1B8TA

Solution structure of the chicken crp1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
192
structure length
192
Chain Sequence
b'MPNWGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALIHSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CRP1)
publication title Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile
total genus 13
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00412 LIM LIM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.110.10 Mainly Beta Ribbon Cysteine Rich Protein Cysteine Rich Protein 1b8tA01
2.10.110.10 Mainly Beta Ribbon Cysteine Rich Protein Cysteine Rich Protein 1b8tA02
2L6YB 2EHEA 1G47A 2O10A 1X64A 2DJ7A 1X61A 1J2OA 2EGQA 2XJYA 1WYHA 2YPAC 2XQNT 2D8ZA 3MMKA 1X68A 3IXEB 2DLOA 4HI9B 2D8YA 2D8XA 1X6AA 1U5SB 2JTNA 2XJZA 1X4LA 2DFYC 2MBVA 1B8TA 2CURA 2CUPA 4HI8B 2O13A 2L4ZA 1IMLA 1X63A 2L6ZC 2DARA 2IYBE 1M3VA 1A7IA 1WIGA 1CXXA 2CORA 1QLIA 1IBIA 1X62A 2CU8A 1V6GA 2LXDA 4KFZA 1NYPA 1X3HA 2CUQA 2MIUA 3F6QB 4JCJA 1RUTX 1CTLA 2LZUA 2CO8A 2KBXB
chains in the Genus database with same CATH superfamily
1G47A 1X64A 1X61A 4EZHA 3IXEB 5A1LA 5FP3A 2D8YA 2MBVA 3AVRA 2CURA 4UF0A 2L4ZA 4BHWA 2IYBE 1M3VA 5FY7A 3ZLIA 1IBIA 1QLIA 3NILA 5LKTA 4EYUA 1CTLA 2CO8A 2EHEA 2YPAC 2XQNT 3NISA 1X68A 3AVSA 1U5SB 1X4LA 3NIMA 3NIKA 1B8TA 2CUPA 4HI8B 1IMLA 1X63A 1WIGA 3ZPOA 3NIHA 2CU8A 1V6GA 4JCJA 2O10A 1J2OA 2XJYA 2D8ZA 3MMKA 5FXVA 4HI9B 1X6AA 3NIJA 2L6ZC 1A7IA 5FXXA 3NINA 4EZ4A 1X3HA 2CUQA 5FY0A 2KBXB 2L6YB 5FXWA 2DJ7A 2EGQA 1WYHA 5FY1A 2DLOA 2XUEA 4ASKA 2D8XA 2XJZA 5LKZA 2JTNA 2DFYC 4UF0B 5FYMA 2O13A 5FXZA 2DARA 1CXXA 2CORA 5LKXA 1X62A 2LXDA 4KFZA 1NYPA 2MIUA 3F6QB 5LKUA 1RUTX 2LZUA
chains in the Genus database with same CATH topology
1G47A 1X64A 1X61A 4EZHA 3IXEB 5A1LA 5FP3A 2D8YA 2MBVA 3AVRA 2CURA 4UF0A 2L4ZA 4BHWA 2IYBE 1M3VA 5FY7A 3ZLIA 1IBIA 1QLIA 3NILA 5LKTA 4EYUA 1CTLA 2CO8A 2EHEA 2YPAC 2XQNT 3NISA 1X68A 3AVSA 1U5SB 1X4LA 3NIMA 3NIKA 1B8TA 2CUPA 4HI8B 1IMLA 1X63A 1WIGA 3ZPOA 3NIHA 2CU8A 1V6GA 4JCJA 2O10A 1J2OA 2XJYA 2D8ZA 3MMKA 5FXVA 4HI9B 1X6AA 3NIJA 2L6ZC 1A7IA 5FXXA 3NINA 4EZ4A 1X3HA 2CUQA 5FY0A 2KBXB 2L6YB 5FXWA 2DJ7A 2EGQA 1WYHA 5FY1A 2DLOA 2XUEA 4ASKA 2D8XA 2XJZA 5LKZA 2JTNA 2DFYC 4UF0B 5FYMA 2O13A 5FXZA 2DARA 1CXXA 2CORA 5LKXA 1X62A 2LXDA 4KFZA 1NYPA 2MIUA 3F6QB 5LKUA 1RUTX 2LZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6Y B;  2EHE A;  1G47 A;  2O10 A;  1X64 A;  2DJ7 A;  1X61 A;  1J2O A;  2EGQ A;  2XJY A;  1WYH A;  2YPA C;  2XQN T;  2D8Z A;  3MMK A;  1X68 A;  3IXE B;  2DLO A;  4HI9 B;  2D8Y A;  2D8X A;  1X6A A;  1U5S B;  2JTN A;  2XJZ A;  1X4L A;  2DFY C;  2MBV A;  1B8T A;  2CUR A;  2CUP A;  4HI8 B;  2O13 A;  2L4Z A;  1IML A;  1X63 A;  2L6Z C;  2DAR A;  2IYB E;  1M3V A;  1A7I A;  1WIG A;  1CXX A;  2COR A;  1QLI A;  1IBI A;  1X62 A;  2CU8 A;  1V6G A;  2LXD A;  4KFZ A;  1NYP A;  1X3H A;  2CUQ A;  2MIU A;  3F6Q B;  4JCJ A;  1RUT X;  1CTL A;  2LZU A;  2CO8 A;  2KBX B; 
#chains in the Genus database with same CATH topology
 1G47 A;  1X64 A;  1X61 A;  4EZH A;  3IXE B;  5A1L A;  5FP3 A;  2D8Y A;  2MBV A;  3AVR A;  2CUR A;  4UF0 A;  2L4Z A;  4BHW A;  2IYB E;  1M3V A;  5FY7 A;  3ZLI A;  1IBI A;  1QLI A;  3NIL A;  5LKT A;  4EYU A;  1CTL A;  2CO8 A;  2EHE A;  2YPA C;  2XQN T;  3NIS A;  1X68 A;  3AVS A;  1U5S B;  1X4L A;  3NIM A;  3NIK A;  1B8T A;  2CUP A;  4HI8 B;  1IML A;  1X63 A;  1WIG A;  3ZPO A;  3NIH A;  2CU8 A;  1V6G A;  4JCJ A;  2O10 A;  1J2O A;  2XJY A;  2D8Z A;  3MMK A;  5FXV A;  4HI9 B;  1X6A A;  3NIJ A;  2L6Z C;  1A7I A;  5FXX A;  3NIN A;  4EZ4 A;  1X3H A;  2CUQ A;  5FY0 A;  2KBX B;  2L6Y B;  5FXW A;  2DJ7 A;  2EGQ A;  1WYH A;  5FY1 A;  2DLO A;  2XUE A;  4ASK A;  2D8X A;  2XJZ A;  5LKZ A;  2JTN A;  2DFY C;  4UF0 B;  5FYM A;  2O13 A;  5FXZ A;  2DAR A;  1CXX A;  2COR A;  5LKX A;  1X62 A;  2LXD A;  4KFZ A;  1NYP A;  2MIU A;  3F6Q B;  5LKU A;  1RUT X;  2LZU A; 
#chains in the Genus database with same CATH homology
 1G47 A;  1X64 A;  1X61 A;  4EZH A;  3IXE B;  5A1L A;  5FP3 A;  2D8Y A;  2MBV A;  3AVR A;  2CUR A;  4UF0 A;  2L4Z A;  4BHW A;  2IYB E;  1M3V A;  5FY7 A;  3ZLI A;  1IBI A;  1QLI A;  3NIL A;  5LKT A;  4EYU A;  1CTL A;  2CO8 A;  2EHE A;  2YPA C;  2XQN T;  3NIS A;  1X68 A;  3AVS A;  1U5S B;  1X4L A;  3NIM A;  3NIK A;  1B8T A;  2CUP A;  4HI8 B;  1IML A;  1X63 A;  1WIG A;  3ZPO A;  3NIH A;  2CU8 A;  1V6G A;  4JCJ A;  2O10 A;  1J2O A;  2XJY A;  2D8Z A;  3MMK A;  5FXV A;  4HI9 B;  1X6A A;  3NIJ A;  2L6Z C;  1A7I A;  5FXX A;  3NIN A;  4EZ4 A;  1X3H A;  2CUQ A;  5FY0 A;  2KBX B;  2L6Y B;  5FXW A;  2DJ7 A;  2EGQ A;  1WYH A;  5FY1 A;  2DLO A;  2XUE A;  4ASK A;  2D8X A;  2XJZ A;  5LKZ A;  2JTN A;  2DFY C;  4UF0 B;  5FYM A;  2O13 A;  5FXZ A;  2DAR A;  1CXX A;  2COR A;  5LKX A;  1X62 A;  2LXD A;  4KFZ A;  1NYP A;  2MIU A;  3F6Q B;  5LKU A;  1RUT X;  2LZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...