1KAA A;  4Q5V A;  3M4Q A;  3J7Y W;  4LF7 Q;  1WJJ A;  4A3K H;  4IN3 A;  3PIO 3;  4J8Q A;  3HFZ B;  1PH7 A;  4NXN L;  3KUP A;  1PRT C;  5BN5 A;  4JI4 Q;  3VYU A;  5J1Z A;  1PTO F;  2G9H D;  2QCP X;  2RCN A;  2FIN B;  5EQ0 A;  1EWH A;  1NJI C;  3ND8 A;  3CD6 A;  5IY0 A;  2PI2 A;  1H9M A;  5FJ8 G;  4AIM A;  4KY7 A;  3CCR A;  4IJL A;  1WYD A;  2CQA A;  4DAY A;  1EQT A;  1QZH A;  3I4M H;  5IOC A;  1Q8I A;  3GTJ H;  2CQO A;  2F4V L;  1IZ6 A;  3S17 H;  4X66 L;  1MIU A;  4A3L H;  4KHZ A;  4ODG A;  1S40 A;  2EYO A;  3RN2 A;  1FGU A;  2A73 B;  1L0X B;  1D8L A;  3NQT A;  2ICI A;  1K3R A;  2RA4 A;  5IE8 A;  2RBM A;  4L5S A;  1R9T B;  5JAV A;  4ALP A;  1P8L A;  1VMP A;  5GQO A;  1HNZ Q;  3NUC A;  5ELE A;  1J5E L;  1BDO A;  3TP5 A;  5KEE A;  2IY5 B;  3WOF A;  1H9S B;  1FYC A;  1SRU A;  4GS3 A;  5M5X H;  1Q12 A;  1CA6 A;  1EWC A;  3EBE A;  5IYB G;  5LHY 1;  4KD3 A;  2WIN B;  3CHB D;  3TP7 A;  4A3I B;  1VQO A;  3R8B A;  3ERS X;  5CBE E;  1I94 Q;  4DV7 Q;  1VQB A;  3EFX D;  4LF5 L;  1SR3 A;  4POF A;  4Y7N H;  4C3I G;  4DR1 L;  1CT1 D;  1KXL A;  2PCF B;  3AYH B;  4X62 L;  5LMN Q;  1X6O A;  1NBW A;  1PTO B;  2F03 A;  3M7N A;  2ALY B;  1Q46 A;  1LTA D;  1X3Q A;  4RHR A;  1AFP A;  1HPC A;  4GLV B;  1DGS A;  1G2S A;  3OSO A;  4HR7 B;  4QMG A;  1JJC B;  3J80 L;  4G7H C;  3UDG A;  4DKA C;  1YHQ A;  1VQP A;  1CQF A;  2KCT A;  3P75 A;  1BF4 A;  2K75 A;  3MWY W;  4QJF A;  4O0A A;  2DY7 A;  1IYJ B;  4JI8 Q;  4RCN A;  3TZD A;  4L5R C;  5FOB B;  5AJ3 Q;  1SYF A;  1SFO B;  4K14 A;  1QVG A;  3E0J A;  5C4Z A;  1LTI D;  3QG1 A;  2L12 A;  3S14 B;  4FXK C;  1R4Q B;  3WOE A;  1T5X D;  2DNC A;  3L2P A;  4JBJ A;  5ELF A;  1EQV A;  4YY3 L;  3GTP H;  1WVL A;  1LTT D;  1OXT A;  4EGV A;  1AN8 A;  1FR3 A;  1TS2 A;  4H13 C;  4BY1 H;  4N9T A;  1BKB A;  5G3L F;  3NEL A;  3SR1 A;  2PZU A;  4JV5 L;  3E5S A;  1B2T A;  2ATW A;  1SYD A;  2F3W A;  2F0D A;  1HA5 A;  4IAL A;  1JB3 A;  3ER0 A;  4BA2 I;  3HOX B;  1ENF A;  5FLM H;  1PA6 A;  4I7A A;  1XMQ Q;  2E2J H;  2VQF L;  5FLX E;  1RCV D;  4DR4 Q;  4RMF A;  4LK1 C;  2KJX A;  2C9O A;  4H7B A;  2VUM H;  4RGT A;  3EVQ A;  1RDP D;  1L2F A;  3HKZ E;  5IT9 L;  3FKI H;  3BDL A;  3VA7 A;  4HJ5 A;  5I9O A;  1RHP A;  4NPS A;  1BNZ A;  2KCC A;  3I73 A;  4OIJ A;  5KYL A;  2KHJ A;  3EJI A;  4LFC Q;  1GHK A;  2BE5 D;  2CH4 W;  2F0W A;  1ZYR C;  1TWH B;  2LMC B;  4Q0F A;  3OTO Q;  1I4P A;  5DM7 3;  1CA5 A;  3HKZ B;  3OWE B;  4DAP A;  1QIL A;  1HZA A;  2BA1 A;  1GJX A;  4F87 A;  3H94 A;  5IGD A;  4LW1 A;  4XQN A;  1BXT A;  3S1M H;  4A75 A;  3I70 A;  2K01 A;  4YHH Q;  1EEI D;  5K36 H;  4A3G B;  5IYC H;  1GM5 A;  2YV5 A;  5M5W B;  2VW9 A;  1H9R A;  2D9U A;  5GAH C;  4LUV A;  1WFQ A;  4BBR B;  1YJ9 A;  2KVM A;  5C4J B;  5FK9 C;  2DGY A;  3M3Y B;  4ZKB B;  2N3S A;  1SJE D;  1D6E C;  2AQ3 B;  2SNS A;  1UEB A;  2NUC A;  4ME3 A;  1UAP A;  2FHT A;  2TSS A;  2BDN A;  1YNN D;  2Z9H A;  2B2Y C;  4XT1 B;  2NN6 G;  4ZQ3 A;  5C0X J;  2E5L Q;  1JOK A;  4DK1 A;  1PDQ A;  4A3C G;  3F2U A;  4F7X A;  1CZW A;  3T16 A;  2Y0S G;  4C1N K;  5IP7 G;  1H9S A;  5IWA L;  3PIO A;  1KNE A;  2N8N A;  1EY9 A;  3HOU B;  3H3V I;  1G6Z A;  1JOR A;  2GA4 B;  2VZA A;  2LKV A;  1QUQ B;  2KQ3 A;  4JK1 C;  2RKS A;  1XPR A;  3GTK H;  1FNU A;  2E2D C;  3T1H L;  2WFW A;  2L5T A;  4RG1 A;  3HOZ H;  1VQN A;  4OON A;  1QE6 A;  3K81 C;  1PHJ A;  3CPW A;  4B08 A;  5TSS A;  4QIW E;  1Z47 A;  1IXR A;  1E1O A;  3RUZ A;  4DK3 C;  4G57 A;  3ITP A;  3GQB A;  2KUM A;  3H0G G;  2JA7 G;  5C3E G;  2EY5 A;  4JI3 L;  1OXV A;  3Q22 A;  3CCU A;  1KAB A;  1U9R A;  4ILW A;  2Z1C A;  4DNR B;  3KFU A;  1ICW A;  4QIW B;  3BU2 A;  3M4Y A;  4FVM A;  4P2C B;  3NE5 B;  5CC4 A;  1NR4 A;  4IFD H;  3DEP A;  2UXD L;  4DF7 A;  4ZUJ A;  4OWW B;  2NB0 A;  3PO3 B;  3S2H H;  3MFG A;  4KHP L;  4YCW A;  1TWC H;  1VQC A;  1D5M C;  4LF6 Q;  1IKM A;  4C1N I;  2WAC A;  4OO1 I;  5FJ8 H;  4PV1 C;  2WP8 J;  2B2V A;  1X3G A;  3QR8 A;  1SFO H;  1N36 L;  5LMN W;  4PZ8 A;  4GLX A;  2F0F A;  3S2D B;  1UWV A;  2Y0S E;  5NUC A;  4IFD J;  2PW7 A;  5L37 A;  1EY6 A;  4HJ8 A;  4PNY A;  3VYS A;  5LMU L;  4DR2 L;  2JA6 B;  3GTG B;  1MHW C;  4NXN Q;  1FVI A;  3U4V A;  3AMU A;  2WAQ E;  1L1O B;  2EJG C;  4NMZ A;  1WTX A;  3I90 A;  2LXK A;  1I4G A;  3C1F A;  4A3F B;  2CW0 C;  2EE1 A;  3I55 A;  3VDY A;  5EBC A;  3HOX H;  2WAQ B;  1RJT A;  4JI0 L;  4OWT B;  3K58 A;  2K5H A;  2F4V Q;  2JA9 A;  4JCV E;  4X66 Q;  5GAE C;  2KEN A;  1HRJ A;  1SBB B;  2F0J A;  4HMI A;  2R7F A;  1Y8P B;  3VR5 A;  2XRS D;  2F0V A;  4OX9 Q;  4LNQ A;  1SJH D;  2EYM A;  3IRB A;  4HJA A;  3FPP A;  1JWS D;  3RMH A;  4DA2 A;  1WTW A;  5KYI A;  3K0Y A;  3PUZ A;  2XRQ D;  4L6T B;  1PYS B;  1WD0 A;  1YIJ A;  5J39 A;  1B3Q A;  4GNX A;  2EYP A;  2QDL A;  1TQO A;  4P75 A;  1SE4 A;  1AE2 A;  3HRZ C;  1DOL A;  1BCP C;  3GV6 A;  4GLA C;  4LUO A;  3KF6 B;  1I50 B;  4DR3 L;  1CQV A;  1SEB D;  2KCM A;  1H95 A;  3I91 A;  4TQU S;  4LF5 Q;  3E9H A;  1PFM A;  5M5W H;  1CHP D;  4BBR H;  5KNC A;  1F2Z A;  4DR1 Q;  4JC0 A;  5C4H A;  2TMP A;  5C4J H;  1G2T A;  2B2U A;  1KC8 C;  3M3Y H;  4X62 Q;  2RHS B;  4LFB L;  4A3D G;  2Q8R E;  2JJQ A;  5ELB A;  3TZU A;  3TS2 A;  3VR6 A;  3AB9 A;  1UE7 A;  1NNX A;  2BDO A;  4P74 A;  4HCE A;  1DM0 B;  1JCK B;  4L5T A;  5EPJ A;  4X65 L;  3L9A X;  1QUQ A;  3FEW X;  2J4X A;  2EJF C;  4PMW A;  3PQI A;  1SDF A;  2MNA A;  4A3K B;  1M1K C;  5IYD G;  3K59 A;  3QJY A;  3CW2 C;  4EQ5 A;  4ZKC B;  3HOU H;  2FXQ A;  2AQ1 B;  1TII D;  1YNJ C;  4CDF C;  3J7A 5;  4AYB G;  1CTM A;  1V1P B;  4YY3 Q;  2Z6B A;  2O2L D;  5CV7 A;  1HZC A;  4MZ9 A;  5ELO A;  3I4M B;  4JYA L;  2GVA A;  4A76 A;  3LWE A;  4A3E G;  1K83 H;  3GTJ B;  2KBN A;  2WB1 G;  3S17 B;  1PRT D;  3M85 A;  2XNA C;  3J81 j;  4JV5 Q;  5CV5 A;  1PZJ D;  3NWT A;  3KBX A;  4CDE C;  1C4Q A;  1U4R A;  3I4N G;  1V43 A;  1Q7Y C;  2QW7 A;  1S3O A;  2EY2 A;  1O7Z A;  4P72 A;  2NTT A;  3NEN A;  1VQ5 A;  1HFN A;  4KN4 C;  1N32 L;  5D3I B;  2HIV A;  3NPP A;  3HOW G;  3DWP A;  3D6W A;  4EQN A;  4R9W A;  1II3 A;  2E74 C;  2MGS A;  3U4Z A;  3PO3 H;  2K50 A;  3J81 c;  1JWM D;  1X54 A;  3CRK C;  4OIK A;  5J3B A;  1Y14 B;  2KEC A;  2PZW A;  4TVA B;  1HR0 L;  2J7Z A;  3ERQ A;  2ZM6 L;  4JI7 L;  1NCV A;  1A3U A;  2D62 A;  4Y7N B;  3M4O H;  2K03 A;  3F2B A;  1HTL D;  2NN6 H;  1EOT A;  5E4W C;  1S5E D;  3GTO B;  3A7A B;  3D0F A;  2Z6K A;  2B2W C;  2EXZ A;  2N88 A;  3H91 A;  3S1R H;  4B3S L;  1DOM A;  1FNV A;  1YZ6 A;  4JI1 L;  5FO7 B;  1PH8 A;  3FMC A;  4DUY L;  1JOO A;  2WB1 E;  3GDE A;  2M00 A;  1HQM C;  2AMC B;  4RHS A;  4UHV A;  5ELN A;  1J8I A;  1O7I A;  2QGQ A;  4KV6 A;  3ONA B;  1WTH A;  2Q2H A;  4IUQ A;  4DR6 L;  1G29 1;  3BZK A;  1BBU A;  2RVL A;  2R7Z G;  1ASZ A;  3H09 A;  5JEA J;  4K6D A;  3J81 i;  3T51 B;  3MAQ A;  4N9P A;  1DJR D;  1J6Q A;  1TY2 A;  3PGZ A;  1B70 B;  2UUC L;  2JA7 H;  5C3E H;  1PFN A;  5IWA Q;  1LT6 D;  1U5K A;  1I4R A;  3KF6 A;  3A74 A;  1UEA B;  4OO1 G;  2XWJ B;  3PCO B;  1B53 A;  3Q6S A;  3G6E A;  4YWL A;  4QGU A;  3J80 E;  2Q2I A;  3T1H Q;  1L0Y B;  4A93 G;  5J22 A;  1VQ4 A;  1EZ6 A;  3G48 A;  2E2J B;  4R4T A;  1EUJ A;  2HCC A;  2F0G A;  4PG3 A;  3BYT B;  2PQA A;  5CYU A;  2VUM B;  3BS1 A;  1CKN B;  4YWM A;  4IPG A;  1EY7 A;  2DY8 A;  1UUP A;  2FMM A;  4B3T Q;  3J7A V;  4R1J A;  2EZV A;  4I65 A;  4A3M B;  4KJO A;  3A54 A;  4NP5 A;  1E2Z A;  5JJI A;  4OL7 A;  3F2C A;  5M3F G;  2F0E A;  1OXU A;  1HNX L;  3CRL C;  1JQY D;  2MO0 A;  2E2I H;  1CHQ D;  1XJV A;  1TS4 A;  4FO2 A;  4X64 L;  2UXD Q;  1ILP A;  4BBS B;  2PQE A;  4KHP Q;  1V1P A;  2Z8L A;  1NY4 A;  1NTG A;  1Q8K A;  1I5F A; 
#chains in the Genus database with same CATH homology
 3S15 B;  4KK7 A;  1ZYR D;  1AW7 A;  2L4N A;  2A69 C;  2R3Z A;  4FP5 D;  2EY1 A;  5A2Q L;  1SYC A;  1UNS A;  4RH6 A;  4L8J A;  2X6L A;  3KLR A;  3NBI A;  2B2T C;  5IT9 E;  1QWY A;  2B8G A;  1MSH A;  1Y69 U;  2F0P A;  4TSS A;  2MJ8 A;  3DHQ A;  5T1I A;  4HAE A;  2A68 C;  3E6Z X;  3NSW A;  1BO0 A;  2IT1 A;  4C2M B;  4A3B B;  1Q1B A;  2IX3 A;  2N55 A;  5KRU A;  2CVR A;  4TRD A;  1LT3 D;  3GTK B;  3SXH A;  4KI0 A;  3HOZ B;  4NW2 A;  2Q8I B;  2B2T A;  2E2H B;  4R8I A;  1E2V A;  3T53 B;  2KEE A;  1F9R A;  1IL8 A;  4K5X A;  4O1N A;  5KNB A;  1SMY C;  1A3T A;  4IQZ A;  2EVB A;  2QIL A;  3OMC A;  3H3V C;  3J81 L;  1KDB A;  4DAV A;  3R93 A;  3Q0A A;  1SAP A;  1JE4 A;  1ESR A;  2JE6 I;  1WTQ A;  1RD9 D;  5JOB A;  2XSC A;  3S2H B;  2K5Q A;  1TWC B;  1W6K A;  4MHE A;  4QB4 A;  1D1K A;  1D1I A;  1C8C A;  3O13 A;  3SE0 A;  2F0S A;  2E76 C;  3OPO A;  1LT5 D;  5D65 A;  3TBI B;  1BR9 A;  3FVQ A;  3T4A C;  1WTP A;  3D3R A;  1CK1 A;  4DXF A;  5KGU A;  2EOT A;  1SNQ A;  1XX8 A;  2QKI C;  3A8J E;  1GUS A;  5EBD A;  1LTR D;  5I6W A;  3A8K E;  3WDN A;  1S5C D;  3KLS X;  2YYZ A;  3P20 A;  2O5I C;  3HZX A;  1GUT A;  1JIC A;  2O5J C;  2OT2 A;  5JPM C;  2CW0 D;  1STY A;  4C3I B;  2L11 A;  1KLU D;  3I4L A;  2IPK D;  5CR3 A;  1I3Q B;  5JVH 3;  1WTV A;  1XWE A;  1GUG A;  4IUR A;  1IYV A;  2K28 A;  1W6J A;  4ZLT F;  3K5O A;  4IUN A;  1SXT A;  1X3P A;  1MSG A;  1U4L A;  2L1B A;  3DM1 A;  2E75 C;  1JWU D;  1M8A A;  1BCP D;  1RTN A;  3MXP A;  4G7Z C;  1RF2 D;  2IJ0 A;  1PTO C;  3CU7 A;  2ICE C;  1ONL A;  4C3H G;  2QF7 A;  5DEH A;  3SK5 A;  4OO1 H;  1SYG A;  1NSN S;  5T1G A;  1ML0 D;  3QOJ A;  2KED A;  4EQO A;  1SNP A;  3IFD A;  3BVM A;  1F9S A;  3K5N A;  3C46 A;  4FF2 A;  1K83 B;  4U68 A;  4ME5 A;  1ILQ A;  2LY7 A;  4E6I A;  4GZY C;  3QB3 A;  2B2V C;  5E4X A;  1YNJ D;  4XYQ A;  4WRD A;  1IYU A;  1LAC A;  3JAM L;  1TU2 B;  3VR3 A;  1EU4 A;  2BOS A;  4ID6 A;  1ZKO A;  4XIG S;  2MPM A;  2IX1 A;  3MC0 B;  5A35 A;  3MEH A;  4HED A;  2D2C C;  2M2L A;  2VB3 X;  3AU7 A;  3PUV A;  3GD7 A;  5C0X I;  3BVG A;  3T56 B;  3X3N A;  4QCL A;  3EA6 A;  1SND A;  4CJ2 C;  2AWO A;  4CKB A;  3M4O B;  4IUU A;  1WTO A;  2QEJ C;  4XQQ A;  3NTI A;  3HEJ A;  5JVG 3;  4L63 B;  4X3U A;  3DXJ C;  3S1R B;  5KIX A;  2Y0S B;  2MHV A;  4KD4 A;  3FDT A;  3DMU A;  3BG3 A;  1E0B A;  3OIQ A;  4RAU C;  2H4O A;  3DUZ A;  4C3J G;  2K5W A;  4CKC A;  2WKC A;  1K8M A;  4XXE A;  1EIG A;  5LL6 X;  1TWF B;  4BS9 A;  5C5L A;  1PYW D;  3P7J A;  1CM9 A;  3RZD B;  2JA7 B;  3H0G B;  2B2U C;  2JYO A;  5C3E B;  3NWS A;  2JEB I;  3PUX A;  2ID0 A;  4KHV A;  2K04 A;  3SK6 A;  4X3T A;  1O78 A;  3D8G A;  4O42 A;  2WII B;  3I72 A;  1XTC D;  1CZG A;  1QNU A;  5CBA E;  5IOD A;  1EY4 A;  1EYC A;  2RDG A;  4IFD I;  2R61 A;  3QOL A;  1A15 A;  2VB2 X;  5BN3 A;  1PMR A;  1QCB D;  1TR5 A;  2JXM B;  2EDG A;  2J0T D;  1EYA A;  2NBF A;  5IGB A;  2E2I B;  5E1F A;  1EY5 A;  2Z4H A;  1STG A;  2L9H A;  5F2D A;  4FXG C;  4CKE A;  3PMF A;  4DFA A;  4XQJ A;  3K6O A;  2FFK B;  1ET6 A;  2KA7 A;  1CI3 M;  1PRT F;  4HSV A;  4ZYS A;  1EZ8 A;  4CJ1 B;  3OMG A;  2AUJ D;  3S9W A;  1ENA A;  2K05 A;  2A69 D;  1SSO A;  5C5M A;  2NVT B;  4QF4 A;  1EEF D;  2X69 A;  1KDC A;  3DWA A;  2EYH A;  3S16 B;  4LMQ D;  1DYQ A;  1FGB D;  5LL6 S;  4CHT B;  1A3V A;  1IW7 C;  3U9O A;  2A6E C;  4PQX A;  1B3A A;  2R6G A;  4KN7 C;  4DN4 M;  2A68 D;  5A2Q E;  1SYE A;  5IGF A;  3FRP B;  2A74 C;  2Z4I A;  1EYD A;  1F77 A;  1QG7 A;  2G9D A;  4X3K A;  4IUV A;  4A3D B;  2SDF A;  1CFM A;  4G4K A;  1JC7 A;  1ROD A;  3BYY B;  1TWG B;  2WV6 D;  1B44 D;  2HDL A;  5C3W A;  4NDX A;  1BQQ T;  1PRT B;  3SVM A;  1EY0 A;  2XN9 C;  3RLF A;  3SK4 A;  1SMY D;  2HQE A;  3DEO A;  4IUP A;  2H1E A;  4AYB B;  3MVV A;  4CBV A;  2BCO A;  3N52 A;  3LNN A;  5DAU A;  2F0O A;  4A3E B;  1KDA A;  2WB1 B;  4F8M A;  1DZ1 A;  1MBY A;  4R8N A;  3I4N B;  4FXD A;  3Q24 A;  5K36 G;  2HCI A;  5DM6 3;  3J81 E;  5C0X G;  2EYF A;  1LTG D;  1QJO A;  3K5M A;  4K6L A;  2O4X A;  3KK7 A;  1STB A;  4WJW A;  2RDH A;  1KNA A;  3HOW B;  3K7A B;  2A5H A;  3TME A;  3R3O A;  2SNM A;  4PMB A;  2EPB A;  1VDZ A;  2K32 A;  3IFT A;  3A56 A;  2LFN A;  4F88 A;  4Z9C B;  4OGQ C;  2A6H C;  2FMC A;  3GTM B;  2CHB D;  5FKA C;  1I4X A;  3L3O C;  1B9N A;  1BUV T;  1B1Z A;  2K7V A;  3IKJ A;  1ZEQ X;  4KJN A;  5KND A;  3K5L A;  1AZP A;  5EPL A;  5IIF A;  2BA0 A;  4XT3 B;  4I7Z C;  3S1N B;  3HP3 A;  3ND9 A;  2R7Z B;  1J9O A;  1H9J A;  4DXG A;  4HN7 A;  2ZXR A;  1OXS C;  1Q1E A;  5IGE A;  4EVO A;  4IFD G;  1T5E A;  3BVZ A;  4V19 0;  3PIP 3;  2OXP A;  4RA8 A;  3SDZ A;  1QNK A;  2OF1 A;  3VYR A;  5EJW A;  1AEX A;  1F2L A;  4A93 B;  3R2T A;  1PTO D;  1ESF A;  3A8I E;  2K33 A;  2OEO A;  3MZ5 A;  1XYI A;  2F0H A;  2Q8T A;  1SNM A;  3LWU A;  5EKI A;  1I6H B;  1FD7 D;  1LTS D;  1JOQ A;  2K5D A;  4ABN A;  1Z7T A;  3M7G A;  3NTH A;  5M3F B;  2JSO A;  3VA5 A;  1LV9 A;  4FF1 A;  3A7L A;  3MXU A;  3C2P A;  1TWA B;  2VNU D;  4IZ8 A;  1DOK A;  2SOB A;  3GTL B;  1D5X C;  1OO9 B;  5I2Y A;  3S1Q B;  2PZT A;  4RKB A;  1H9K A;  4FF4 A;  1S5D D;  3MFY A;  1HUN A;  5HGT A;  3P1H A;  3DWQ A;  3QWN A;  3G7L A;  1SNC A;  3TSS A;  4M1U B;  1STE A;  2NTS A;  2NVY B;  3D4W A;  5CV6 A;  3HOV B;  4OHJ A;  5IGG A;  4K5V A;  4K2L A;  4KY5 A;  2QDB A;  1B50 A;  4WFN 3;  3NXW A;  3V96 A;  1SE2 A;  3JAM E;  4X3S A;  4KKU A;  1VF7 A;  2JP1 A;  3CQZ B;  1Q3L A;  1VCI A;  2RQX A;  3R2I A;  2PPB C;  3HGB A;  3K57 A;  2JA8 B;  3VR4 A;  2F0N A;  4NKL A;  5E3F A;  1SYB A;  4B9X A;  1HTP A;  2RDF A;  3D4R A;  5EKK A;  3GV3 A;  1DCZ A;  1EL0 A;  4DU9 A;  5G3L D;  2MP1 A;  3D31 A;  1DD2 A;  1D2B A;  3T13 A;  3BDO A;  2PNR C;  1TT2 A;  1SE3 A;  1BBX C;  2FJ2 A;  2L55 A;  1R4P B;  3Q23 A;  1GHJ A;  2KHS A;  2NVQ B;  1EIH A;  3URY A;  3MXG A;  3PUW A;  2WKD A;  3J7A F;  4RGN A;  3G6J B;  1LO5 D;  1BCP F;  5C6A A;  2D5D A;  5M5Y B;  1F9P A;  1JR0 D;  4ZK9 B;  4CJ0 B;  5CMD A;  2EY6 A;  4RFB A;  2NZ1 D;  1OXX K;  3NK9 A;  4M8A A;  3D4D A;  1ZXT A;  2DNE A;  2F0M A;  1S4Z A;  4B9W A;  5C0X H;  1B4O A;  1STN A;  1LLR D;  1PLF A;  3C3L A;  5C4X B;  1WCM B;  1X32 A;  4ZUI A;  4RGO S;  4QUC A;  1O7Y A;  1TS5 A;  3HOY B;  4CGY B;  3GP7 A;  3MXN A;  5M9O A;  1QOH A;  5COR A;  2EYJ A;  3QIA A;  3NP8 A;  1EY8 A;  1C48 A;  2AUK A;  4A3J B;  3ERO A;  2YU9 B;  5JEA G;  1AP0 A;  4U67 3;  2EYL A;  2F0I A;  2F4I A;  2KOL A;  2LS0 1;  1EU3 A;  3NBH A;  5M3M B;  1Z6H A;  1BCP B;  2RSN A;  1Y8N B;  2KCN A;  5D14 A;  3NHH A;  4J1M A;  3RZO B;  2IL8 A;  2B2Y A;  4LJZ C;  2AQ2 B;  2XWB B;  4DNT B;  2ZT9 C;  4HCS A;  1DON A;  4LAA A;  1IW7 D;  1PTO H;  3H6M A;  3A55 A;  2A6E D;  3VYT A;  5I2X A;  1K8O A;  1WD1 A;  1XXG A;  2PMZ B;  4V0B A;  1A2U A;  4C3H B;  1I4H A;  3NTK A;  4G7O C;  2F0T A;  1FNW A;  2ZXO A;  3I3C A;  3EQL C;  2MUY A;  5FLX L;  2F0L A;  3IAY A;  2RSO A;  4BY7 B;  2XVS A;  4IUT A;  1HCZ A;  1B9M A;  2I07 B;  1HUM A;  2HDM A;  2F0Q A;  1RTO A;  1PFB A;  2IX0 A;  2F3V A;  2V4D A;  3SEB A;  3BZD B;  1D5Z C;  1A6X A;  1BOS A;  3UI2 A;  5ISR A;  1MI2 A;  4H0L C;  1NAP A;  1IHZ A;  1MD2 D;  5D3D A;  3OHX C;  4HTH A;  1TY0 A;  1GXD C;  1HHV A;  3N6R A;  2BE5 C;  3MHB A;  4KKT A;  1NUC A;  5EKL A;  1Y8O B;  4ULL A;  2AWN A;  1GUN A;  4RGM A;  1HQR D;  5COY A;  4RCO A;  4H44 C;  1PZK D;  4ZRZ A;  5JPN C;  1ENC A;  2NVX B;  1O7L A;  3I8Z A;  2PYK A;  4DGZ A;  2ENB A;  1I6V C;  1STH A;  4C56 C;  3V05 A;  1KLG D;  4WOR A;  1IKL A;  1TKW B;  2JA5 B;  5C3X A;  2EJM A;  3BDC A;  4FYD A;  3QO2 A;  1YNN C;  4DK0 A;  4KKS A;  3SHL A;  2XIW A;  1Y1W B;  5EGT A;  1S5F D;  2A6H D;  4C3J B;  3CKI B;  4UAI A;  4S3S A;  4BWG B;  5IGC A;  3OW7 A;  2NYZ D;  4BA1 I;  3KF8 A;  2R93 B;  4K8J A;  4TKO B;  4PMC A;  2M9V A;  1DXM A;  3V2T A;  2NWG A;  3SK8 A;  1U4P A;  5ELC A;  5CV8 A;  1HA6 A;  3PUY A;  5AFW A;  2PW5 A;  5JJZ A;  3FPU B;  5FO9 B;  1M4V A;  4KY6 A;  1HXY D;  2F0K A;  2C5C A;  3KLS A;  1F2Y A;  5I9P A;  1S5B D;  3PV0 A;  5C44 B;  1GUO A;  5I6Y A;  2ZXP A;  4HMJ A;  1U4M A;  1NR2 A;  1V1O A;  3OIP A;  1E2W A;  4K8I A;  4J6H A;  4JBW A;  3MA2 B;  3IL8 A;  5K5P A;  4XTC S;  2B63 B;  2F1M A;  5HUR A;  3ZYY X;  4FNF A;  2F0U A;  4RWS C;  4MN3 A;  1A2T A;  5M5X B;  2B39 A;  5ELD A;  3D6C A;  1LT4 D;  1VF5 C;  3TP6 A;  2SEB D;  4KTA A;  1AZQ A;  3HG9 A;  5CV9 A;  4ZAI A;  3C1E A;  1EFI D;  1MGS A;  1G8Z D;  3GO5 A;  3KBG A;  2VXW A;  4YIJ A;  1VMC A;  3W3A A;  1HFG A;  1STA A;  5JEA H;  1G91 A;  4XDX A;  1Q90 A;  3X3M A;  3RD4 A;  5CV4 A;  3W2D A;  2DN8 A;  3L7Z C;  1TVX A;  3OOC A;  1V8Q A;  2L0C A;  4MIU A;  3NQI A;  1F2M A;  2R92 B;  4XYO A;  3GTP B;  3VR2 A;  1Y1V B;  3OWF A;  5CGK A;  3GTQ B;  4FF3 A;  5BN4 A;  4BY1 B;  2K6A A;  4K2K A;  2B2W A;  2I46 A;  2JEA I;  1SNO A;  1PXU A;  3PO2 B;  1TS3 A;  5I4D A;  1QB5 D;  1LAB A;  1GUW A;  1ET9 A;  3LX0 A;  1LTB D;  2HUG A;  5DNF A;  2B8F A;  1RKN A;  2NN6 I;  5EPK A;  4UDU C;  4EQP A;  3HS0 C;  4QUF A;  4RKL A;  3FKI B;  2IW3 A;  4HSP A;  3TDQ A;  2IWH A;  4K5W A;  3TP8 A;  2X6G A;  3MTS A;  1WTR A;  1I4Q A;  5FO8 B;  1KTK A;  4KMU C;  1F9Q A;  1GOZ A;  2K1B A;  3U9S A;  1PZI D;  1O80 A;  2PO4 A;  3TN2 A;  3S1M B;  1KAA A;  4Q5V A;  3J7Y W;  4IN3 A;  3PIO 3;  4J8Q A;  3KUP A;  1PRT C;  5BN5 A;  3VYU A;  5J1Z A;  5EQ0 A;  1PTO F;  2G9H D;  2QCP X;  2FIN B;  1EWH A;  3ND8 A;  1H9M A;  4KY7 A;  2CQA A;  4DAY A;  1EQT A;  5IOC A;  1Q8I A;  4KHZ A;  4ODG A;  2EYO A;  2A73 B;  1L0X B;  3NQT A;  2ICI A;  2RA4 A;  2RBM A;  1R9T B;  5JAV A;  1VMP A;  3NUC A;  5ELE A;  1BDO A;  3TP5 A;  5KEE A;  3WOF A;  1H9S B;  1FYC A;  1Q12 A;  1CA6 A;  1EWC A;  5LHY 1;  4KD3 A;  2WIN B;  3CHB D;  3TP7 A;  4A3I B;  3R8B A;  5CBE E;  3EFX D;  4C3I G;  1CT1 D;  2PCF B;  1PTO B;  2F03 A;  3M7N A;  1X3Q A;  1LTA D;  4RHR A;  1AFP A;  1HPC A;  1G2S A;  3OSO A;  4HR7 B;  4QMG A;  3J80 L;  4G7H C;  1CQF A;  3P75 A;  1BF4 A;  3MWY W;  2DY7 A;  4RCN A;  3TZD A;  5FOB B;  1SYF A;  1SFO B;  4K14 A;  3E0J A;  5C4Z A;  1LTI D;  3QG1 A;  2L12 A;  3S14 B;  4FXK C;  3WOE A;  1R4Q B;  1T5X D;  2DNC A;  5ELF A;  1EQV A;  1WVL A;  1LTT D;  1OXT A;  4EGV A;  1AN8 A;  1FR3 A;  1TS2 A;  4H13 C;  4N9T A;  5G3L F;  3SR1 A;  2PZU A;  3E5S A;  1B2T A;  1SYD A;  2F3W A;  2F0D A;  1HA5 A;  4IAL A;  1JB3 A;  4BA2 I;  3HOX B;  1ENF A;  5FLX E;  1RCV D;  4LK1 C;  2KJX A;  2C9O A;  4H7B A;  4RGT A;  3EVQ A;  1RDP D;  5IT9 L;  3BDL A;  3VA7 A;  5I9O A;  1RHP A;  1BNZ A;  2KCC A;  3I73 A;  4OIJ A;  5KYL A;  3EJI A;  1GHK A;  2BE5 D;  2F0W A;  1ZYR C;  1TWH B;  2LMC B;  4Q0F A;  1I4P A;  5DM7 3;  1CA5 A;  3HKZ B;  3OWE B;  4DAP A;  1QIL A;  2BA1 A;  1GJX A;  4F87 A;  3H94 A;  5IGD A;  4XQN A;  1BXT A;  3I70 A;  2K01 A;  1EEI D;  5K36 H;  4A3G B;  5M5W B;  1H9R A;  2D9U A;  4BBR B;  2KVM A;  5C4J B;  5FK9 C;  3M3Y B;  4ZKB B;  1SJE D;  1D6E C;  2AQ3 B;  2SNS A;  2NUC A;  1UAP A;  2FHT A;  2TSS A;  2BDN A;  1YNN D;  2B2Y C;  4XT1 B;  2NN6 G;  4ZQ3 A;  5C0X J;  1JOK A;  4DK1 A;  1PDQ A;  3F2U A;  4F7X A;  1CZW A;  3T16 A;  4C1N K;  1H9S A;  1KNE A;  1EY9 A;  3HOU B;  1G6Z A;  1JOR A;  2GA4 B;  2LKV A;  2KQ3 A;  4JK1 C;  2RKS A;  1FNU A;  2E2D C;  2L5T A;  1QE6 A;  4B08 A;  5TSS A;  1Z47 A;  3RUZ A;  4G57 A;  3ITP A;  3GQB A;  2KUM A;  3Q22 A;  2EY5 A;  1OXV A;  1KAB A;  1U9R A;  4ILW A;  2Z1C A;  4DNR B;  1ICW A;  4QIW B;  3M4Y A;  4FVM A;  4P2C B;  3NE5 B;  5CC4 A;  1NR4 A;  4IFD H;  3DEP A;  4DF7 A;  4ZUJ A;  2NB0 A;  3PO3 B;  3MFG A;  1D5M C;  1IKM A;  4C1N I;  2WAC A;  4OO1 I;  4PV1 C;  2WP8 J;  2B2V A;  2F0F A;  3S2D B;  5NUC A;  4IFD J;  2PW7 A;  1EY6 A;  4PNY A;  3VYS A;  2JA6 B;  3GTG B;  3AMU A;  2EJG C;  4NMZ A;  1WTX A;  3I90 A;  1I4G A;  3C1F A;  4A3F B;  2CW0 C;  2EE1 A;  5EBC A;  2WAQ B;  1RJT A;  3K58 A;  1HRJ A;  1SBB B;  2F0J A;  4HMI A;  1Y8P B;  3VR5 A;  2XRS D;  2F0V A;  1SJH D;  2EYM A;  3FPP A;  1JWS D;  3RMH A;  4DA2 A;  1WTW A;  5KYI A;  3K0Y A;  3PUZ A;  2XRQ D;  4L6T B;  1WD0 A;  5J39 A;  2EYP A;  1TQO A;  1SE4 A;  3HRZ C;  1DOL A;  1BCP C;  3GV6 A;  1I50 B;  1CQV A;  1SEB D;  3I91 A;  4TQU S;  1PFM A;  1CHP D;  5KNC A;  1F2Z A;  5C4H A;  2TMP A;  1G2T A;  2B2U A;  2Q8R E;  5ELB A;  3TZU A;  3VR6 A;  3AB9 A;  2BDO A;  4HCE A;  1DM0 B;  1JCK B;  5EPJ A;  3L9A X;  3FEW X;  2J4X A;  2EJF C;  4PMW A;  1SDF A;  4A3K B;  3K59 A;  3QJY A;  4ZKC B;  2AQ1 B;  1TII D;  1YNJ C;  1CTM A;  1V1P B;  2O2L D;  5CV7 A;  3I4M B;  3LWE A;  3GTJ B;  3S17 B;  1PRT D;  3M85 A;  2XNA C;  5CV5 A;  1PZJ D;  3NWT A;  3KBX A;  1C4Q A;  1U4R A;  1V43 A;  2EY2 A;  1O7Z A;  2NTT A;  1HFN A;  4KN4 C;  5D3I B;  3NPP A;  3DWP A;  3D6W A;  4EQN A;  4R9W A;  1II3 A;  2E74 C;  2MGS A;  1JWM D;  3CRK C;  4OIK A;  2KEC A;  2PZW A;  2J7Z A;  3ERQ A;  1NCV A;  1A3U A;  2D62 A;  4Y7N B;  2K03 A;  1HTL D;  2NN6 H;  1EOT A;  5E4W C;  1S5E D;  3GTO B;  3A7A B;  2B2W C;  2EXZ A;  2N88 A;  3H91 A;  1DOM A;  1FNV A;  5FO7 B;  3FMC A;  1JOO A;  2M00 A;  1HQM C;  4RHS A;  1J8I A;  4KV6 A;  3ONA B;  4IUQ A;  1G29 1;  2RVL A;  3H09 A;  5JEA J;  4K6D A;  3T51 B;  3MAQ A;  4N9P A;  1DJR D;  1TY2 A;  1PFN A;  1LT6 D;  1I4R A;  1UEA B;  4OO1 G;  2XWJ B;  1B53 A;  3Q6S A;  3J80 E;  1L0Y B;  5J22 A;  1EZ6 A;  2E2J B;  2HCC A;  2F0G A;  3BYT B;  5CYU A;  2VUM B;  3BS1 A;  1EY7 A;  2DY8 A;  1UUP A;  2FMM A;  3J7A V;  2EZV A;  4I65 A;  4A3M B;  4KJO A;  3A54 A;  4NP5 A;  1E2Z A;  4OL7 A;  2F0E A;  1OXU A;  3CRL C;  1JQY D;  1CHQ D;  1TS4 A;  4FO2 A;  1ILP A;  4BBS B;  2PQE A;  1V1P A;  2Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...