1B7FA

Sxl-lethal protein/rna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
b'SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3')
publication title Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna-binding protein/rna
total genus 35
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b7fA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b7fA01
2HGNA 3MUTP 1VC6A 4W90B 2CPHA 1X5PA 2KM8C 3CCJS 3VAJA 2DNPA 2MKKA 2X1BA 1Q81T 1U1QA 1G2EA 4YOEA 2DIUA 5DDRC 1NU4A 2DK2A 2CPJA 1WHWA 3EGZA 4IO9Q 2G0CA 2D9OA 1KD1T 2LEBA 2CQ2A 2CQBA 1N54B 2DGSA 2ADBA 2JVRA 1OWXA 2DGTA 4TU8A 4BS2A 5GAGU 2ZJQQ 1QM9A 2DIVA 2MKHA 2FY1A 5GADU 2MKIA 2LEAA 5DM7Q 3CCRS 2FC9A 1VQ5S 2EK1A 5CXTA 3G8TA 1O0PA 4LMZA 1UP1A 3R1HA 2MB0B 3CCLS 1WG5A 1DRZA 1X0FA 5LSLA 3P6YC 3CCUS 2XSFA 2YKAA 2PE8A 2XS2A 3G96A 2MPUA 4F02A 4C7QA 2DO4A 3NS6A 5DETA 4QQBA 1X4FA 2YWKA 1X4CA 1WWHA 2M8HA 3D2WA 2DGVA 2XB2D 3CD6S 1U1KA 2CPZA 2MKCA 3P49B 5FJ4A 3THTA 3SXLA 2RQ4A 1WHXA 2CPDA 2M0GB 1URNA 2XS5A 3I56S 1ZH5A 3ZZYA 3MI7X 1U1PA 2LXUA 1VBYA 3CTRA 2KI2A 2CJKA 1WF2A 2CQ0A 2MZTA 1NO8A 1JJ4A 3S7RA 1M90T 3DLLQ 2PEHA 2CPIA 2KFYA 2DH8A 5DDPC 2G4BA 5H1SV 2N3OA 4A8XA 2NLWA 1JJHA 2MXYA 2I38A 2AD9A 1OO0B 1XN9A 5HL7Q 2M8DB 4UQTA 2GHPA 3ULHA 3H2UB 1WI6A 3RW7A 4TU7A 2DNZA 2RU3A 3THPA 2JVOA 1OIAA 1WEYA 5D77A 2CPYA 5DM6Q 1ZZNA 1F9FA 1S72S 2M2BA 3J7YU 3US5A 2KYXA 3SMZA 1FJEB 2J76E 2YTCA 5LXRA 2KXNB 2M7SA 2HGMA 2DNRA 2VODA 2E5IA 3SDEB 1SJFA 2F3JA 3NNCA 1D8ZA 2KG1A 3BS9A 1H2UX 3VALA 4Z2XA 2KRRA 2E5HA 2MYFA 3NNAA 1U1RA 2KVIA 2RS8A 3DXBA 4QPTA 2MQPA 2KXHA 2KU7A 1SJ4P 2OTLS 1YI2S 2M88A 5IM0B 1KOHA 4M5DB 2DNGA 4EGLA 3CXCR 1SXLA 2KRBA 5JVHQ 5BJRA 3UWTA 2KXFA 1B7FA 3IRWP 2XNQA 2CPEA 2EK6A 3NS5A 3TYTA 3J7ZT 2J8AA 5DDQC 2RS2A 4YUDA 3UCUP 2DHAA 1NJIT 2QEXS 2ZJRQ 2LMIA 3P5TL 3U1MA 3MXHP 2A3JA 2MKJA 5LJ3Y 1BY9A 1WF0A 2X1FA 1RK8A 2DNKA 4CH0S 1VQMS 2D9PA 1KQSR 1N88A 2CQ3A 1W2BR 2KN4A 3CCMS 1FO1A 3HHNB 3Q2TC 4U67Q 2V94A 5LXYA 3MURP 1VQ6S 1H6KX 5JVGQ 1VC5A 1U2FA 2DNOA 2DB1A 2LCWA 2AYBA 3U1LA 2KG0A 4ZKAA 5HO4A 1VQNS 2NZ4A 2KT5A 2AYEA 1WTBA 2M4MA 2OTJS 3MUVP 1X4AA 1FHTA 2JWNA 2N3LA 3BO4A 3VF0B 3VAHA 4FXVA 2D3OR 2DH9A 5D78A 3FEXB 2CQIA 1OPIA 4RU2A 2CQHA 2MSSA 2YH0A 4PRFA 3VAFA 2VONA 2GO9A 2YH1A 2JX2A 3VAKA 2VOOA 1YITS 2J0SD 1SJ3P 3UD3P 5IFMA 1HL6A 4CQ1A 3N9UC 3CC4S 2DGWA 3VAMA 2ADCA 1WHVA 3MDFA 2DNNA 1M1KT 3LQVA 2B0GA 2EVZA 3S01A 1P27B 1WEZA 1R8HA 1HD0A 1L3KA 2QFJA 3EX7B 5GMKa 1N8RT 3CCES 1YHQS 1FJ7A 2MZJA 3ZZZA 4Y00A 2MZQA 2DISA 1UAWA 1UW4A 1ZZFA 3G4SS 2KM8B 3G71S 1SJRA 4PR6A 1YJWS 4ERDA 3H2VE 2DGQA 2RUGA 1VQ9S 1WI8A 2BZ2A 5GVQA 3MOJB 4WFAQ 2L9WA 2MGZA 2MQLA 3SDEA 3MD1A 4C4WA 2MY8A 1DBDA 1CVJA 4OZ0A 1YJ9S 1M5VC 1K73T 3UCZP 2G1DA 3BEGB 3CPWR 1QVFR 2RT3A 3S6EA 2DHXA 3NMRA 1U1NA 1VQPS 2DNHA 2MQMA 2FPHX 4FXWA 1M5KC 2M9KA 2OSQA 2U1AA 2K8GA 5ITHA 1DZ5A 3CULA 2L41A 2MJUA 3Q2SC 1WHYA 4F26A 2ZJPQ 2RQCA 4QU6A 4CH1A 1HD1A 3RW6A 3UE2A 2MQQA 2LYVA 3OW2R 1VC0A 1VQKS 3IWNC 3TO8A 2DHSA 2UP1A 4IUFA 4TU9A 1WG1A 4LIRA 1X5TA 3B4MA 3EGNA 4OZ1A 2E5JA 2LKZA 1PO6A 2BOPA 3V4MA 2LQ5A 3CCVS 2CQDA 1IQTA 2LA6A 1H2VZ 1RKJA 4IOAQ 1VQOS 3MUMP 1UFWA 3CMAS 3G8SA 5DDOC 2DNLA 1YTYA 2MMYA 2RRBA 2I2YA 3CMES 1A7GE 2LA4A 1WELA 2CPXA 2DNMA 4Y0FA 2AYGA 4PKDB 3CCSS 1VQ7S 2XNRA 4WFBQ 1A9NB 4UY8T 2XS7A 1WG4A 1Q7YT 4LJMA 2DGUA 1YIJS 2AYMA 3PIOQ 4WFNQ 2J0QD 2DNYA 4F25A 5CA5A 1KOOA 4YB1P 3MD3A 4CIOA 2L08A 2OIHA 3LPYA 2F9JA 1U1OA 1S79A 1WEXA 2FHOB 2KH9A 5MLCV 4ED5A 1WF1A 2DITA 2MY7A 2DNQA 1FNXH 2FC8A 1X4DA 1YJNS 2DH7A 2N7CA 3HI9A 3B4DA 2F9DA 1M5OC 2MSTA 3S8SA 1VQLS 2HYIB 1X5SA 2ERRA 3L3CA 1KC8T 4WKRA 2MZRA 3G6ES 2LXIA 2M70A 3UD4P 3TP2A 2MZSA 1Q86T 2MJNA 1Q82T 4WF9Q 1SJQA 2CQGA 2MQOA 1VQ4S 2U2FA 3K0JA 2CQCA 2OJ3A 2DHGA 1U6BA 2WBRA 2MHNA 3VAGA 2DGXA 4WIIA 5GAEU 2X1GA 3G9CA 3FEYB 3NNHA 1JJ2R 1X4GA 3CUNA 1DHMA 1U1MA 2MQNA 1VBZA 1U6FA 2E44A 1YWXA 2N82B 1AUDA 2HZCA 3R1LA 5EN1A 2X1AA 2CQ1A 1HA1A 2E5GA 2SXLA 5IQQA 2HVZA 4J5OA 5GAHU 5LSOA 4QU7A 5CYJA 3CF5Q 2CQ4A 5LJ5Y 1M5PC 1QVGR 2QA4S 1X4HA 2RNEA 1X5OA 1FXLA 1JMTA 1P1TA 2DO0A 3I55S 2OSRA 3CC2S 1U1LA 1K8AT 2HGLA 1FJCA 2RVJA 4WCEQ 4W92B 1X4EA 1PGZA 2JRSA 1H2TZ 4TLQA 2LECA 1FT8A 4P6QA 5IM0A 1VBXA 3CC7S 2DGOA 2MKSA 2KHCA 2M52A 2MGZB 2CQPA 2K3KA 2RRAA 3CCQS 3VAIA 1X4BA 1D9AA 1R8PA 4IOCQ 4V19X 2MZ1A 2CPFA 3R27A 3JB9k 3PIPQ 3P3DA 1N52B 4C0OC 3UCGA 1VQ8S 3BO2A 2Q79A 2O3DA 3BO3A 1K9MT 2VOPA
chains in the Genus database with same CATH superfamily
3WDOA 3SQOP 2RU9A 2LQBA 5CABA 3BBFA 2CPHA 4ICLB 2V6AA 2C2EA 1T95A 1NU4A 5ETQA 3KNAA 3DM2A 3I82A 2IYGA 2VUGA 3D28A 4JV0A 2O66A 3GG0A 2MKHA 2H4WB 2WVFA 3OXLA 5GADU 2XMUA 3NS7B 3G6VA 1BMQB 3G6XA 4F4YA 3OL9A 4QIVA 2HS4A 3KK3B 2XZWA 2B43A 2DO4A 2RF2A 1SC1B 4NX9A 3ICLA 1NDPA 2BQUA 1ZA2B 1HBNA 3O8WA 2OPRB 4K7QA 4A4JA 1ZH5A 1VBYA 3K5MA 2B7BB 3GV5B 2GJFA 4FDFA 1S1VA 4HL9A 3A8IA 5BR8F 1RWOB 5J2MA 4CWBA 3IO1A 2CFXA 4HKQA 2B9WA 3IG1B 4U8YA 4X65F 3BGUA 5DM6Q 3BKUA 3W8GA 4IRDA 1R89A 2J76E 2J7KA 2RIJA 4X4RA 3D3CJ 1EJ7L 4BC9A 1RAOA 3KMQA 4O3RA 4NYOA 3DXBA 3MM7A 2P6TA 3O2IA 3TJ9A 3NL0A 4M5DB 3MF5A 3I5AA 4NA1A 2RSQA 4KSEB 2E7WA 8AT1B 1SV5A 5EDWA 1HW8A 2BJDA 4U6PA 2AJ2A 2DHAA 1T9TA 2E29A 4QWDA 3U1MA 2QC3A 2DNKA 3PO5A 3KLFB 3HVWA 3MR3A 2EC2A 2NYIA 2DB1A 4HT5A 1TKDA 5HO4A 2HWHA 4DPYA 3PW4A 2OTJS 2PMHA 2D74B 1IBMJ 2FVPA 3GJRB 3L4BC 5D78A 5ETNA 1VLYA 4B9NA 3IS9B 2VBYA 3M9OB 2YKOA 2JEJA 2HBRB 3MTJA 1JLFB 2OMLA 4AL5A 2OPSB 1ZTTA 4EWTA 3OHBA 2W9AA 2FHKA 1M1KT 4NASA 5RUBA 5GAHI 3WZ0A 1R8HA 2ZBCA 4NLYA 1L3KA 2GCFA 3QRRA 4ZCLA 2QZ8A 3D4JA 4IH6A 3QT7A 4JI5J 3MAAB 1F3VA 1NK0A 4LF4F 5KG3A 4PZVA 4C0BA 4K5SA 5J2PB 1JXVA 3H42A 1RTHB 2IM3A 3ZZOA 1WNEA 1LW0B 5DG7A 4HI2A 4X4TA 5KG4A 2BANB 1JIHA 2NPIA 4F4AA 3JSMB 1IBKJ 4DG1A 1DZ5A 4V1Ak 1HQEB 2G2OA 6AT1B 2ACMA 2EBEA 3TJ8A 1MN9A 1YK9A 5J1NA 2GJIA 4J91A 3CCVS 2KVQE 1WJ9A 4LRCA 3G8SA 4FPIA 2ZBRA 4KYZA 2ZKUA 5AXKA 1GX6A 2Z57B 1Y3KA 1PKUA 3OTDA 2H65B 3KHGA 4YB1P 4DPUA 2E1PA 2F9JA 3BR9A 1YRUA 1TAUA 4E98A 1BXNA 4DWIA 2PIIA 1NJZA 5KFZA 2DY1A 1RUSA 1H98A 4URQU 1PILA 2IDLA 2W7AA 1M5OC 1FTCA 1X5SA 3J7A1 4R8UB 2OKQA 2MJNA 2OJ3A 3NNHA 5DG9A 3CJKA 3W62A 2D3O1 2G2YA 3IBFB 5KT6A 2UUAJ 5DQGA 3TAMB 2CQ1A 3BKTA 2XCAA 2RDIA 2QLJB 3UQSA 1DLOB 3JSBA 3J80Y 1QVGR 5KFUA 4XO0A 3TARA 1CC7A 3JYTB 4E8UA 2YNHA 3D66A 3AODA 3DGPA 4H4OB 4CLSA 4KT0C 2RVJA 1FNOA 3X3UA 2ASJA 3T41A 2VKRA 3IRXA 1WSRA 1LK7A 1JLQA 2RRAA 2ZH7A 4Y3CA 3TRGA 4O3QA 4YY3F 2FVRA 1U25A 3ENVA 4DS4A 1K9MT 1JB0C 2KDOA 2MKKA 5K5MA 2R2SA 1C0TB 1OS5A 1U1QA 2BJ9A 2YPZA 2FZCB 3PRBA 3AJDA 2DGSA 4MKBA 3ET6A 3DOLA 4NLOA 4ZMMA 3R5GA 5D0RA 3HKZD 5J1EB 2GGPA 2FC9A 4NXNF 4HH0A 5HROB 4WPAA 1U47A 2W2PP 2VBXA 3NGTA 5BXIA 3EMTA 1KNZA 5HSPA 3D2WA 2HVHA 1SI9A 3FZ2A 4NCAA 1NHVA 3GTYX 4QPXA 4O0NA 2CPDA 4G1QB 1HYSA 4DX7A 2GVZB 4KV8A 2CJAA 1UVIA 1YZ6A 4JI1F 3TW0A 4WTYA 4OX8A 5IT0A 2QG9B 3QGHA 4JI2J 2ABYA 2YKNA 3FSYA 4ELVA 3W5XA 1EIYB 4F7VA 4XDDA 1OPZA 3KKFA 2UVUA 1A0OB 2LVWA 4N76A 4DQQA 1TK0A 3VGVA 1RBOB 4OJHA 2BRLA 1FDNA 3M32B 2XHCA 2VODA 3QZ7A 2FLOA 3FJ2A 2Z2MA 2CUYA 2QE5A 3LO3A 4Q0BB 1J5EJ 5A8WB 2MQPA 2V8VA 2HWIA 4JI4F 4OHVA 3OV7A 5KT5A 3OJSA 1FFWB 3IRWP 1UVJA 3TZXA 1YVFA 2QEXS 2ZJRQ 2IRXA 4USHA 2J0XA 3RG6A 2IBKA 4YR3A 1HW9A 3FCVA 4CH0S 3ENAA 2CQ3A 2UXBF 2JNJA 2ZM6J 5D4LA 3RRKA 4ZJQA 1EETB 3RB3A 3CEDA 3CJTA 1HNZJ 3TZZA 3E8OA 4MKAA 4QIGA 3TJAA 3KK3A 2IY5B 3T1HF 4KY3A 1Q7LB 1FRMA 5E2QA 2HZAA 2KT2A 5F41A 2QA1A 4ECXA 2IJRA 1F9EB 3FC9A 4AUKA 1JLEB 3CO0P 2GHWA 2ATCB 4DV3J 2N4DA 1CC8A 5CAAA 1P27B 1PC5A 3DU5A 3IG1A 4OYPA 4DV1J 4EYIB 1TUWA 3G71S 4PR6A 1YJWS 3PX4A 4ES3A 3VTIA 3QT5A 2DGQA 1SUQB 2BA9A 4J9RA 2CAJA 3FBBA 2P6SA 1RBAA 1NZ8A 3CPWR 2DHXA 2R7VA 5LMUJ 4LF7F 3W63A 4M5DA 2BR0A 2L41A 4B9UA 4WK3A 2K2PA 2B56A 2DCLA 1RT7A 1HLWA 4CLUA 2EFGA 2MQQA 2QRRA 1LXNA 3KTQA 1ZPVA 3D0IE 1RKJA 3UDLA 1W26A 1AUSL 3KLFA 3LP1A 1RT4B 3CMES 1A7GE 2CVEA 5KT4A 4DV5J 4IFYA 5B0FA 4WFBQ 4Q2MA 1S0NA 2UVVA 1OY6A 2B4UA 1F60B 1M1GA 4C8KA 1U1OA 3N6MA 1WF1A 3IS9A 4UZBA 2MLZA 2R8HA 5HQLA 2N7CA 3Q0AA 1NJXA 1VQLS 2HYIB 3UNGC 4BHQA 4HLBA 4ZP6A 1JLFA 5A2QY 1S12A 4DR7J 2KB2A 4PXCA 1I94F 3R7NB 2DGXA 2NXCA 4ITSA 1X4GA 1JNRB 1N0UA 2FTRA 1EP4B 3R3TA 4CM0A 2V50A 3RUBL 2AGQA 3MMCA 5EN1A 5EWEA 3MAAA 2PD1A 2I0XA 3PTWA 5J2PA 3PW7A 1CJKB 4PQUB 1RT3B 5DLFA 1LW0A 3HSDA 3PG9A 3DLBA 2HEKA 3W9IA 3NGRA 2VFUA 1X31C 2BANA 3KUEA 1PGZA 4ZP9A 3JSMA 3CWJA 2MKSA 2AMCB 4PCQA 1JQGA 1E6VB 4ZDNA 1RHQB 4V19X 1D0EA 4OHWA 4PG7A 1V3RA 3RB0A 2V8DA 3T5HA 2O3DA 3DOMB 4U7CA 4QOTA 2XM3A 3PW5A 1NH8A 1DQ9A 1T9WA 1T02A 3AA9A 1KD1T 3M8RA 3C14A 1GXTA 2IM1A 2EXUA 2LDIA 3RR7A 4PUOA 5GAGU 2GVDB 3GJQB 5L38A 1FKPB 3BQ0A 1XMQJ 1HQUA 5CXTA 2F8EX 2WTFA 1OQ3A 4KGZB 3KLIA 4FNIA 3TNVA 4NCGA 2OFHX 2PE8A 1G1XA 4C0HA 4G6VB 3GPAA 1Y0HA 4ED7A 3B82A 1TZ0A 5B0DA 3B6BA 2MTLA 2FYXA 4P74A 1LKZA 2W4DA 3RBEA 2J9DE 5I4MA 3PV8A 2OI2A 4RNNA 4GO5X 4OZNA 5C7PA 4A8XA 1DLOA 3LOUA 1NDLA 2ASLA 3UN2A 2HHUA 4B3MF 5IOLA 1H3DA 3JYTA 4TVAB 5D77A 3JTOA 5H9EK 3KJVB 1TTHB 3P45B 4NL5A 2AF6A 2F3JA 2V63A 4P7VA 2YNIB 3QYYA 3UDCA 1OY9A 5B0AA 1FERA 4USUA 2ZZMA 4EO8A 2XSJA 1VGYA 1KOHA 4ECSA 3OBIA 1SXLA 5BR8J 5JVHQ 5KFWA 5ETPA 1ZTWA 1RYRA 4NZ0A 1OSDA 5I3PA 2DCUB 4YR0A 5D4OA 4ECZA 4RBUA 4X65J 4JV2A 4H4KC 2AGPA 2C3PA 4RUAA 4ZCIA 4ZVFA 5KFGA 4ES1A 4IG3B 5HROA 2XY5A 1H7WA 1QDUB 5L8RC 1AA1B 3U1LA 2KG0A 3WIVA 2AYEA 1X4AA 4NYPA 4ZIVA 2E7XA 3BO4A 3PO4A 4FXVA 5H9FK 2HAFA 1Y5IB 5C24A 1VLOA 4AXJA 4O44B 3D0HE 2H1YA 4XDCA 4ZPCA 4JI7F 1FD2A 3HHKA 1NK4A 3VGTA 5JJBA 2CJQA 3N9UC 3LWMA 2RUSA 2FJEB 4B3TF 4Q2LA 1ZZFA 1IKXA 1H74A 5KFOA 1VJWA 3M32A 4PXDA 2L9WA 4MYUA 1N5TA 5KFCA 1GMWD 2YWFA 1TK5A 5J2QB 4Q0BA 2XCPA 1HFEL 2B7CB 5SUHA 1M5KC 2FPHX 1CPZA 2V4JB 2ZHAA 3DOKB 3M8SA 2FVCA 4ECYA 4RW8A 2O67A 2R8IA 4L72B 2HVDA 4C11B 2KT3A 4LIRA 4DL6A 3SSQA 2LKZA 5E3CA 1SQFA 3BPSP 1IQTA 3I31A 4OI6A 2VASA 4X62J 1IKWB 4C6AA 4CO4A 3FRZA 3GYGA 3QGIA 1Y00A 3POTB 1MSWD 3FMBA 1EETA 2AYGA 1H0HB 1EKSA 5DJBA 1DARA 2DGUA 4M5LA 2E5LJ 2R3VA 2R42A 4CIOA 2WK4A 4TQSA 1KTVA 1Q5YA 3VGUA 3W9JA 3PEJA 2DNQA 2W7PA 4DR2F 2GQCA 3KXDA 1W7WA 4CYUB 1JLEA 1HBUB 4QWEA 2MZSA 1Q82T 2BJ7A 2ZDOA 3KLGA 3D9BA 2VBZA 4PYDA 1MMLA 1XMOF 3L95X 4KC5A 2HIQA 3SSRA 2E1RA 2CDRB 5HN0A 5GAHU 1QLNA 5LSOA 4KIAA 4OZLA 1YBTA 2CXEA 4BC7A 2Z4PA 1SUQA 1B4SA 2JEGA 2Z58B 4FF1A 3Q8RB 4OYWA 1RHKB 3RTVA 3OUYA 4DMZA 1LWFB 3VAIA 3JXOA 3ETOA 3D1QA 3L7OA 3D6MB 2FLLA 5K8MA 5F8LA 2WVBA 5B0BA 4HI1A 1X5PA 1LWXA 5FIIA 1R0AB 4FNHA 4NZ6A 2F8MA 1RLDA 2RILA 3GFXA 1N0VC 1RA7A 4LQ3A 1Q4RA 3JAMY 3H40A 5DM7Q 4TNOA 4F2RA 1EB0A 3G8TA 5KFYA 4LMZA 1WG5A 2XY7A 4YY3J 2XSFA 2F63A 3NBPB 3O6QA 1JLBA 3G86A 3QRPA 2YWKA 3AXKA 3CD6S 5A0YB 2VU5A 1TV6B 5DQHA 3DRSB 4LR9A 5B0CA 5D15A 1KVIA 2MDAA 3DYAA 4ZPAA 2QYGA 1U4BA 2KL8A 4P7TA 1RU1A 2IC3B 5DDPC 4K50A 3P8BB 1ZM4A 4EUVA 4WYWA 4PQUA 1QJHA 4NXNJ 1RT3A 1ITPA 3M6XA 4DZ6A 2RU3A 2HNDA 4OV1A 3KUHA 1U2CA 4B3SJ 3SCKE 2ZD1B 4UOGA 4C48A 5AJ3J 2BKNA 3VZHA 3TAQA 1RHMB 4NOHA 2KTQA 3M2RB 2DNRA 4ID5B 3H25A 4FYYB 4RBTA 4Z2XA 2NREA 4JI1J 1MMNA 5U47A 3L9ZA 1C0UA 1FE4A 2R2TA 4DR1F 2FVSA 4M8LA 5HJYA 1JK9B 4X4VA 3BYRA 5L9XA 5F9LA 3TYTA 3HD1A 1NRKA 4IQMA 3CJQA 7FD1A 2F4FA 1RACB 4FKXA 4A8YA 3R2CJ 1N33J 1BHNA 2GVDA 4OI4A 3Q8PB 5B09A 8RUCA 3BDEA 4G3IA 1HWIA 1TR0A 1HI0P 5HK4A 2EI5A 4ZVQB 3KK2B 1VRTB 5JVGQ 4EZ6A 2GA7A 3AQOA 2M4MA 2R7RA 1HNVB 1LW2B 4JI4J 3FEXB 1V5VA 2CQIA 1OPIA 2GO9A 5HMYA 3C6TB 3BN7A 2VZ9A 3K5OA 2B9YA 2OEMA 2C2KB 2CG8A 3ZNUA 2RAQA 4MJKA 4R0EA 1YJVA 3FBFA 1UAWA 2B9EA 3KJVA 3DMJB 5KFPA 1W2IA 1RQ0A 3ETMA 4J9MA 4C8YA 3LA0A 3M05A 1QSLA 2GAGC 1FKAF 3UCZP 3TA0A 2M3DA 4MAKA 4MT1A 5HJXA 3K59A 4ECTA 4DSLA 1VQPS 2MKYA 3MFIA 4DUYF 2X3DA 3M6UA 4K5RA 1FRKA 3RW6A 3ZC4A 2CNKB 2OP5A 3QZ8A 4YB6A 5CD4A 4Q44A 2A6MA 2QA4G 1R8AA 1RWMB 4Y2MA 4B9TA 4ECWA 5K14A 1K1QA 1MWZA 2MMYA 2NPFA 4PWWA 2LA4A 2KYZA 4ZLNA 3D68A 1NLKL 1S9GA 2J6UA 3PIOQ 4CO0A 4DR5F 2W01A 3W3SA 1VDHA 2Y8WA 4LF7J 1GMWA 4I0WA 1FWKA 2CRLA 2FC8A 1XNRJ 1K44A 4DHVA 1HWUA 3MCNA 2EFVA 4LF6J 3H7HB 4N8NA 1VQ4S 2QTWA 3JTNA 4USWA 2E9ZA 2WHOA 3Q8QB 2GO8A 1UWBA 3CJ0A 2DRBA 3GSIA 2HAIA 1S1WA 4LF1A 1XIQA 2F65A 3RBZA 3K5PA 5J2QA 3CC2S 1FRHA 4I69A 4LREA 3H59A 5C2GA 1RP5A 2YNGB 2LECA 3FBEA 2RMLA 2K7KA 1X4BA 1I94J 1R8PA 3P3DA 5KG6A 4RUBA 4C11A 2HPUA 4GKJF 2GS8A 1B64A 2FDNA 3FBCA 3D6FB 3NMAA 1Q81T 2QLBB 3ILIA 2PMZD 4RPFA 3SCJE 1KKHA 3H2LA 5I3QA 4LFAF 3ZZPA 3O3LA 2DGTA 5F8MA 1SC3B 4ZVPB 1VQ5S 7AT1B 2WONB 1IBCB 2V2VA 2JZ5A 1DRZA 2YX7A 4Y2AA 4F4WA 2HHVA 1VOMA 2W1BA 1BE4A 1WOPA 4ZLLA 3MM5B 4DOZA 4QQBA 4RX6A 1HBUA 4NLTA 4MK8A 2K1RB 4CT8A 5E3PA 4OJGA 3R8YA 3WX4A 3HZGA 3ZZYA 2IRUA 2HW3A 5D6GA 1TL3B 1HNXF 1RWNB 3H5UA 1ROFA 4FYXB 1HNWF 1YGYA 5H1SV 2UUTA 3MM8A 4M1KA 1PAEX 4N77A 3N6NA 4BWMA 2V2KA 3PFEA 4TU7A 5KFIA 1GEHA 4RNMA 4MYTA 5FDLB 2IA6A 5LXRA 4ZLPA 4JOUA 4B3RJ 2DVIA 1ZAWA 1LWFA 3EVMA 3BS9A 3RBDA 1T9UA 1RHUB 3CXCR 1R0AA 2H48B 3M8WA 5BJRA 4TXSA 2H9ZA 2EK6A 1T9VA 1RYSA 4OV6A 3DLHA 2V9KA 4WXOA 4B3MJ 2HKEA 4DFPA 2ZOMA 2Y0SD 2D7SA 1BY9A 5KFLA 5KFEA 4DSIA 5KG7A 2UVRA 1VC5A 4CO3A 2WBMA 5ETMA 1LOUA 2VPZB 3NBPA 2XMKA 2VG5B 2H5EA 1P8GA 3GIKA 4A48A 1TV6A 2RB7A 4D3GA 3IM8A 3MR5A 5AE2A 4PRFA 3VAFA 2WVDA 2VONA 2YH1A 3E2EA 1KLNA 2AQ4A 1RU2A 3QSIA 1C1BA 3MAQA 1WKKA 3LQVA 4O3SA 3MEEB 1WEZA 2XTJP 1FK9B 4CLFA 3ISND 5C25A 2JC1A 2B5JB 2H5IB 4DN9A 2BQRA 3G4SS 3MWBA 2QGFB 2RUGA 1SQGA 3NCQA 2BJEA 1RCXB 3QWUA 3GP9A 1B0PA 2MY8A 3NY0A 2ZUAA 2G1DA 2YWGA 4IKAA 2RT3A 3S6EA 4JI7J 5EHHA 1PBUA 4C9DA 3DRRB 2EBGA 3OJUA 3TZYA 3TQ1A 3BDPA 3UVJA 3OW2R 3OTOF 3D3BJ 4L73A 1JNZB 4DXLA 4B3TJ 4TU9A 3B4MA 1PO6A 4KHMA 4Y2IA 4K4UA 4RUHA 4UY85 1MWYA 2ASYA 5CHCB 3KK2A 1UL3A 2J6TA 2MQ8A 3GYXB 3DFEA 4UTGA 5DGAA 4F25A 1LW2A 2FHOB 4ED5A 4F0MA 3NGSA 2F7VA 4QIEA 1XNQJ 4QYZK 4YN3B 4DN0A 2ERRA 3C6TA 2ZZNA 1GAOA 4YB7A 3BH6B 2OGUA 1I1GA 1FNMA 2CJXB 4PAAA 2BYCA 5L39A 3IMQJ 5D3GB 3N5BA 1U49A 1U1MA 3ISNC 4X64J 5KFVA 3T19A 1AZSB 2LP4A 1QY7A 4ZITA 3R1LA 1REVA 5KFJA 4OX7A 5H9EJ 1PBAA 4F67A 3SQGA 1WTFA 5CYJA 1N4LA 2NUUG 3DMJA 4ECRA 2EKNA 2JJ4D 3DC2A 1FXLA 4MKVA 2DO0A 3I55S 2R7OA 2XI2A 1KVJA 3L7UA 4DR2J 1S1UA 3AXMA 4NLPA 5DZ6A 1H2TZ 1J27A 1U6ZA 2C2DA 1SQEA 4ED0A 2W4PA 2AEJA 2MGZB 1PCAA 1PYTA 2K3KA 3DLEA 1D9AA 4J9NA 4W4MA 3R27A 4Y28C 4FYDA 1F5AA 2VJUA 2ROPA 1MU2B 4O3PA 3E01A 5FLXY 2G0CA 1ACMB 4F3OA 3EPIA 3CGIA 3PW2A 2WOMA 3I32A 5ETTA 1U8SA 2CZ4A 4EI2A 1YSJA 1RB0A 2Z30B 3QT6A 3H8YA 4RZRA 5T7LB 1E6YB 5H9FJ 4CZCA 5KFHA 1D8YA 2YKAA 1RCOB 1JLGA 2YKMB 1GFWB 1TMMA 4KH1B 2FIUA 1WHXA 3EZ5A 2XS5A 4PEOA 2YQ1A 1R6VA 4RW9B 2MZTA 2GIFA 4XAKA 1DFDA 2KFYA 1MG7A 2ZOGA 2FJAB 4TY9A 1S59A 2N3OA 2G4BA 1YBUA 3D6TB 1FJGJ 4ED6A 4QZVB 3CMQA 4OYAA 1WEYA 5KFQA 1Y7PA 3SMZA 2YTCA 3PYFA 3OHAA 4UUWA 1YKWA 3FDSA 5HMXA 1D8ZA 1HI8A 1EKRA 4RJVA 3EICA 4LF9J 4QPTA 2KU7A 3S1TA 4R5PB 1S6OA 1RAGB 2HQFA 2KRBA 4CTAB 3OVAA 1DQ8A 1HBMA 5AXNA 1T3OA 3TA2A 5HQMA 2QT7A 3WHIA 2CWXA 4TYAA 4I64A 2Y3YA 1KN6A 2V94A 3NOGA 2OD4A 5CYQA 3IM9A 1VQNS 4FF2A 3MUVP 1HHSA 2W9BA 3FGVA 4DR1J 1S97A 3EVWA 4TLRA 3BSNA 2DH9A 4CP5A 1SKWA 1EX8A 2KO1A 4EBEA 2F40A 2RF2B 3V6DA 1WOOA 1TL3A 5EGYA 1I6JA 3HM9A 2HG4A 2WSEC 3I4HX 4CQ1A 3VAMA 1HBNB 2B0GA 3KJQB 3B8HA 4C3KA 4LVNP 2MZJA 1S1VB 2DPIA 1SJRA 2FJDB 1KONA 4ZP8A 5J2MB 4DDFA 2CADA 3NGKA 3PRDA 4C4WA 2E9TA 1X9MA 3RB6A 1U02A 2P9EA 1QVFR 3ZO7A 4ANCA 3HSJA 2EFNA 2U1AA 1GQEA 4JI6F 4EZ9A 1NAQA 3CJSA 3PX0A 3AJ2A 4OZ2A 5IQ6A 4BCAA 3RR8A 2YWWA 3MM9B 2FVQA 1X5TA 3ILJA 4BBYA 2FB0A 1KHVA 2A18A 2LA6A 4WFYA 4DU7A 1U8WA 2AKWB 2V68A 4DV2F 2AEFA 4IG0A 2E7VA 2I2YA 1EZZB 3RJMB 5KFTA 2CJYB 3OTBA 4LFCF 2AYMA 4TY8B 3V5RA 3K58A 2BX6A 4DUYJ 2R7XA 3GMGA 1IKYA 2CZ9A 3I5CA 2V8GA 3M6VA 2V34A 4X4SA 2OH2A 2NXEA 2DR5A 2CA9A 4AFFA 3MHYA 2VFSA 4DR6F 2Y0BB 3VAGA 2X1GA 3M2UA 3MEEA 1NHUA 2DHHA 2HLTA 3Q83A 3T9ZA 1HNIA 2V9WA 1FK9A 1YWXA 2N82B 2VQEF 3E3XA 1VCTA 2HVZA 3CDWA 3Q8SB 1RGVA 2EFOA 5F8NA 1HWKA 4DR5J 4QU7A 3T5LA 3OXFA 4U95A 2Q6CA 3WQPA 2QA4S 1X4HA 3TUPA 3NAHA 3NWGA 3KUGA 2DR9A 3HHLD 1N5VA 2BE7D 4CNZA 3UPFA 3KWMA 4C8ZA 3IC1A 3EGWB 4RW6B 1NCLA 1H73A 1VBKA 4WKYA 2VFVA 3ZTRA 4ENOA 3HFVA 1DTTA 1TMJA 2VDHA 1RWXB 3N6LA 1VC6A 2D69A 2DNPA 3GV7B 4Y34A 1YX2A 3FK4A 1GTEA 1OSCA 2K7JA 1YQHA 5K8PA 2CQ2A 4OI3A 1X0PA 3KG0A 1YJTA 2FJXA 4QBUA 2HBQB 3ZZRA 4Y2KA 1YRTA 2CJBA 4XIUA 3JQKA 3J81U 1DTQA 1RAHB 4AQYF 4HT7A 3O1LA 1NSKL 2VC1A 2QA2A 1URRA 1X4FA 1YJRA 4C3LA 3CCTA 2JLFA 4A8SA 2AT1B 3HF5A 1U1KA 2MKCA 4J9SA 1URNA 5M2RA 1U1PA 7FDRA 2GC8A 3UN3A 3W60A 1WF2A 1PAUB 3QPIA 4JI0F 4O0IA 3DLLQ 2CPIA 3VQTA 1N6QA 1UFKA 1TKTA 2C2ZB 3DNCA 5KG5A 1JJCB 4ZK7M 4ECVA 1B0VA 3BKFA 5M2UA 3THPA 3D7SB 4KGVB 1UVMA 2KXNB 2M7SA 1W25A 1NSPA 1M0SA 4NRUA 2ZBIA 4HHJA 3EXYA 1P9YA 3DGPB 4K8RA 4PABA 4MFBB 3J7Z5 5D8HB 1HNXJ 2HWTA 1GTHA 2XLKA 1FRJA 3GV8B 4M5MA 3IRXB 3BSAA 1MU2A 1HNWJ 1JLQB 2KXFA 2XNQA 3NS5A 2J8AA 2XGPA 2CKWA 3QFWA 3W61A 1Q5VA 2HHTA 4OI2A 1HIYA 5LJ3Y 3C16A 3M7VA 1RAAB 3LGHA 2C22A 2PFFB 2HMIA 1Q95G 2LLZA 2KN4A 1E6YA 4HDGA 5LXYA 3BPDA 2DNOA 3LTOA 2FJWA 2JHEA 3DOLB 4QWCA 3ZFVA 4I67A 2BABA 3IP0A 4OYOA 3AOBA 2QSWA 3JQMA 5KFDA 3I0RB 4LVOP 2IMOA 4GVLA 2IAJA 4DPXA 1SJ3P 1R7IA 3QJLA 3UD3P 4KHRA 1NK6A 1RISA 2DNNA 1JWWA 4KV8B 1H72C 2VA2A 5KFXA 1N8RT 2GMHA 2YKNB 4Q8EA 2VG7A 4NI2B 3AAWB 1VQ9S 5GVQA 1WDDA 1K47A 1Q16B 4LFBF 2YPYA 4ED2A 1TP7A 1OY8A 4P72A 2D41A 3OFEA 1NB7A 1O5JA 2KFZA 3AA8A 2MQMA 4FXWA 4R5PA 4DSEA 1N34F 2MJUA 1KS2A 4NXMJ 4DL3A 4CTAA 2VDIA 4DSFA 2V8PA 4WU2A 3HDSA 2VQFJ 2UXDF 4ZHRA 4OZ1A 4B17A 3BSOA 4QW9A 3CCZA 4J7CA 5EWFA 1TELA 1YTYA 3N5FA 1N5YB 2HIYA 2B8QA 4RW4A 4Y0FA 4L76A 1YG0A 2WZ1A 3H90A 3BB5A 1IQZA 4CDIA 2XMWA 4K0KJ 1KOOA 5LMNF 3MOZA 2KH9A 3ZNJ1 1NM2A 2LXFA 1FRXA 4KQZA 3PFOA 5E7OB 1YJNS 1QE1B 4ECQA 3W2WB 3OTOJ 3D5MA 3NCRA 1IR0A 3AD7C 3G6ES 4WF9Q 2CQGA 1FFGB 3TUJC 3PKYA 2YBVA 4PQAA 3MEKA 2OD6A 3FZBA 2C3MA 1BQMB 4DR4J 2I1RA 2X7IA 1ZA1B 1UEKA 4AT1B 3TWZA 4WZMA 2CQ4A 1NJWA 3GE9A 3PJ9A 2PO4A 3GU0A 1JMTA 2DT9A 4NLUA 4KB7A 2UV8A 4RNHA 3N01A 1T8EA 1X4EA 2QMUB 3CC7S 5HBMA 3SSSA 3MEGA 2IIHA 2CQPA 1N32J 4YEAA 2MZ1A 2CPFA 2XULA 1K1SA 2VG6A 1XWLA 2X51A 1FEHA 3MM9A 4A8FA 3AD9C 5B0GA 1S57A 1EQ0A 2CVIA 1IR1A 3TA1A 2Q6BA 4J37A 1QAJA 1RT7B 5GADI 1CJUB 3PYDA 3BV8A 2W2QP 2GIQA 5IV4A 1UZDA 4TU8A 2XI3A 2ZH9A 2G0IA 3MR2A 4DUZF 4TY8A 2LEAA 4LF8F 3IGNA 3LP1B 3HHLA 3K7RA 3HULA 2MB0B 4MK7A 4IFYB 3AB2B 1K0TA 2G1HA 4C7QA 5KT3A 2YWEA 2P8IA 1QTNB 2GAHC 3CIMA 5JUMA 1SC4B 4LRFA 3QIPA 5G0RA 3UDVA 3DN9A 1ZAXA 4ID8A 2OPQA 1NO8A 1VFJA 2Z56B 2WSFC 2O01C 4DU8A 4N8OA 3AH6A 4NMXA 4DV7F 3HP6A 1FRLA 2CIMA 1RAFB 2RRNA 2XHWA 3H2UB 2VICA 1RTDA 3DU6A 3MMCB 4MKYA 4QJVA 5E3RA 2WSCC 3LPEA 3Q8UA 1BLUA 1TFYA 4RW6A 2HFZA 3SDEB 3A12A 3C6UA 1S6QB 3A3PB 1C2PA 4KE5A 4KO0B 5BYQA 1WORA 3TQEA 5L1LA 2AZ1A 4M5HA 1NPRA 2CPEA 2ZC4A 2HFSA 4D3HA 3CJ3A 4I68A 3IAS9 1CJTA 2RS2A 4JI3F 3D67A 4WWSA 1KQKA 3ZTPA 2MKJA 2VFRA 4GKKF 4L3KA 1N88A 2J8SA 3HHNB 3C14B 3MURP 1TK8A 1SH3A 4ETZA 1WC6A 2UV8G 5IXUA 3K2YA 2KT5A 4QYZJ 4PUOB 4ZPVR 2FD2A 1HQUB 3P96A 3HFKA 3KLIB 3M4XA 4NCGB 3OL8A 3E51A 4OHXA 3VGSA 3VAKA 1YITS 4E0DA 1I3OB 1WC1A 4DEZA 2ZH6A 2XG8A 2RDDA 4CLKA 4CLTA 4EEYA 3CJ5A 4DCOB 1JLCA 3CT9A 2DBBA 2MZQA 1RBLA 2N4CA 3HT3A 3PDNA 4OJ1A 1P9QC 3AQPA 3MD1A 1CVJA 2ZC3A 3KDOA 1M5VC 2NXJA 3CB4A 4DUTA 4WTOB 4MFBA 3KG1A 1IBMF 3MPDA 2K8GA 4IFVA 4IQXA 4JYAJ 4F26A 1HD1A 3DRXA 4RLEA 3T6JA 3R9LA 1KVKA 3W64A 3CD0A 4WK1A 2XSJB 2LQ5A 2QJ3A 3RGIA 2R7QA 3IN5A 3VWSA 1JLAB 2DNLA 1O6XA 1VHIA 2VKZG 2LQJA 3CCSS 4Q8FA 2XNRA 1A9NB 3RZAA 1YIJS 2GQ2A 3CDAA 2J0QD 3K8WA 2F4VF 2A2CA 3D54A 1WEXA 4UOHA 3EXCX 4BDPA 1IBLF 1Q79A 3HO1A 3I0RA 4F0HA 1H7XA 1X4DA 2LXIA 4LT6A 5F9NA 1KFDA 2GX8A 3G8QA 5C24B 4WE1A 1U6BA 2MHNA 5GAEU 4DV2J 5DO2A 4GVBA 4CO5A 2ZWOA 5DLGA 1PSDA 3OL6A 4LFCJ 3QBCA 3RRGA 5A8RA 2UUCF 1J5OB 1XK8A 4NI2A 2RD5C 3I4PA 1T11A 5HMWA 5T14A 1B7YB 1S4EA 1WC0A 3SYZA 1RAJA 3KHHA 2FLNA 1NNDA 2FUG9 1M1HA 4QWBA 3EGVA 1IKXB 4O23A 2C1EB 5JXSA 4DR6J 1V3ZA 2H54B 2HHSA 1S7HA 3MR6A 3GZ7A 2VOPA 4DJBA 2FY8A 3CJ2A 4LF5F 1I51B 5DGBA 4IH5A 3KLHA 1S4FA 1FDBA 3RAMA 4RW8B 1R31A 2GHVC 3C66A 1N5YA 4RNOA 1RTIB 1UFLA 2UUAF 3FFIB 1F5CA 3PEHA 2HNYB 2ZJQQ 3SCIE 2MKIA 3N4WA 2QLXA 2G9OA 3MEDB 3GR0A 3JAMU 4DPOA 1C1CB 5F8HA 1QE1A 3W2WA 1T0TV 3H0PA 4J9OA 3BSCA 2PEBA 2M8HA 1NK9A 3Q22A 3DRPB 2BM1A 2GQQA 2ZEJA 3K5LA 3VVUA 4P10A 2A2DA 4OI0A 4X4QA 1UA0A 3I56S 2KJWA 1BQMA 3CTRA 3IFEA 4N41A 4ED1A 3HX9A 3S7RA 5A6PA 4KH0B 5KFBA 3KLGB 1XN9A 5HL7Q 2EFQA 2MEWA 4RW7A 2W2NP 5KT7A 1FDDA 1AFIA 2CPYA 2M2BA 3MMJA 3RRHA 2COLA 1ZOTA 2K06A 2JEIA 3PY8A 1S10A 1S76D 2KRRA 2E5HA 3HT0A 3EPGA 1SJ4P 4JI0J 2MLYA 1Z4UA 3OUYB 1CBKA 2XO6A 3UWTA 4ZVHA 4R25A 1RWKB 4DS5A 1CJUA 3ENWA 3A3OB 3RAXA 4JI2F 3M30A 1HKAA 1RK8A 3P4UB 2QLFB 1T7PA 4U67Q 3MECA 1QD1A 4NA2A 3AB4B 4ZVSB 2C28A 2AYBA 3L7PA 4K4TA 4O4RA 5ETRA 3LUYA 1CEZA 2AX1A 3LGNA 1YRXA 4A8MP 3VAHA 4LRDA 8ATCB 2HHXA 2R7WA 1CJVB 4I6AA 2F5GA 2UUWA 3CD7A 4KR0B 1IWAA 4OYZA 1JLBB 3KMSA 3PCOB 2DR6A 1L3VA 1N5SA 4OJ3A 2EFPA 4C8OA 3AOAA 3M2VB 3S01A 4M94A 2IJFA 5GMDA 3DYAB 4I6YA 2QFJA 3EX7B 1VQSA 1GXUA 4OFZA 2B9XA 5HMZA 4O3NA 3KOAA 1RT5A 1FRIA 3H2VE 5KOWA 5AXLA 3PACA 1OQ6A 1MNEA 3SDEA 4GC7A 1QAXA 2HNDB 2J5AA 1S6QA 1WKLA 3DDKA 3I9ZA 1KHWA 4UOCA 3T3FA 4KO0A 5CQGA 2HSEB 4FXDA 3AD8C 1QAYA 4IRKA 1JXEA 1JKHB 9RUBA 3HCXA 4YS2A 4M95A 2ZE2A 3EE3A 4I6WA 4OLOA 2UP1A 1C0UB 1H2VZ 1XERA 4OHZA 2QSFA 3A4TA 4NLSA 2RRBA 4LFBJ 2BJ1A 2ZFHA 4LSZB 2A6OA 2VV5A 5E3AA 4A47A 4I2PA 2OIHA 2LQ9A 3HVAA 3MR7A 1RWVB 4RO0A 4QR2A 1FE0A 2QIFA 4UF4A 1Q8IA 2UU9J 3HHEA 2DH7A 2W4CA 2Y1LB 4L74A 3S8SA 2UXDJ 3NCPA 4ER8A 1KC8T 5LMUF 3TP2A 5IT9Y 1IKVB 2WW4A 3ZTQA 2BXJA 3GFZA 5IS2A 2JSXA 4C97A 4F4ZA 3MMAA 2XZDB 1HA1A 2E5GA 3QFHA 5L1JA 1VK8A 3QMQA 1QUVA 4ED8A 1TKZB 2O1PA 5LMNJ 5AXMA 2Q66A 1SVDA 3W8PA 4TQRA 2QN6B 4P2XA 1X5OA 5BYRA 4KRWA 3MFHA 3M6WA 3KJFB 5D0HA 4F36A 4IO1A 1FJCA 1REGX 2JRSA 2DY9A 5IM0A 3VZIA 2HHPA 1KP6A 4FKYA 4USVA 2R2UA 4IOCQ 3JB9k 1DAXA 1F2GA 2B51A 1NHKL 4RU9A 3CCJS 1RT6B 2HFVA 2KJVA 4DR7F 1KEKA 5GAGI 4FN5A 1JLAA 4K4SA 3TX0A 2ASDA 4GO7X 4P9SA 4OLPA 4HDHA 5K8OA 2DIVA 2GV1A 2L48A 5K14B 3ILLA 3R1HA 4ZVEA 3SEOA 4AXIA 3P6YC 1S9GB 2XS2A 3R7SB 2CJ9A 3MAHA 4DL2A 2GJ2A 3OR1B 1X4CA 1FEEA 1GH8A 3MPWA 3SXLA 5HATA 5AE1A 2AJ0A 3PM9A 3PR5B 2ZITA 5B7WA 1LFPA 1Q1KA 1ULRA 2CJKA 2CQ0A 3GIJA 3GIIA 2PEHA 4NMLA 3OSNA 1J5OA 3FRYA 4RL1A 2HVIA 3GYNA 4LF8J 2ZBQA 2E1CA 2VD3A 4AYBD 2IPOB 5F3TA 4I7FB 4B3OB 1Y4ZB 1EARA 1OIAA 1UWBB 1NH7A 3PHEA 3QGPA 1N5QA 1S1WB 3NOCA 3G6YA 4RKUC 1UMJA 4ANDA 1Y5NB 4C3MA 1O51A 2KG1A 1H2UX 2V0NA 4ZCKA 4K2JA 1SCJB 2OTLS 3BQ2A 2HHHF 1RT2B 4DV7J 3C19A 1CQNA 3PNIA 1GMVA 4XPCA 2C3OA 4ED3A 1RTIA 3BYPA 3FFIA 2HNYA 3TUIC 4ATNA 4LIWA 4LF4J 3VR1A 4B9VA 1W2BR 2QO3A 3U7JA 2NQPA 3MEDA 3Q2TC 1C1CA 3ZXWA 5CCLA 2HFNA 3CJRA 1XBWA 3HD2A 1KBRA 2QYCA 1R43A 4DFJA 1U09A 2CWKA 3DRPA 2NYHA 4Z7YA 3A8KA 1ZM2A 1KSPA 3W1YC 3OTCA 4K4XA 2IMWP 4JI3J 2Q3PA 4X4OA 1HL6A 1U45A 2P9GA 2DGWA 2NCKL 4GKKJ 4Q5VA 4DR3F 1HD0A 2PA3A 4NLQA 2V69A 3LGMA 2M5YA 2J7WA 4WYLA 2RH3A 3MM8B 2P9CA 1S99A 4QYRA 3U27A 1DBDA 3C3LA 1S0VA 3GJSB 3K89A 4ES2A 4ZLJA 2B8PA 1L3SA 3DGVA 1PJ7A 5ITHA 3R2DJ 4QU6A 5E3QA 1FI4A 1BUXA 2L9NA 3OPKA 2B6AA 3GQCA 3MUMP 3N28A 3H98A 2DKOB 2V67A 2HQIA 3O5TB 2DTJA 3GLJA 4G1PA 2LU2A 3EVOA 5F8JA 5ETOA 4UY8T 1T03B 4DL7A 4LF2A 4OI1A 3J81j 2RQMA 2XZTB 1SBRA 5KFKA 4N47A 3EJMA 3Q8VA 3GG1A 2E1MC 3M1VA 4Z7CA 3PW0A 1QSYA 3HFZB 4NEZA 1CJVA 1AROP 1YJUA 1AYEA 2W2MP 4B02A 2BV3A 1O8BA 2MSTA 3VQSA 4RNFA 4F4XA 5HVFA 3M8PA 3UD4P 1U0HA 2CQCA 1Z2ZA 1VK3A 3BR8A 3M2VA 5L46A 4WIIA 1EHWA 3FEYB 5KFRA 4CM2A 2HZCA 3LF0A 1BQXA 1WC5A 1C1BB 1KDNA 2XYPB 1KRPA 4X62F 2F4VJ 5LJ5Y 5ETSA 1RABB 4C2MA 4USTA 2RNEA 4P52A 1IBLJ 4MTPA 3A13A 5C25B 4EBDA 4JV5F 2HFUA 1K8AT 2G13A 2E5LF 2P5VA 2OHDA 2W8KA 4P6QA 4ETXA 3HVTA 1UA1A 4KHPF 1J2VA 5DS7A 4ILLA 1JKHA 2AU0A 3H5SA 2XYHB 1CS4B 5IV3A 3T1YF 3BO3A 2RDJA 2UUCJ 3Q89A 1D1UA 4GMKA 1G2EA 4JV1A 3SI8A 2H51B 1S0OA 2D9OA 5B0EA 3UVJB 1S1XB 2CQBA 1MN7A 1QSSA 5FLXU 2OPPA 2ROGA 4BS2A 3D0GE 1NSAA 5KTQA 4DQIA 2PC6A 2WB1D 4BWJA 2NXUA 1LXJA 1O0PA 2ZWPA 4EU0A 5IC6B 2IHR1 3CCLS 4PG6A 3BZQA 1X7VA 1XMBA 1Z1ZA 3FSXA 4LUBA 4F02A 5CYMB 2WVCA 3HSZA 1HMVA 3KHRA 4K4YA 4F50A 4LF5J 2ATLA 1IKVA 3THTA 3ZZUA 3BGOP 2RQ4A 2EKYA 2M0GB 1XR6A 3W2VA 4DZDA 4ZA1A 4WIQA 2V2ZA 1SC6A 3UW1A 3AFGA 4LRBA 1GT8A 4PG8A 2XBPA 3QO9B 3RBXA 1RWUA 1MROB 2CNLB 4DLGA 1IM4A 4ILMA 1ELOA 3PKMA 1AT1B 1TKZA 3K57A 2UXBJ 2YKQA 2GHPA 2AJ4A 3RW7A 1HPZA 4CH7A 1REVB 3BN4A 2JDJA 2LEPA 3SQGB 2KYXA 3T1HJ 3KK1B 4K4WA 3PYEA 3TVKA 5I42A 2VJVA 1S1UB 3NNAA 2HHQA 3C8YA 5HI7A 1YI2S 2M88A 2UZAA 2XQCA 4R0JA 1RT6A 2QV6A 2EG2A 4MMOA 1VR6A 3JSRA 3DLEB 5C42A 1R27B 4ALZA 3NP5A 4YUDA 3BGRA 2VA3A 2PN6A 3J81Y 3N79A 1WF0A 3E01B 3LH2S 5KFFA 1KQSR 4OX9F 4QIFA 1QUPA 5F3ZA 4U8VA 1FO1A 4ZPBA 2WOMB 2OLWA 4HVZA 3DLGA 4NLRA 2NZ4A 1FKOA 4JI8F 4YFUA 2G2ZA 4B3SF 3OR1A 5AJ3F 4N56A 4KPYA 4WBFA 3GILA 3EDRB 1JXLA 5ETKA 4P75A 3MCMA 1CULA 2MSSA 1QTMA 4M5NA 2EW9A 1S6PA 1JLGB 4A8OA 4ZPWR 4KBIA 4WP3A 2E9RX 3DLJA 3G82A 4OIXA 4ANEA 2QX0A 4NEYA 5CZXA 1RZMA 4NE9C 2BACA 4MIAA 2HQGA 5MAOA 3R97A 4I7FA 2PMWA 4B3OA 2PFDA 2RHSB 4NLXA 1FJ7A 4KGXB 1N33F 4V19J 2IFXA 2FZKB 1UW4A 2KM8B 1OMSA 1GNKA 1TFWA 3MOJB 2HS0A 3D1HA 5DZ7A 1TKXB 2V8HA 5HQ8A 1NKEA 1TL7A 1RXOB 3BEGB 3J7AN 3V6KA 9ATCB 3OTEA 4FPRA 4DF4A 4ICLA 5A76A 3CULA 1RT2A 3IXQA 4U9RA 3TANA 3IWLA 3IWNC 3OSPA 1S1TB 2JH3A 3DXSX 4IUFA 3MMBB 2GMLA 3EGNA 2UUBF 2WB4A 2C3YA 1IJEB 3KLEB 2AP6A 3JSYA 1U0SA 1G6BA 1NJYA 5DDOC 1HBMB 3K17A 2CPXA 2GZOA 3DKDA 4XK8C 5KOXA 1T9XA 2OEJA 4WFNQ 1VIXA 5CA5A 2FQQB 1F6TA 1S79A 3LAKA 4C8MA 4OZ3A 3T1AA 2DITA 3HXMA 2OPRA 5CYQB 1FNXH 2Z0GA 3IA0A 2F9DA 2HS3A 5BYSA 2W9BB 3KJNB 2WAQD 1VRQC 3KLVA 3NWRA 3OLAA 4M5GA 3D1OA 4QIWD 1DHMA 2YQ3A 1VBZA 3V6DB 1VHFA 3DI6B 2R9LA 3M8YA 2SXLA 4J5OA 1AXQA 2WRMA 3OVSA 2HK2A 1DQAA 5KFSA 2HURA 1RTJB 3SIPB 2OSRA 2UXCF 3NXZA 3TX8A 1SL2A 3TOQA 2EG1A 1WKJA 1KFSA 4FBUA 1B99A 4XPEA 1XNRF 4DPTA 4C0OC 1VQ8S 5D4NA 4UUXA 2YWHA 2AWZA 4LF6F 2YX4A 4W90B 2YVSA 5CH7B 4FF4A 3DHXA 2KM8C 5HLFB 6FD1A 2DIUA 1RAEB 1GX5A 1RT1B 4ZVTB 3C46A 3VCDA 5EX0A 1T03A 4LQ9A 2FY1A 1M5SA 2BJ8A 3T6BA 2RJZA 3HJVA 4IG0B 4EMDA 3EWGA 4OZ5A 3FVYA 2AGOA 4H4MB 1NK5A 3NS6A 4KFBB 1P6TA 5I3UB 4ZCMA 1XC9A 1IKYB 2OPSA 2R8KA 2D3ZA 2BE2B 3D6HB 1D3WA 4N5SA 2ALZA 1Q8LA 5KFAA 4K4ZA 1Y5LB 1UVNA 3BBCA 1JJHA 2I38A 1RTHA 4DI6A 3M2UB 2M8DB 1HNIB 2QL9B 3F0NA 4AD6A 2JVOA 3G87A 1KLMB 5ADZA 3PJWA 3AT1B 3US5A 2HLUA 4ELTA 1FJEB 3P5BP 2BBEA 2AJQA 2HGMA 1U26A 2E5IA 3QJJA 1HQEA 1CS4A 2KXHA 3FUYA 1AB8A 4FYWB 2I9SA 2DNGA 1OJ4A 3FCHA 2R4FA 3UD5A 3J7ZT 3NKYA 1RADB 1DTTB 1S1XA 1NPKA 1VIOA 2J6SA 2VIHA 3SFGA 2JLGA 3VV2B 4X4UA 4DFKA 5D0GA 2PI4A 3CCMS 2AIRB 3LP0B 2C2RA 4UT4A 1FWPA 5CYMA 4R8UA 3OXGA 2D3OR 4B3RF 2BW2A 2HHHJ 2J0WA 4PXBA 2CQHA 1DTQB 4ZPTR 1VYAA 2XMJA 2IBOA 4HACB 1DY3A 5CZVA 2CNOB 3QO9A 1MROA 3TAMA 4LR7A 2DJWA 2ADCA 1WHVA 3FMWA 4MIWA 5T41A 3HJFA 2N7YA 3A1YG 4IH7A 2HRYA 4DL4A 4H4OA 3CJ8A 1AFJA 4OYIA 4H54A 1IUJA 1N6QB 1TKTB 2HNZB 4CO2A 3T5JA 3KK1A 2B4OA 2ROEA 2OFGX 1U2RA 4WFAQ 3EYZA 2MQLA 3JS9A 2FGOA 1K73T 4I4BA 4DX8H 2OELA 4RR5A 4DV6F 1U1NA 2IDEA 1NK8A 4ZVRB 2W24A 1C0TA 3Q86A 3BGFA 3QQCD 1NPPA 2RQCA 3I9V9 4DR3J 3TVZA 4ZJOA 5KG1A 2LYVA 1XMOJ 2DHSA 3EDQB 2PGCA 2P2CB 1IWGA 2CQDA 1S48A 5J1EA 1PJ6A 2CYYA 3MTKA 2CDQA 4A8WA 2V4RA 3SV4A 5IWAF 1XR5A 5EUHA 3IAM9 4LJMA 2IVFB 3ADAC 3C16B 3MD3A 4HYKA 2GIRA 2HMIB 2GMJA 4P2FA 2RHQB 4NLDA 3FSIA 2XMAA 2HQ3A 2HK3A 4G1QA 1KTQA 2GVZA 4QCLA 3LP2B 1TQLA 3L3CA 3ITHB 1SJQA 5CCMA 1NKCA 2OMOA 4F3QA 3QIDA 2DHGA 4LRAA 4TKTA 3CD5A 4EFAC 1FDAA 2MQNA 2J9CA 4CRJA 1UPPA 2IAJB 4NRTA 3CCWA 1MW7A 4CT9A 2ZH3A 2EPIA 1YLXA 1FXDA 1L3UA 2YKPA 3EZUA 1WUUA 3DLKB 1TKXA 2IVMA 2YX1A 1N48A 1RHRB 2YXLA 3TR5A 1XJWB 3TI0A 2VG7B 3CDBA 5A8WA 5K9FA 4OL8A 4WFXA 1TL1B 2ZUGA 2W9CB 2BKOA 4DBQA 4X66F 2NSBA 1XNQF 3QLHB 2LQ8A 3HHDA 3UCUP 1S1TA 5LL6d 3MMBA 3SFUA 2ZH8A 2R8JA 1Q8KA 4J90A 3KLEA 3UFCX 1K0VA 2CPJA 1WHWA 4IO9Q 3MM6B 4X64F 2LEBA 4ZHRB 2JVRA 4JV5J 2Y1RI 3I87A 1X8DA 3KHLA 3V6HA 3CCRS 1X9SA 2EK1A 4KHPJ 1UP1A 1R0CB 4PXEA 2QMXA 3HKWA 5G4DA 2FZGB 2HZVA 4RW4B 5HANA 2POKA 1NZAA 3T1YJ 2ZH1A 2DGVA 5GMEA 5A8KB 3X1LB 4U7UD 4G65A 4O3OA 4S0MA 1RTZA 1XTZA 2I6WA 2J9DA 2ZH5A 1WDTA 2XMTA 2Z2LA 1FFSB 3DI6A 1HHTP 1M90T 2ZNZA 2DH8A 4C8NA 1VMBA 3DCAA 2AD9A 2ILYA 2C2MB 3ULHA 4JBCA 1ZM9A 3CDEA 3PR4A 1L5UA 1RTJA 3THVA 2I8EA 3W5YA 3V4IB 1RJJA 2OEKA 5K20B 1S0MA 4FS2A 4HHUA 2QFIA 2MHEA 1R3NA 3VALA 1UVKA 3TAPA 4KJIA 2MYFA 2BVZA 4AL7A 2JL9A 2KZZA 5HBMB 1KQGB 5HLFA 3NEKA 1VI7A 3MEGB 1IR2A 4I1TA 1RT1A 4DX5A 2VG6B 1RT4A 3BBBA 3A8EA 4DQRA 1NJIT 2LMIA 4HR2A 3MGJA 2X1FA 1HI1A 5DRKA 2E1AA 4USJC 1UKUA 1FJGF 1SPBP 1IXKA 5KT2A 1H6KX 1U2FA 4XTTA 2GNKA 5HAOA 4ZKAA 1S7IA 4H4MA 2W7OA 4KFBA 1BGXT 3JTPA 5I3UA 2N3LA 4OMFG 3HHLB 4YHHF 1V5IB 2BE2A 4YDDB 4RUCA 4Z37A 1EP4A 4LF9F 2YQ0A 4OZJA 1IJFB 2OAUA 1N36F 2BMBA 1T9YA 4DL0C 3CC4S 1FCAA 3GR1A 2R7UA 3AY0A 1CJKA 4OX9J 4IYQA 3QIPB 5G0RB 1L3TA 1RKIA 5KG0A 2OPQB 1S9EB 1KLMA 2I5JB 1G7CB 2DISA 1G3OA 4JI8J 4H4KA 4C8LA 4KKOB 4RBVA 1UJ4A 3GONA 3U1NA 3LAMA 5SZTA 2XMVA 2JC0A 1LQ9A 1RTDB 1E6VA 3MPYA 4OZ0A 3NRBA 1SIZA 3B78A 5F8IA 3GJTB 3J80U 1MLAA 3DOMA 2O5DA 2DNHA 3GFYA 1HWLA 5D4PA 3PRVA 3Q2SC 3C6UB 1PYOB 4FYVB 3NAIA 5F8GA 3TO8A 2FJBB 3NG8A 2FHJD 3TUZC 1FKPA 5FD1A 2V4QA 1WC3A 4DLEA 1YDLA 1BC6A 1FF2A 1GMUA 3GB0A 1IM6A 1Q53A 3KYLA 2CNNB 1CJTB 1WELA 3LP0A 3CDUA 4PG5A 1VQ7S 2XS7A 1UJ5A 3AJ1A 3CNQP 4UW2A 2L08A 1VJQA 2NSCA 1ICEB 2MY7A 2XC9A 4CCHA 4IR1A 4HACA 3TEHB 3HI9A 4GKJJ 1KWMA 1NDCA 2A1BA 2UUBJ 5L1IA 4USKA 1Q86T 2VPWB 1WACA 2KFNA 1M5HA 4DX6A 1Y10A 3G9CA 1JJ2R 3CUNA 4LFAJ 1U24A 2E44A 3IR6B 2K3IA 3KNGA 4QR1A 2VB6A 4ZOSA 2HFOA 2HNZA 5EX3A 3HHLC 3J7YI 3ONQA 4CLYA 3GWCA 1PG5B 2YNIA 1JLCB 2OUGA 4G1IA 3FQLA 2C3UA 1FT8A 4DCPB 2XEXA 4ZVUB 1SKRA 4Q43A 2XWXA 2ZH2A 2Y1JA 5HVGA 1N52B 2ILZA 2FJVA 5EWGA 4CLZA 3LWLA 3VAJA 4NZ7A 4IFVB 2R7SA 5DQIA 2X1BA 1TUVA 4FVMA 4EK2A 5DDRC 1WOSA 2DK2A 4PWUA 5E5NA 2F1FA 4IG3A 4WU3A 4HTJA 2XO7A 1N54B 4J9PA 3PHTA 2UXCJ 3F41A 4ZVOB 3HLUA 2VPXB 5LSLA 1B3TA 3N0VA 4O44A 3G96A 4HHHA 3LP2A 5C5JA 4ZVGA 3V81B 5DETA 2FHMA 3MZIA 1SJ1A 2AHOB 4NA3A 3ITHA 3WX8A 1DURA 2X3GA 3P49B 2IYIA 3UDEA 1TL5A 2VF3A 3A3NB 5DG8A 5IT4A 2KI2A 2NR0A 2H3EB 1PYSB 4DSJA 3OFHA 2NUHA 4WE1B 2IM0A 3M9MB 3IBCB 3DLKA 4GVBB 1WI6A 3QATA 5A8RB 5KFNA 1ZZNA 1RLCL 4B08A 4OX6A 1LNQA 1TL1A 3VHQA 2V4JA 2W9CA 4URSA 2ZNYA 4X84A 3WIUA 2BQ3A 3DOKA 4KAIA 3W5ZA 3QLHA 2VL1A 3ZTOA 4FS1A 2NZCA 3OT9A 4W98A 1AW0A 1FVSA 2JEFA 1N56A 2JOQA 1IKWA 4OYMA 2BRKA 3MM6A 2J7UA 3POTA 2ACYA 3M8QB 1SH2A 4IRCA 3OFGA 3R6LB 1LFWA 3KLHB 3NGUA 3WBZA 4L6V3 3HPOA 3R5CA 2D9PA 4MIBA 4USIA 5AT1B 4DFMA 1WTBA 2NXNA 1CG2A 4CYUA 4NLVA 5CD4H 1FHTA 1TVRB 2DYAA 3VF0B 4KTQA 4FP9A 4DV4F 5A8KA 4B9MA 4UOFA 2YH0A 1RAIB 1OYDA 1ZYQA 3W65A 2IVYA 5K8NA 2VOOA 2ZKTA 4F8RA 4M5IA 1BWEA 2E66A 5KAKA 2DRAA 3MDFA 1HBOB 1XEZA 1S6UA 3GIRA 5A2QU 4IR9A 4ZS6A 2D3UA 2XGQA 1YHQS 3R5DA 1D9FA 3QAEA 2EC0A 1NB2A 4X4PA 3IR7B 3V4IA 1BQNB 2BJ3A 2BUNA 4ZN1A 3DRYA 3OR2B 3F73A 2BZ2A 1OYEA 4P2SA 3C15B 4RW7B 3CO9A 4ILRA 2A10A 2AEMA 2HBZB 5J2NB 2JFKA 1RSCA 1MMDA 3NMRA 3Q8YA 2OSQA 3ZTSA 4Y6IA 2OO4A 2DRDA 3OLBA 5ETVA 3U02A 2ZJPQ 3V6JA 2BOAA 1LEOA 1VC0A 4ECUA 4WFZA 4NPOA 3L09A 3SZ2A 1FD8A 4AE5A 2XY6A 2RKIB 4WP9A 1WD6A 3QRQA 2DEIA 4A46A 3R7BB 4EYHB 2BE9B 4CLWA 2DNMA 3I0SB 4RWWA 1WG4A 4FZVA 1Q7YT 3M30B 2KHDA 4DV6J 2DNYA 5HVHA 4U96A 5A0YA 1F3FA 1HARA 1HR0F 3DRSA 3MECB 1T05B 2Q43A 4J9UE 3SCLE 4X4NA 4QW8A 4WKRA 2MZRA 2M70A 2EWHA 2YY3A 5M2PA 4LSLB 4DV0F 2MQOA 3IWXA 4PYAA 2IC3A 1UCNA 2BDPA 4NXMF 1CLFA 2IM2A 4TN2A 4ZP7A 2LDYA 5IWAJ 2VQFF 3EM1A 5IT9U 1KQFB 2HQCA 1S9EA 2FHJA 4J9QA 2I5JA 2AW0A 3F44A 2XYGB 4KKOA 5E41A 3CE8A 2ZD1A 3CF5Q 2RE1A 1FA0A 1M5PC 1RWPB 3M2RA 4ID5A 4RWXA 1NDKA 1P1TA 1Q0NA 3CSKA 5B08A 4QR0A 4W92B 4WCEQ 1RT5B 1JX4A 4K0KF 4TLQA 2F8HA 1A6LA 3DHWC 4FVCA 2H4YB 3QSYB 1WC4A 4IDKB 2DGOA 2GW8A 3FNNA 2KHCA 2M52A 5F0WA 4HTIA 3K5NA 2A0FB 1Y9OA 4LSNB 4ZIWA 1VQYA 3UCGA 3BO2A 2Z2ZA 2HGNA 3MUTP 1LWEB 2R8GA 3I96A 2ZH4A 2LU1A 4Y65A 4YOEA 3R6GB 3TVYA 3QJPA 4M5KA 2ZE2B 1VRTA 2NS1B 1ZBTA 4F04B 4DR4F 5AE3A 2ADBA 1OWXA 1FESA 3G2XA 1HNVA 1NK7A 1DJ0A 3CW2C 2QLWA 3HSGA 3Q23A 3UI3A 1IN0A 2PA8D 4X66J 3LALA 2HQDA 3B54A 1UPMB 2MPUA 2L9DA 3M8ZA 3CVKA 4WP8A 1QAIA 4B9SA 4I2PB 4M63A 3UN5A 2WW8A 2DEJA 2BW7A 4JP8A 5FJ4A 3W66A 4F4KA 4O4GB 1LV5A 1N32F 1RA6A 2ZZTA 3IGVA 1NKBA 1EQMA 3ENQA 3OD2A 3SBMA 1FX4A 2LXUA 3Q24A 1JJ4A 1RWWB 1H38A 2NLWA 1P1LA 4DQSA 3FKBA 2DXEA 1FTRA 1OO0B 4UQTA 2DNZA 3MMAB 3QGGA 3MPUB 2DD8S 1HHQA 3NLCA 3QT8A 4X2BA 2IA0A 5KG2A 4PWDB 1SJFA 3K8VA 3W7BA 4URGA 4LBHA 1NXIA 2APOA 4P2MA 2KVIA 2RS8A 4LBIA 4YDXA 5IM0B 1Q8BA 2XLIA 4EGLA 3IR5B 3EZOA 4YR2A 5E33A 2DXDA 1LWCB 1GK8A 4OYBA 4JB8B 4I2QB 4WJBA 4JUZA 2Y8YA 4A8QA 2Z2YB 3P5TL 3MXHP 2A3JA 1G4CA 2ZVIA 4KGMA 4J9LA 5C2CA 4J9VA 1VQMS 2C2NA 3H4DA 5KFMA 2PT0A 1FWLA 2LFVA 1V3SA 2ZHOA 2LCWA 3O44A 1XR7A 4CO1A 4HEA9 2RQKA 4UQGA 3V81A 4JI5F 3QNWB 2MLXA 5JMNA 4JI6J 3A8JA 1SH0A 3CIZA 5E0OA 3PX6A 4GC6A 1R8CA 3LW5C 2ZBPA 4ZN3A 1IBKF 2ALYB 2ZVSA 1D9DA 2XMMA 1R0BG 3DDNA 1MWQA 5GMKa 3CCES 3KDNA 2YNFB 3TEGA 1CQMA 2YNGA 4ERDA 5ETLA 4QWAA 3M9NB 3RB4A 4OYXA 5HP1B 1FXRA 1FX2A 4FF3A 2J9EA 3EUNA 4YHHJ 1V9OA 1T3NA 4DF8A 4CLPA 1SIWB 1N36J 4E2FB 2PI5A 2HBYB 4PG4A 1VRUB 4MK9A 1EAYC 6FDRA 4CH1A 4HH1A 1BD6A 1VQKS 2KZMA 2VQEJ 3M8QA 3FCWA 1WG1A 4NLWA 2WVEA 5LOQA 4IOAQ 3BH7B 1UEVA 3FEZA 1UFWA 2WONA 3DM2B 2V5HG 1UEUA 4YMEA 4CI0B 2JFDA 1Y3JA 4F3MA 1UVLA 3MM5A 1B0TA 1VS3A 2QMWA 1TVRA 5D0EA 3LPYA 3I5BA 2K1RA 5MLCV 1ZM3A 1NEEA 3C2PA 2ZOFA 1S77D 5GAEI 3JQJA 3AHPA 4AL6A 1RE1B 4JYAF 1F5BA 2WBRA 2D1CA 3FQKA 3GSDA 2R2RA 4NWBA 1HBOA 4P73A 4CNYA 4BLGA 4ED4A 1U6FA 1TAQA 2X1AA 5IQQA 1BQNA 4K59A 1I5OB 5FDLA 2GFFA 4ZJLA 3OR2A 1BWVA 2ZDPA 3C15A 2BEFA 2AJFE 3H4BA 4PPDA 1C4AA 4PPZA 3H5XA 4AQYJ 3V2UC 1YJ7A 1U1LA 5J2NA 2AZ3A 3GCWP 4IOBA 2QL7B 1APSA 3LANA 1VBXA 2PSZA 4K2XA 2DR7A 3CJ4A 4B9LA 1CSJA 5LSRA 3MM7B 2B4VA 4Y2CA 4YB5A 2AX0A 1F2HA 2RKIA 3AOCA 2VFTA 4FBTA 4NLGA 3EGZA 1SV5B 2ZHBA 3KFWX 1C4CA 2Y9HA 1T94A 4OHYA 3I0SA 1B70B 2C42A 3WC2A 2CG4A 2B6AB 1QM9A 3MCOA 2VG5A 2IRYA 5IC4B 1HQ2A 1PC4A 1UTAA 1T05A 2JLEA 2BKPA 4GRSA 1X0FA 3CCUS 2AV5A 1V6HA 2VBWA 3W9HA 1WWHA 2XB2D 4LSLA 2CPZA 1TU0B 1RHJB 1NSQA 3M1VB 3HMJG 1UWAA 1XQIA 3MI7X 3PYGA 1J5EF 4NYZA 3UNYA 2HRTA 1F9HA 2B5JA 3M8PB 2Y1IA 1U0HB 1WSVA 2C2OB 1ZPWX 2MXYA 3H20A 1NUEA 2VH7A 5THWA 3ZZTA 3H5YA 3ZZ0A 3RAQA 4YQWA 4ELUA 4F2SA 1IVZA 1F9FA 1S72S 1GXLA 3J7YU 1S5ZA 2AJ1A 4L75A 2V2QA 3DRRA 4IDKA 2ZM6F 1U7LA 3NNCA 4L3NA 2L3MA 2DXFA 1PIEA 4LSNA 1HNZF 1RI7A 4OQJA 3ISZA 1U1RA 4KGKA 1LWEA 1ZS6A 3MPVA 2DPJA 2HVEA 3HVTB 4DG1B 4KPCA 1R6YA 1B7FA 3IBWA 1NBEB 4U7UK 3GFHA 1UJ6A 5DDQC 2B3TB 2WCXA 1X9WA 3ELHA 1UW9A 1SB6A 4TYBA 4DV3F 4N7TA 5L9NA 3QAUA 1VQ6S 2VC0A 4DV1F 2G0JA 1SKSA 2OPPB 2R7TA 2W8LA 1F0XA 3BM7A 4DSKA 2JWNA 1N34J 3F56A 3KG4A 2BM0A 3OFFA 2UVWA 4O4GA 4RU2A 4DQPA 4P71A 2FLPA 4Q7AA 5D3GA 2PDAA 3PXGa 2JX2A 1KR4A 1AZSA 2J0SD 3R5AA 1ZETA 1HMVB 5IFMA 5J1PA 2IJNA 3BQ1A 1Y11A 4USMA 5LM7E 5LT5A 3BGLA 2DR8A 2EVZA 3W2VB 5L1KA 3CJKB 2KKHA 4J9KA 1HWJA 1X60A 1U48A 3ZZZA 4Y00A 3OQ2A 2B4PA 4WXWA 1WI8A 2W2OP 1UZHA 4DV4J 2HRUA 2MGZA 4PWDA 2YNHB 4F0KA 4DV5F 1SL0A 1HPZB 1YJ9S 1F1BB 1S49A 1Z2LA 4DCJB 4UZCA 3T5KA 2M9KA 4I56A 1TL4A 3HZEA 1PJ5A 3NGDA 4EBCA 1YBAA 2HHWA 1WHYA 1LWCA 5I42B 1D09B 4DPWA 2FGCA 3TZWA 3UE2A 4I2QA 1RDRA 4WZQA 1LK5A 2E5JA 2BOPA 3V4MA 2XWYA 5A6WA 1VQOS 4ZPDA 4YP3A 5C42B 3UO0A 3CMAS 5T7LA 2CZVC 3GCXP 4PKDB 3ET6B 3I6PA 3BGRB 3VVTA 2YKMA 3DDIA 3OL7A 3BJYA 4NCBA 3MCSA 2GGPB 1UETA 3PJXA 2EEYA 2H5JB 3PZPA 1SL1A 4K4VA 3DLGB 4LR8A 1FVQA 3R5BA 2Q1LA 1FKOB 3T9NA 4RW9A 3B4DA 3UR0A 4Q45A 2QL5B 2U2FA 1R8BA 3K0JA 1YZ7A 1CULB 1HYSB 2VPYB 1S6PB 1AUDA 2YNFA 3G82B 1SKUB 2W25A 3R5JB 4CLLA 3WC0A 1S9FA 2VHGA 4MH8A 4DUZJ 1ZAVA 1VISA 5IZHA 4LBPA 4DL5A 4EO6A 5HP1A 3ILOA 2Z8QA 1HR0J 3SV3A 1Q78A 3HK2A 4M5JA 4A8KA 3GIMA 1TUGB 1NMEB 3RU0A 2HGLA 2XLJA 5F0UA 3UR3C 1XMQF 3HVRA 4C98A 4DV0J 3QWPA 1VRUA 3BF4A 3CCQS 3RYLA 3OVBA 3PIPQ 2UU9F 1TL7B 3PVXA 2Q79A 3BREA
chains in the Genus database with same CATH topology
3WDOA 2HPUA 4GKJF 2RU9A 5LL6d 2LQBA 4DJBA 3MMBA 3SFUA 2CPHA 4ICLB 2ZH8A 1B64A 3CJ2A 2FDNA 2R8JA 2C2EA 4LF5F 3NMAA 1Q81T 1T95A 3KLEA 5DGBA 4IH5A 3UFCX 3KLHA 2PMZD 1K0VA 1NU4A 1S4FA 1FDBA 3SCJE 3KNAA 2CPJA 1WHWA 3RAMA 4IO9Q 3DM2A 4RW8B 3H2LA 3I82A 3MM6B 1R31A 2GHVC 3C66A 5I3QA 4X64F 4RNOA 2LEBA 1N5YA 4LFAF 2IYGA 1RTIB 1UFLA 3ZZPA 2VUGA 4ZHRB 3D28A 3O3LA 2UUAF 2JVRA 2DGTA 1F5CA 3FFIB 4JV0A 5F8MA 3PEHA 2O66A 2Y1RI 2HNYB 3I87A 2ZJQQ 3GG0A 2MKHA 3SCIE 1X8DA 3OXLA 5GADU 3KHLA 3V6HA 2MKIA 3N4WA 3CCRS 1X9SA 2XMUA 2QLXA 1VQ5S 2G9OA 2EK1A 2WONB 3G6VA 1UP1A 3MEDB 2JZ5A 3GR0A 3G6XA 4PXEA 2QMXA 4DPOA 4F4YA 3OL9A 1C1CB 3HKWA 5G4DA 1DRZA 4RW4B 2YX7A 5F8HA 4Y2AA 2POKA 4F4WA 2HHVA 1VOMA 4QIVA 1NZAA 1QE1A 2HS4A 3W2WA 3KK3B 2XZWA 2B43A 3MM5B 2DO4A 3BSCA 2RF2A 4DOZA 2ZH1A 4QQBA 4J9OA 4RX6A 1HBUA 2M8HA 1NK9A 4NX9A 3ICLA 2BQUA 2DGVA 3Q22A 3DRPB 2BM1A 4NLTA 2GQQA 4MK8A 2K1RB 1HBNA 3K5LA 5A8KB 3O8WA 2A2DA 4OI0A 4CT8A 4X4QA 5E3PA 1UA0A 2OPRB 4OJGA 3X1LB 4A4JA 3I56S 4O3OA 3WX4A 1ZH5A 3HZGA 3ZZYA 2IRUA 1XTZA 2KJWA 1VBYA 1BQMA 2J9DA 3CTRA 3IFEA 2HW3A 4N41A 3K5MA 4ED1A 5D6GA 2ZH5A 2XMTA 1TL3B 2Z2LA 3HX9A 1HNXF 2B7BB 3DI6A 3S7RA 1M90T 1HHTP 5A6PA 2ZNZA 3GV5B 3H5UA 1S1VA 1ROFA 4HL9A 5KFBA 1HNWF 1YGYA 2DH8A 5BR8F 4C8NA 1VMBA 5H1SV 3KLGB 3DCAA 2AD9A 2ILYA 5J2MA 2UUTA 1XN9A 3MM8A 3IO1A 2EFQA 4M1KA 5HL7Q 2CFXA 3ULHA 4HKQA 4N77A 4JBCA 1ZM9A 2B9WA 3N6NA 4BWMA 3CDEA 4RW7A 2V2KA 3PR4A 1L5UA 3IG1B 3PFEA 1RTJA 1FDDA 5KT7A 4TU7A 5KFIA 1AFIA 3THVA 2I8EA 4X65F 3BGUA 4RNMA 2CPYA 5DM6Q 3V4IB 2M2BA 3MMJA 4MYTA 3RRHA 5FDLB 1RJJA 4IRDA 2COLA 1R89A 2IA6A 1ZOTA 2J76E 5LXRA 1S0MA 2J7KA 4ZLPA 4JOUA 2RIJA 4FS2A 2JEIA 4X4RA 2DVIA 2MHEA 4BC9A 1ZAWA 1LWFA 3PY8A 1S10A 1R3NA 3BS9A 3KMQA 3VALA 1UVKA 3TAPA 3RBDA 4KJIA 1S76D 2KRRA 4O3RA 2E5HA 2MYFA 4NYOA 3DXBA 3MM7A 2BVZA 3EPGA 4AL7A 2P6TA 3O2IA 1SJ4P 2JL9A 2KZZA 5HBMB 3NL0A 1KQGB 4M5DB 3CXCR 1Z4UA 3MF5A 3I5AA 5HLFA 1R0AA 3OUYB 4NA1A 1VI7A 2RSQA 3MEGB 4KSEB 2E7WA 4I1TA 5BJRA 1RT1A 4ZVHA 3UWTA 4R25A 4TXSA 2H9ZA 2EK6A 1RYSA 2VG6B 3DLHA 2V9KA 1SV5A 1RT4A 4WXOA 5EDWA 4DS5A 3ENWA 1HW8A 2BJDA 4U6PA 2DHAA 3A8EA 4DFPA 4DQRA 2ZOMA 2E29A 4QWDA 2Y0SD 3RAXA 1NJIT 4JI2F 2LMIA 3U1MA 2D7SA 3M30A 1BY9A 3MGJA 5KFLA 5KFEA 4DSIA 1HI1A 1RK8A 5DRKA 2X1FA 2DNKA 2E1AA 4USJC 3PO5A 3KLFB 3HVWA 5KG7A 1UKUA 3MR3A 2UVRA 1T7PA 4U67Q 1FJGF 3MECA 1IXKA 4NA2A 5KT2A 1H6KX 2NYIA 3AB4B 1VC5A 1U2FA 2C28A 2DB1A 2WBMA 4HT5A 4CO3A 2AYBA 3L7PA 4K4TA 1TKDA 2GNKA 4ZKAA 5HO4A 2HWHA 3PW4A 1LOUA 4H4MA 2VPZB 4O4RA 2W7OA 3NBPA 2XMKA 2OTJS 3LUYA 4KFBA 1BGXT 2VG5B 2H5EA 1CEZA 2PMHA 1P8GA 2D74B 2AX1A 3JTPA 2N3LA 3LGNA 1YRXA 5I3UA 3GIKA 4A8MP 4A48A 3VAHA 2FVPA 1TV6A 4OMFG 2RB7A 3HHLB 4D3GA 4YHHF 5D78A 3MR5A 1VLYA 5AE2A 2HHXA 4B9NA 3IS9B 4PRFA 2VBYA 3M9OB 2R7WA 3VAFA 2VONA 2BE2A 2YKOA 4I6AA 4YDDB 4RUCA 2UUWA 4Z37A 3CD7A 2YH1A 4KR0B 1KLNA 1EP4A 4LF9F 3E2EA 2JEJA 1JLBB 3KMSA 4OZJA 3MTJA 2AQ4A 1IJFB 2OAUA 1L3VA 1N36F 1JLFB 1C1BA 4DL0C 3MAQA 2OMLA 1N5SA 2OPSB 4OJ3A 1ZTTA 3CC4S 4AL5A 1FCAA 4EWTA 2EFPA 3OHBA 2W9AA 2FHKA 3GR1A 4C8OA 2R7UA 1M1KT 3AY0A 3LQVA 4O3SA 3M2VB 5GAHI 3S01A 3WZ0A 4M94A 2IJFA 3MEEB 1WEZA 4IYQA 1R8HA 2ZBCA 3DYAB 3QIPB 4NLYA 5G0RB 1L3TA 4I6YA 1L3KA 2GCFA 2QFJA 3EX7B 1FK9B 4ZCLA 2QZ8A 1RKIA 1VQSA 5KG0A 2OPQB 1GXUA 3ISND 2JC1A 1S9EB 4OFZA 5C25A 2B9XA 1KLMA 5HMZA 2I5JB 4O3NA 1G7CB 2B5JB 2DISA 4DN9A 2BQRA 1G3OA 3KOAA 4IH6A 4H4KA 3G4SS 1RT5A 4KKOB 4C8LA 1FRIA 4RBVA 1NK0A 1UJ4A 4LF4F 5KG3A 4C0BA 3MWBA 4K5SA 3H2VE 3U1NA 5J2PB 2RUGA 3LAMA 1RTHB 5SZTA 3NCQA 2BJEA 2IM3A 3ZZOA 5KOWA 5AXLA 2XMVA 2JC0A 3PACA 3QWUA 1OQ6A 1MNEA 1WNEA 1LW0B 1B0PA 1LQ9A 3SDEA 4GC7A 1RTDB 2MY8A 1E6VA 3MPYA 4OZ0A 1QAXA 2HNDB 2J5AA 3NRBA 5DG7A 1S6QA 1SIZA 3B78A 4HI2A 5F8IA 4X4TA 5KG4A 2G1DA 2YWGA 2BANB 4IKAA 1JIHA 3DDKA 2RT3A 3S6EA 3I9ZA 3DOMA 2O5DA 5EHHA 1KHWA 2DNHA 4UOCA 4C9DA 2NPIA 3T3FA 4KO0A 5CQGA 3JSMB 4FXDA 3GFYA 1HWLA 1QAYA 3DRRB 5D4PA 4DG1A 4IRKA 1DZ5A 2EBGA 3OJUA 1JXEA 1JKHB 3Q2SC 1HQEB 3TQ1A 3BDPA 3C6UB 3NAIA 5F8GA 2ZE2A 4M95A 3OW2R 3OTOF 4I6WA 1JNZB 3TO8A 4OLOA 2EBEA 2UP1A 4TU9A 1C0UB 2FJBB 3B4MA 1PO6A 5J1NA 3NG8A 2GJIA 4KHMA 3CCVS 4Y2IA 2FHJD 4K4UA 1H2VZ 3TUZC 1XERA 4OHZA 4RUHA 1FKPA 5FD1A 2QSFA 4UY85 1MWYA 2V4QA 4DLEA 1BC6A 1FF2A 3G8SA 3GB0A 1Q53A 2ASYA 3KYLA 4NLSA 5CHCB 1UL3A 2RRBA 3KK2A 2J6TA 1WELA 3LP0A 3CDUA 4PG5A 2ZKUA 1VQ7S 2XS7A 3GYXB 5AXKA 3DFEA 1GX6A 2ZFHA 1Y3KA 2VV5A 5DGAA 1UJ5A 5E3AA 3AJ1A 4A47A 4F25A 3OTDA 3KHGA 4YB1P 1LW2A 4I2PA 4UW2A 2L08A 2OIHA 2LQ9A 2F9JA 2NSCA 3HVAA 3BR9A 1YRUA 1TAUA 4E98A 2FHOB 4DWIA 4ED5A 2PIIA 2MY7A 2F7VA 2XC9A 4CCHA 4QIEA 1NJZA 5KFZA 4QR2A 1FE0A 4IR1A 2QIFA 1Q8IA 3HHEA