1BDCA

Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
b'TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCUS AUREUS PROTEIN A
publication title Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1bdcA00
2B88A 4ZNCA 1EDLA 1LT1A 2KS1B 1FC2C 2OTKE 3PH0A 4BXLA 1Y47A 4KJMA 2LXCB 2RKLA 2LXBA 5DJUB 1S3JA 1LP1B 5EFWB 4HB1A 2QVAA 3ZDMA 2Q1KA 1NVOA 5CBNA 5DJTB 4HKZH 4EYYQ 4GOFA 4MN4C 2M5AB 3MZWB 2P58A 2I8DA 2B87A 5C39A 1EDIA 2UWJE 4ASWA 1U7JA 2ZAEB 2KUBA 1SS1A 1JM0A 1OVUA 2KZJA 1EC5A 4K35A 2KIKA 2B89A 1LP1A 1OVRA 1X0TA 1OVVA 1MFTA 4GODA 3FXDA 1ZW0A 2M5AA 1H0TB 2SPZA 1Q2NA 5K5GB 1BDCA 4IOIH 4GOEA 1H0TA 2KI7B 2QRXA 4HJGH 3MHVA 4NPEA 2LR2A 4K3AA 4WWIA 3QWOC 4NPDA 4ASVA 5CBOA 1U7MA 2R44A 3RGUA 4CPGA 2WMMA 2K3RA 2M0BA 1EDJA 3S1KA 1EDKA 4NPFX 2HR3A 4ZMDA 1BDDA 1ZXGA 3FXEA 4JBZA 1DEEG 2JWDA 2KZIA 2B87B 1JMBA
chains in the Genus database with same CATH superfamily
3CLQA 1LNQA 1FOSF 1LTSC 3LW5H 4W7YA 3P7KA 1QGKB 5AW3B 1T8ZA 1OW6A 1FZAA 1KQLA 4OVNF 1SQQK 5AVUB 1ZRTE 1KZUB 1RE4C 1X79B 5CCGC 2I1JA 1KILD 2KB7P 3MZWB 1FDOA 4UB8H 2I8DA 1YTZI 2HPCA 4H44C 2W8ZA 4U3FJ 1USDA 3MUDC 1JCCA 2WWWA 1M1JC 2CPBA 1Y9BA 2MKVA 2V7QH 1FOSE 1K04A 3V2QA 5CJ0A 2NPSC 1EZVG 3W67A 1RH5B 3D6YA 5K5GB 3L74J 2YNYA 5KKZB 3VMZA 1BGYG 5CCHA 3U1AA 3KXDA 3IAOA 3CCUP 3LW5J 3AEDC 2KLUA 3BCCD 1DH3A 2GUSA 5AVQB 2R5DA 1Y8AA 2WMMA 2HR3A 4OGQB 5KLVD 2VRSA 2Z4EA 2OYOA 2B87B 4I2LC 1HBWA 2H89C 1L0ND 2WSEH 1HUCA 1BE3D 1LTGC 2G3AA 3H32A 1KQSO 4D6TE 2V7QJ 4I6MC 3L73D 1N7LA 5GTIE 2PAJA 2Q1KA 4EYYQ 1QX8A 4XA4A 3HE4B 4MN4C 1FZGA 3CWBD 2WSSH 3L75G 4OH8B 2GUVA 5CCGD 3AE3C 1KILE 1ZP0C 3HD7A 4R4LA 2ZVNB 3NXSA 1IFDA 2K37A 4U7JA 4EOTA 2E76C 2KIKA 1OVRA 1NTKD 2R32A 2M3EA 4B86A 1SQXK 5M1BA 4PD4D 3L72G 1S1CX 1RF1B 1VQ6P 1BDCA 2FXOA 2NPSD 4HJGH 3H1JG 1VL2A 1NGMB 3CCVP 2FKWB 3KYQA 2WSEJ 3RL0g 1MFZA 1GMJA 4GT1A 3W68A 4NPDA 1LT9B 3H1LJ 5CBOA 1ZV8A 2Q3EA 3R2PA 2M0BA 2HFED 5APQA 1NO4A 2W90A 3N7NA 1CZQA 1YQ4C 2O01H 4IFMA 4L75A 5CJ4A 2JEEA 2WSCH 2FYUG 1IK9A 1JMBA 1H88A 5APSA 5KLVE 3GMAA 5TISE 3O6QB 1QLED 1N73B 3CI9A 3Q2YA 4YXDC 1QVGO 2G8YA 4R4MA 3L73E 5B66E 5C39A 5AW6B 2OYHA 1K8AQ 1BCCG 1PPJD 3PHLA 5BVZA 2R5BA 1XTCC 1PGPA 4DZOA 3R4YA 2KNCB 4C7RA 1GL2B 1AFOA 3CWBE 2AEMA 4GKGA 5AW7B 1VF5B 3V4WA 5KJ7C 1OWAA 2E76D 2A45I 3FXDA 2K9JB 2O01J 1NTKE 1JEKA 5L8RJ 4IOIH 1T3UA 2QRXA 1PGJA 3MIWA 2OQQA 3FX0A 1IO4A 2ZYDA 2JDIH 2C0XA 4LLHA 1AVOA 4DJGA 2HLOA 2BCCJ 1KYOD 4N3YB 3S1KA 1EZVD 1Z56A 1DD3A 1S2EA 1EXIA 2E42A 1FBMA 1KTMA 1BGYD 2HPCB 4UB6E 5APVA 2Q5UA 5CHXA 3P32A 2OTKE 4BRYA 3PH0A 5BU8B 4IL6X 4JYBA 3JSVC 1FJPA 1IFIA 2ZXEB 2JR8A 2P67A 2WITA 3H1KG 3RK2B 5CBNA 3P8CD 4O9BA 1NAFA 2OARA 3KPEA 3G9RA 2BEZF 5GTHE 3JC22 3BVHA 4WY4D 1JNMA 5KKZC 1R8EA 1PPJE 3E7KA 3TGUG 2WZ7A 1QL1A 3SFEC 4D6TJ 2WPSA 2HODA 3CMEP 5KAFH 3ABVC 1YTZT 1SQBG 2M5AA 4AUWA 3HTKA 5KLVK 5KJ7D 2AXCA 3CCRP 3L75D 3H1IG 3AE6C 4GIFA 1KD1Q 2QJPB 4OGQC 1RE3A 1HGZA 3BCCG 1T3JA 3SFDC 2DW3A 2XV5A 2E5YA 3RGUA 3CCQP 2D2CD 2N1TA 1EDKA 3L72D 3GLMA 1SQQE 4TLFA 2W6JH 3WUUA 1JY3O 1KYOE 3D71A 5AW4B 1NU1G 1L0LD 1OX3A 3A5TA 3F89A 2Y9ZA 1L0NG 4H0LB 2Y0CA 1S9KD 5KLIB 1EZVE 3H1JD 2RMZA 2P7JA 1BE3G 2OYIB 1NWQA 5B66H 3HD7B 1W2EA 3KZIE 1BGYE 2ZYGA 3V2NA 2KSJA 1NTKK 3AE7C 2AXTH 5DJTB 1ZR4A 3B71A 3KHUA 1VQOP 3L70E 2FYUD 3HRNA 4I1LA 1H8AA 4ZKPA 1RF1C 1KB9I 2E43A 4PD4H 1SS1A 1OVUA 1KILA 2KZJA 1EC5A 1NTMG 1YJWP 2BASA 1J1DB 3NFQA 2ZJSE 4Z1MH 2V4HA 1VQPP 1KC8Q 3L71G 1AV1A 2XZRA 3L73J 1BCCD 2KI7B 5BU5A 4LGDE 4W80A 2IPPA 2W6AA 1JOCA 3L75E 2QJKB 3IN6A 4UB6H 4OGQD 3CWBJ 3G71P 5AVWB 1HJBA 3BRTB 2YXRB 1VQ4P 4IFDK 3RK3C 3VMXA 1N73C 1BDDA 1IK7A 1FAVA 4JPZB 1R5SA 2FXMA 2PGDA 3FXEA 5AVXB 1SP4A 2OYHB 4IL6E 4EIJA 4ZNCA 1Q7YQ 3B5NC 3V6IA 3H1JE 5GTHH 1Y47A 3FWNA 1GL2C 2IZ0A 2RKLA 4HB1A 4L74A 1SQXE 3H1HG 4WB4A 3GHGA 2KOGA 4U3FG 2Q9IA 3K5BA 1L2PA 1X22A 1SQPG 3NTNA 1GDTA 2FYUE 5AW5B 2NZ2A 1ZOYC 4EDFA 4PV1B 3G6EP 5KAIH 3H1KD 1IJDB 4AYCA 2QM7A 3G4SP 1WT6A 3Q5RA 2C0WA 2P10A 1KFNA 1VQNP 2J5UA 2C9LY 1KYOH 2YIUC 3WUTA 2KXPB 4NPEA 1SFCA 4L76A 1YJ9P 1U57A 3TGUD 4ASVA 4BRYB 3CC2P 4JYCA 3EQ2A 3C9IA 1EDJA 2HG5D 2NPSA 3KZIH 4ZKUA 3M0AA 1SQBD 1NTZD 3F5HA 1SQVG 2FFDC 1M90Q 3H1ID 3RK3D 4HH2A 3RK2C 1VPCA 3U1CA 1GW4A 3Q1MA 1PV3A 5CCHC 4KJMA 3OAKA 3B5ND 3II6A 2FBWC 1WMKA 1BSNA 2HODB 2B9BA 1NHLA 4HKZH 1NU1D 1SQQJ 2M5AB 3HTKB 4DT0A 3BASA 1PZQA 2K88A 3Q3DA 1KV4A 3IF4A 2N1TB 1DX7A 1IZNB 4TT3H 3L35A 3HE5A 3VOPA 2SPZA 2FYNB 1FDIA 1K05A 3AEAC 3WU2E 1LTTC 4H44D 3L70J 3MHVA 2N9YB 2LR2A 4H0LC 4K3AA 5KLIC 1KN7A 3ITKA 4IL6H 1FU1A 1NTMD 2OYIC 1NJIQ 3HD7C 2WVRA 4I7ZC 1L0LG 2P1JA 3L71D 1NOHA 2OTJP 2FYUK 3TYYA 1N8RQ 1JMMA 1G1JA 1J1EB 2IYOA 5KAFE 1FC2C 3EFGA 1URQB 1KILB 3BCCE 1AA0A 2A45H 2Y0EA 1JY2N 1L4AC 1IC2A 3P8MC 1J2JB 1YQ3C 1FS0E 2A45G 4JF7A 1J1DC 1YHQP 3A2AA 3SWFA 3AECC 1E79H 1NU1E 1L0NE 1FZCA 1VQKP 1BE3E 1LWUC 1HVVA 2QJKC 3AE2C 4Y28J 2IBZI 4WY4A 4H13B 1ZLLA 3GW6A 3H1HD 1RF0A 2A06G 3M91A 4U3FD 1Q2NA 1SQXJ 2YXQB 4GOEA 1H0TA 2BCCG 1SQPD 2H7HA 1RQUA 2AXTE 3JCUH 2OYHC 2M3BA 3M0DC 3AE8C 2FYUJ 5CMZA 4H0LD 4YPCA 4PJ0H 4NPFX 2WSCJ 3L74D 1NTME 4PD4E 3PTZA 2FYZA 3GHGB 1YBKA 1N7SC 3L71E 1VQ7P 2Z5IA 2RH0A 4RJTA 1MUUA 1G2CA 1H89A 2WQYC 1FZEA 4BXLA 2C9NY 2YO2A 1PGQA 5H2FE 3FWLA 1PP9G 1SQVD 5APUA 4GOFA 3RL0B 1L4AD 2XNXA 1EXJA 3TNUA 2M8RA 3OW2O 1AQ5A 1U7JA 4EI2A 1CI6A 1SFCB 2KUBA 1Q90D 3V2RA 3WU2H 2YO3A 4W7ZA 1GU5A 3A0HE 3CCLP 1GZLA 2B89A 1GU4A 3KQGA 3L4FA 1AVYA 2NPSB 2Q6QA 2OGUA 1SQBK 2H43A 3RBZA 3LIEA 3I5CA 1LTIC 3H1HE 3PLNA 4U3FE 1LGHB 4JQ0D 4Y99B 1YJNP 1S5LX 1SQPE 1W5CE 1NTZG 3GF3A 1MKMA 2Y9YA 1ZXGA 1NU1K 2ZT9B 3PP5A 1L0NK 4L73A 3AEFC 3GG2A 4C7NA 1JY2P 1SVFA 3E1RA 5KAIE 3H32B 1N7SD 3M9HA 2E74B 3SWYA 3HUSA 1HGVA 1RE3C 2LXBA 3VP9A 1LTAC 2IYPA 1ZMEC 1VQLP 3HE5B 1TU3F 2H8PD 2POHA 2IBZD 3CXHI 2N1TC 3IFMA 2IFMA 1SQVE 2FYNC 3CC4P 2E76B 5APWA 1JM0A 1S4XA 3O8ZA 1NTMK 3M06A 3QH9A 5E79H 4IFFA 3NMDA 2CK3H 3BCCJ 3TSIA 3MP7B 4GODA 1OFCX 3A7OA 3A0BH 3H25A 5AVTB 3P8CE 3D70A 5KLVJ 1JY2O 1NU1J 4WWIA 3B8EB 1L0NJ 1MZ9A 1U7MA 3CC7P 1LT9C 1J1EC 3CPWO 1BE3J 3VMYA 2QSIA 4GDOA 1URQC 2A06D 5H2FH 2JWDA 2IDBA 2BCCD 3AEGC 1FZCB 1VQ5P 1NKNA 3TK1A 1S3JA 1N73A 3ZDMA 3A0HH 1LTJA 3L72E 3VP8A 1M57D 4WY4B 1NTKJ 1NTMJ 1OXZA 1GK4A 2RN0A 2QIWA 4HYTB 1L0LE 1EDIA 4H13C 1DD4A 2UWJE 5AVSB 3B5NA 1S9KE 1SQPK 2W27A 3L71J 1JB0J 1G1IA 1JCDA 1LP1A 1VF5C 2L5GB 3V2PA 1HJ0A 2H88C 1PP9D 1JTHA 3EWKA 1HTLC 2WPQA 1VDFA 1P84I 2K9JA 5AVVB 3T97A 1FZFA 2E5TA 2NRGA 2LKMA 1S5LE 4LC1A 2D2CB 3N4XA 3GHGC 1G2CB 1RE4A 5CCGA 2KYVA 2R44A 3I56P 3L74G 3CX5I 1FE6A 1UIIA 2E75B 1LTBC 1SQVK 3MUDA 1M7LA 1Q86Q 1M1JA 1URQD 2JWAA 1Q81Q 3TNUB 1BCCE 2A06E 3M9QA 3RL0C 2W83C 2FY8A 3CXHD 2Z5HA 3PJSK 1X9VA 3H1HJ 1CI6B 3E1IA 3VYIA 2BCCE 4WVZA 1SLQA 1IFNA 1SFCC 2I1KA 1ZR2A 5DJUB 1D7MA 1FDMA 3SSUA 1SQQG 1SQPJ 2FFDA 2Y0DA 2AEJA 3VMAA 3JCUE 2R3CA 1EQ7A 2XNDH 4KHXA 1BSHA 1YIJP 2ZYAA 4ASWA 1GD2E 2OTLP 1KB9D 3V4QA 4PJ0E 2KSEA 1JO5A 4H13D 2JO1A 1FJKA 1GL2D 4N6JA 2KK7A 4Y99C 1MFTA 2J58A 1JUNA 1KQFB 2N9BA 3MGNA 2KLVA 5B5EE 1VF5D 1PL5A 3L70G 2JJLA 1MV8A 1USEA 1PP9E 1WRGA 3MD0A 1VQ9P 4C7NB 3VTPC 2ZT9C 1IFPA 2QJPC 1SQVJ 2AEFA 3CCSP 1GK6A 2K9YA 2O1KA 1BGYJ 2W6BA 1KYOI 3HUSB 1VQ8P 1EZVI 1L0LK 2E74C 3BATA 3H1KE 2QEXP 4RKUJ 4WBAA 2KZIA 3H1LG 1T2KC 3AEBC 3OA7A 3M9BA 3KDPB 1KMIZ 1CSBA 1JY3N 2YMKA 3S9OA 2OYIA 2YKQA 1PIXA 3RL0D 3L37A 3TGUE 3CXHE 2LXCB 2QA4P 1NAYA 1AJYA 2IBZG 1SFCD 1SQBE 1NTZE 2WT7A 1RQVA 1OIPA 3H1IE 1P84D 3RK3E 3RK2D 3OJAB 3L75J 1RY3A 2KS1A 3CMAP 1S5LH 1L4AA 5AVZB 3WMM0 1KB9E 2IZ1A 5CCHD 1HWTC 1OZHA 2JKVA 1SQXG 3CX5D 1A02F 3IR9A 3CCMP 3L72J 1X8YA 3H6PA 1L0LJ 2GM4A 1PGOA 2J59M 1LWUA 2MJZA 3H1JJ 2ZT9D 3I55P 4CPGA 1FZCC 3RK3B 3USSA 2PP6A 1LTJB 4XFJA 4ZMDA 3LIDA 2WPRA 2K1AA 1CW5A 2E74D 5E79E 1K73Q 1KFMA 4WY4C 1RF0C 4AQRD 1R5LA 4DOJA 3B5NB 1VQMP 5KJ7A 3M0DA 3Q5PA 1N86A 1T2KD 1EDLA 1LT1A 3A0BE 5KTBA 3VN0A 1LP1B 3HD7D 2QVAA 3TF5A 1NYHA 2XU6A 1IFJA 1JTHB 5AW1B 4QMAA 2O01N 2QJYB 1N7SA 2P58A 4YXWH 1GW3A 3T97B 5B5EH 2P2UA 2ZAEB 1BCCJ 1YYCA 1AQTA 3A3YB 1P84E 2D2CC 3C8VA 4XE5B 2Q7CA 4PV1C 1SQQD 3CL3D 1OVVA 4H44B 1XTGB 1PFIA 2YIUB 5GTIH 3D6ZA 2E75C 1M1JB 1QEXA 3CX5E 4D6TG 4YTPC 3QWOC 2YMYA 2KP8A 1NTZK 1QVFO 1JY3P 1OW7A 3CXHH 2FFDB 5APTA 3L70D 3AE5C 3U59A 4M3LA 3Q5SA 1DEEG 2QM8A 1HH0A 3TDKA 1PP9J 2L91A 4N78D 1DEBA 4BWNA 1NH4A 3SWKA 1UIXA 1NKZB 1KB9H 4KT0J 3L74E 5AW0B 2B87A 3H1KJ 3H1LD 2XDJA 2PRRA 2CPSA 1M8OB 4A7PA 2IFNA 3B4SA 3C1LA 1GTWA 5AVRB 2ITAA 2YKOA 1IFMA 3TGUJ 4UB8E 5TISH 1ZW0A 3HE4A 4PV1D 2WPVB 3HUSC 5KLVG 4RO0A 2O3JA 1K9MQ 1Q82Q 1KQGB 2R3SA 1SQBJ 1NTZJ 3FGAD 5TJHA 2QG4A 3L36A 3H1IJ 2E75D 1FZBA 1RHZB 2WTYA 1M56D 3L73G 2K3RA 3BRVB 2WSFH 1SQXD 4I7ZB 1YI2P 5AW8B 2HYNA 1RF1A 4C46A 1M1KQ 2WT7B 3CWBG 5APYA 1W2BO 2PFXA 1HF9A 2ZXXA 4OWFA 3S4RA 2B88A 1LT9A 2O1JA 1ZRTD 2Q3IA 3CCEP 2KS1B 1T6AA 3EFFK 2JP3A 1L4AB 3V5BA 1KILC 1URQA 2FXPA 4RESB 5EFWB 1DIPA 1NTKG 1P84H 2IX7C 4N78E 1ZN5A 1NVOA 1E5WA 3WUVA 1LJ2A 1S72P 5AVYB 3O6QA 3H1LE 1A02J 3CX5H 2BEQD 1LWUB 3AE1C 4K35A 2WSFJ 2ZVOB 4DCKA 3G3ZA 1X0TA 3MTUE 3AE4C 5AW2B 1N2DC 3CCJP 1H0TB 3UIAA 2ZFCA 3GF7A 1YITP 2N1TD 1LTJC 2IBZE 2KNCA 1GL2A 4PD4I 3AE9C 3AEEC 2QE7H 1OMIA 3PRJA 4JBZA 1QL2A 5APXA 1N7SB 1KORA 3CD6P 1OW8A 2YKPA 5AW9B 1PPJG 4D6TD 2GA1A 2XKMA 3RBXA 2QJYC
chains in the Genus database with same CATH topology
2B88A 4ZNCA 1EDLA 1LT1A 2KS1B 1FC2C 2OTKE 3PH0A 4BXLA 1Y47A 4KJMA 2LXCB 2RKLA 2LXBA 5DJUB 1S3JA 1LP1B 5EFWB 4HB1A 2QVAA 3ZDMA 2Q1KA 1NVOA 5CBNA 5DJTB 4HKZH 4EYYQ 4GOFA 4MN4C 2M5AB 3MZWB 2P58A 2I8DA 2B87A 5C39A 1EDIA 2UWJE 4ASWA 1U7JA 2ZAEB 2KUBA 1SS1A 1JM0A 1OVUA 2KZJA 1EC5A 4K35A 2KIKA 2B89A 1LP1A 1OVRA 1X0TA 1OVVA 1MFTA 4GODA 3FXDA 1ZW0A 2M5AA 1H0TB 2SPZA 1Q2NA 5K5GB 1BDCA 4IOIH 4GOEA 1H0TA 2KI7B 2QRXA 4HJGH 3MHVA 4NPEA 2LR2A 4K3AA 4WWIA 3QWOC 4NPDA 4ASVA 5CBOA 1U7MA 2R44A 3RGUA 4CPGA 2WMMA 2K3RA 2M0BA 1EDJA 3S1KA 1EDKA 4NPFX 2HR3A 4ZMDA 1BDDA 1ZXGA 3FXEA 4JBZA 1DEEG 2JWDA 2KZIA 2B87B 1JMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B88 A;  4ZNC A;  1EDL A;  1LT1 A;  2KS1 B;  1FC2 C;  2OTK E;  3PH0 A;  4BXL A;  1Y47 A;  4KJM A;  2LXC B;  2RKL A;  2LXB A;  5DJU B;  1S3J A;  1LP1 B;  5EFW B;  4HB1 A;  2QVA A;  3ZDM A;  2Q1K A;  1NVO A;  5CBN A;  5DJT B;  4HKZ H;  4EYY Q;  4GOF A;  4MN4 C;  2M5A B;  3MZW B;  2P58 A;  2I8D A;  2B87 A;  5C39 A;  1EDI A;  2UWJ E;  4ASW A;  1U7J A;  2ZAE B;  2KUB A;  1SS1 A;  1JM0 A;  1OVU A;  2KZJ A;  1EC5 A;  4K35 A;  2KIK A;  2B89 A;  1LP1 A;  1OVR A;  1X0T A;  1OVV A;  1MFT A;  4GOD A;  3FXD A;  1ZW0 A;  2M5A A;  1H0T B;  2SPZ A;  1Q2N A;  5K5G B;  1BDC A;  4IOI H;  4GOE A;  1H0T A;  2KI7 B;  2QRX A;  4HJG H;  3MHV A;  4NPE A;  2LR2 A;  4K3A A;  4WWI A;  3QWO C;  4NPD A;  4ASV A;  5CBO A;  1U7M A;  2R44 A;  3RGU A;  4CPG A;  2WMM A;  2K3R A;  2M0B A;  1EDJ A;  3S1K A;  1EDK A;  4NPF X;  2HR3 A;  4ZMD A;  1BDD A;  1ZXG A;  3FXE A;  4JBZ A;  1DEE G;  2JWD A;  2KZI A;  2B87 B;  1JMB A; 
#chains in the Genus database with same CATH topology
 3CLQ A;  1LNQ A;  1FOS F;  1LTS C;  3LW5 H;  4W7Y A;  3P7K A;  1QGK B;  5AW3 B;  1T8Z A;  1OW6 A;  1FZA A;  1KQL A;  4OVN F;  1SQQ K;  5AVU B;  1ZRT E;  1KZU B;  1RE4 C;  1X79 B;  5CCG C;  2I1J A;  1KIL D;  2KB7 P;  3MZW B;  1FDO A;  4UB8 H;  2I8D A;  1YTZ I;  2HPC A;  4H44 C;  2W8Z A;  4U3F J;  1USD A;  3MUD C;  1JCC A;  2WWW A;  1M1J C;  2CPB A;  1Y9B A;  2MKV A;  2V7Q H;  1FOS E;  1K04 A;  3V2Q A;  5CJ0 A;  2NPS C;  1EZV G;  3W67 A;  1RH5 B;  3D6Y A;  5K5G B;  3L74 J;  2YNY A;  5KKZ B;  3VMZ A;  1BGY G;  5CCH A;  3U1A A;  3KXD A;  3IAO A;  3CCU P;  3LW5 J;  3AED C;  2KLU A;  3BCC D;  1DH3 A;  2GUS A;  5AVQ B;  2R5D A;  1Y8A A;  2WMM A;  2HR3 A;  4OGQ B;  5KLV D;  2VRS A;  2Z4E A;  2OYO A;  2B87 B;  4I2L C;  1HBW A;  2H89 C;  1L0N D;  2WSE H;  1HUC A;  1BE3 D;  1LTG C;  2G3A A;  3H32 A;  1KQS O;  4D6T E;  2V7Q J;  4I6M C;  3L73 D;  1N7L A;  5GTI E;  2PAJ A;  2Q1K A;  4EYY Q;  1QX8 A;  4XA4 A;  3HE4 B;  4MN4 C;  1FZG A;  3CWB D;  2WSS H;  3L75 G;  4OH8 B;  2GUV A;  5CCG D;  3AE3 C;  1KIL E;  1ZP0 C;  3HD7 A;  4R4L A;  2ZVN B;  3NXS A;  1IFD A;  2K37 A;  4U7J A;  4EOT A;  2E76 C;  2KIK A;  1OVR A;  1NTK D;  2R32 A;  2M3E A;  4B86 A;  1SQX K;  5M1B A;  4PD4 D;  3L72 G;  1S1C X;  1RF1 B;  1VQ6 P;  1BDC A;  2FXO A;  2NPS D;  4HJG H;  3H1J G;  1VL2 A;  1NGM B;  3CCV P;  2FKW B;  3KYQ A;  2WSE J;  3RL0 g;  1MFZ A;  1GMJ A;  4GT1 A;  3W68 A;  4NPD A;  1LT9 B;  3H1L J;  5CBO A;  1ZV8 A;  2Q3E A;  3R2P A;  2M0B A;  2HFE D;  5APQ A;  1NO4 A;  2W90 A;  3N7N A;  1CZQ A;  1YQ4 C;  2O01 H;  4IFM A;  4L75 A;  5CJ4 A;  2JEE A;  2WSC H;  2FYU G;  1IK9 A;  1JMB A;  1H88 A;  5APS A;  5KLV E;  3GMA A;  5TIS E;  3O6Q B;  1QLE D;  1N73 B;  3CI9 A;  3Q2Y A;  4YXD C;  1QVG O;  2G8Y A;  4R4M A;  3L73 E;  5B66 E;  5C39 A;  5AW6 B;  2OYH A;  1K8A Q;  1BCC G;  1PPJ D;  3PHL A;  5BVZ A;  2R5B A;  1XTC C;  1PGP A;  4DZO A;  3R4Y A;  2KNC B;  4C7R A;  1GL2 B;  1AFO A;  3CWB E;  2AEM A;  4GKG A;  5AW7 B;  1VF5 B;  3V4W A;  5KJ7 C;  1OWA A;  2E76 D;  2A45 I;  3FXD A;  2K9J B;  2O01 J;  1NTK E;  1JEK A;  5L8R J;  4IOI H;  1T3U A;  2QRX A;  1PGJ A;  3MIW A;  2OQQ A;  3FX0 A;  1IO4 A;  2ZYD A;  2JDI H;  2C0X A;  4LLH A;  1AVO A;  4DJG A;  2HLO A;  2BCC J;  1KYO D;  4N3Y B;  3S1K A;  1EZV D;  1Z56 A;  1DD3 A;  1S2E A;  1EXI A;  2E42 A;  1FBM A;  1KTM A;  1BGY D;  2HPC B;  4UB6 E;  5APV A;  2Q5U A;  5CHX A;  3P32 A;  2OTK E;  4BRY A;  3PH0 A;  5BU8 B;  4IL6 X;  4JYB A;  3JSV C;  1FJP A;  1IFI A;  2ZXE B;  2JR8 A;  2P67 A;  2WIT A;  3H1K G;  3RK2 B;  5CBN A;  3P8C D;  4O9B A;  1NAF A;  2OAR A;  3KPE A;  3G9R A;  2BEZ F;  5GTH E;  3JC2 2;  3BVH A;  4WY4 D;  1JNM A;  5KKZ C;  1R8E A;  1PPJ E;  3E7K A;  3TGU G;  2WZ7 A;  1QL1 A;  3SFE C;  4D6T J;  2WPS A;  2HOD A;  3CME P;  5KAF H;  3ABV C;  1YTZ T;  1SQB G;  2M5A A;  4AUW A;  3HTK A;  5KLV K;  5KJ7 D;  2AXC A;  3CCR P;  3L75 D;  3H1I G;  3AE6 C;  4GIF A;  1KD1 Q;  2QJP B;  4OGQ C;  1RE3 A;  1HGZ A;  3BCC G;  1T3J A;  3SFD C;  2DW3 A;  2XV5 A;  2E5Y A;  3RGU A;  3CCQ P;  2D2C D;  2N1T A;  1EDK A;  3L72 D;  3GLM A;  1SQQ E;  4TLF A;  2W6J H;  3WUU A;  1JY3 O;  1KYO E;  3D71 A;  5AW4 B;  1NU1 G;  1L0L D;  1OX3 A;  3A5T A;  3F89 A;  2Y9Z A;  1L0N G;  4H0L B;  2Y0C A;  1S9K D;  5KLI B;  1EZV E;  3H1J D;  2RMZ A;  2P7J A;  1BE3 G;  2OYI B;  1NWQ A;  5B66 H;  3HD7 B;  1W2E A;  3KZI E;  1BGY E;  2ZYG A;  3V2N A;  2KSJ A;  1NTK K;  3AE7 C;  2AXT H;  5DJT B;  1ZR4 A;  3B71 A;  3KHU A;  1VQO P;  3L70 E;  2FYU D;  3HRN A;  4I1L A;  1H8A A;  4ZKP A;  1RF1 C;  1KB9 I;  2E43 A;  4PD4 H;  1SS1 A;  1OVU A;  1KIL A;  2KZJ A;  1EC5 A;  1NTM G;  1YJW P;  2BAS A;  1J1D B;  3NFQ A;  2ZJS E;  4Z1M H;  2V4H A;  1VQP P;  1KC8 Q;  3L71 G;  1AV1 A;  2XZR A;  3L73 J;  1BCC D;  2KI7 B;  5BU5 A;  4LGD E;  4W80 A;  2IPP A;  2W6A A;  1JOC A;  3L75 E;  2QJK B;  3IN6 A;  4UB6 H;  4OGQ D;  3CWB J;  3G71 P;  5AVW B;  1HJB A;  3BRT B;  2YXR B;  1VQ4 P;  4IFD K;  3RK3 C;  3VMX A;  1N73 C;  1BDD A;  1IK7 A;  1FAV A;  4JPZ B;  1R5S A;  2FXM A;  2PGD A;  3FXE A;  5AVX B;  1SP4 A;  2OYH B;  4IL6 E;  4EIJ A;  4ZNC A;  1Q7Y Q;  3B5N C;  3V6I A;  3H1J E;  5GTH H;  1Y47 A;  3FWN A;  1GL2 C;  2IZ0 A;  2RKL A;  4HB1 A;  4L74 A;  1SQX E;  3H1H G;  4WB4 A;  3GHG A;  2KOG A;  4U3F G;  2Q9I A;  3K5B A;  1L2P A;  1X22 A;  1SQP G;  3NTN A;  1GDT A;  2FYU E;  5AW5 B;  2NZ2 A;  1ZOY C;  4EDF A;  4PV1 B;  3G6E P;  5KAI H;  3H1K D;  1IJD B;  4AYC A;  2QM7 A;  3G4S P;  1WT6 A;  3Q5R A;  2C0W A;  2P10 A;  1KFN A;  1VQN P;  2J5U A;  2C9L Y;  1KYO H;  2YIU C;  3WUT A;  2KXP B;  4NPE A;  1SFC A;  4L76 A;  1YJ9 P;  1U57 A;  3TGU D;  4ASV A;  4BRY B;  3CC2 P;  4JYC A;  3EQ2 A;  3C9I A;  1EDJ A;  2HG5 D;  2NPS A;  3KZI H;  4ZKU A;  3M0A A;  1SQB D;  1NTZ D;  3F5H A;  1SQV G;  2FFD C;  1M90 Q;  3H1I D;  3RK3 D;  4HH2 A;  3RK2 C;  1VPC A;  3U1C A;  1GW4 A;  3Q1M A;  1PV3 A;  5CCH C;  4KJM A;  3OAK A;  3B5N D;  3II6 A;  2FBW C;  1WMK A;  1BSN A;  2HOD B;  2B9B A;  1NHL A;  4HKZ H;  1NU1 D;  1SQQ J;  2M5A B;  3HTK B;  4DT0 A;  3BAS A;  1PZQ A;  2K88 A;  3Q3D A;  1KV4 A;  3IF4 A;  2N1T B;  1DX7 A;  1IZN B;  4TT3 H;  3L35 A;  3HE5 A;  3VOP A;  2SPZ A;  2FYN B;  1FDI A;  1K05 A;  3AEA C;  3WU2 E;  1LTT C;  4H44 D;  3L70 J;  3MHV A;  2N9Y B;  2LR2 A;  4H0L C;  4K3A A;  5KLI C;  1KN7 A;  3ITK A;  4IL6 H;  1FU1 A;  1NTM D;  2OYI C;  1NJI Q;  3HD7 C;  2WVR A;  4I7Z C;  1L0L G;  2P1J A;  3L71 D;  1NOH A;  2OTJ P;  2FYU K;  3TYY A;  1N8R Q;  1JMM A;  1G1J A;  1J1E B;  2IYO A;  5KAF E;  1FC2 C;  3EFG A;  1URQ B;  1KIL B;  3BCC E;  1AA0 A;  2A45 H;  2Y0E A;  1JY2 N;  1L4A C;  1IC2 A;  3P8M C;  1J2J B;  1YQ3 C;  1FS0 E;  2A45 G;  4JF7 A;  1J1D C;  1YHQ P;  3A2A A;  3SWF A;  3AEC C;  1E79 H;  1NU1 E;  1L0N E;  1FZC A;  1VQK P;  1BE3 E;  1LWU C;  1HVV A;  2QJK C;  3AE2 C;  4Y28 J;  2IBZ I;  4WY4 A;  4H13 B;  1ZLL A;  3GW6 A;  3H1H D;  1RF0 A;  2A06 G;  3M91 A;  4U3F D;  1Q2N A;  1SQX J;  2YXQ B;  4GOE A;  1H0T A;  2BCC G;  1SQP D;  2H7H A;  1RQU A;  2AXT E;  3JCU H;  2OYH C;  2M3B A;  3M0D C;  3AE8 C;  2FYU J;  5CMZ A;  4H0L D;  4YPC A;  4PJ0 H;  4NPF X;  2WSC J;  3L74 D;  1NTM E;  4PD4 E;  3PTZ A;  2FYZ A;  3GHG B;  1YBK A;  1N7S C;  3L71 E;  1VQ7 P;  2Z5I A;  2RH0 A;  4RJT A;  1MUU A;  1G2C A;  1H89 A;  2WQY C;  1FZE A;  4BXL A;  2C9N Y;  2YO2 A;  1PGQ A;  5H2F E;  3FWL A;  1PP9 G;  1SQV D;  5APU A;  4GOF A;  3RL0 B;  1L4A D;  2XNX A;  1EXJ A;  3TNU A;  2M8R A;  3OW2 O;  1AQ5 A;  1U7J A;  4EI2 A;  1CI6 A;  1SFC B;  2KUB A;  1Q90 D;  3V2R A;  3WU2 H;  2YO3 A;  4W7Z A;  1GU5 A;  3A0H E;  3CCL P;  1GZL A;  2B89 A;  1GU4 A;  3KQG A;  3L4F A;  1AVY A;  2NPS B;  2Q6Q A;  2OGU A;  1SQB K;  2H43 A;  3RBZ A;  3LIE A;  3I5C A;  1LTI C;  3H1H E;  3PLN A;  4U3F E;  1LGH B;  4JQ0 D;  4Y99 B;  1YJN P;  1S5L X;  1SQP E;  1W5C E;  1NTZ G;  3GF3 A;  1MKM A;  2Y9Y A;  1ZXG A;  1NU1 K;  2ZT9 B;  3PP5 A;  1L0N K;  4L73 A;  3AEF C;  3GG2 A;  4C7N A;  1JY2 P;  1SVF A;  3E1R A;  5KAI E;  3H32 B;  1N7S D;  3M9H A;  2E74 B;  3SWY A;  3HUS A;  1HGV A;  1RE3 C;  2LXB A;  3VP9 A;  1LTA C;  2IYP A;  1ZME C;  1VQL P;  3HE5 B;  1TU3 F;  2H8P D;  2POH A;  2IBZ D;  3CXH I;  2N1T C;  3IFM A;  2IFM A;  1SQV E;  2FYN C;  3CC4 P;  2E76 B;  5APW A;  1JM0 A;  1S4X A;  3O8Z A;  1NTM K;  3M06 A;  3QH9 A;  5E79 H;  4IFF A;  3NMD A;  2CK3 H;  3BCC J;  3TSI A;  3MP7 B;  4GOD A;  1OFC X;  3A7O A;  3A0B H;  3H25 A;  5AVT B;  3P8C E;  3D70 A;  5KLV J;  1JY2 O;  1NU1 J;  4WWI A;  3B8E B;  1L0N J;  1MZ9 A;  1U7M A;  3CC7 P;  1LT9 C;  1J1E C;  3CPW O;  1BE3 J;  3VMY A;  2QSI A;  4GDO A;  1URQ C;  2A06 D;  5H2F H;  2JWD A;  2IDB A;  2BCC D;  3AEG C;  1FZC B;  1VQ5 P;  1NKN A;  3TK1 A;  1S3J A;  1N73 A;  3ZDM A;  3A0H H;  1LTJ A;  3L72 E;  3VP8 A;  1M57 D;  4WY4 B;  1NTK J;  1NTM J;  1OXZ A;  1GK4 A;  2RN0 A;  2QIW A;  4HYT B;  1L0L E;  1EDI A;  4H13 C;  1DD4 A;  2UWJ E;  5AVS B;  3B5N A;  1S9K E;  1SQP K;  2W27 A;  3L71 J;  1JB0 J;  1G1I A;  1JCD A;  1LP1 A;  1VF5 C;  2L5G B;  3V2P A;  1HJ0 A;  2H88 C;  1PP9 D;  1JTH A;  3EWK A;  1HTL C;  2WPQ A;  1VDF A;  1P84 I;  2K9J A;  5AVV B;  3T97 A;  1FZF A;  2E5T A;  2NRG A;  2LKM A;  1S5L E;  4LC1 A;  2D2C B;  3N4X A;  3GHG C;  1G2C B;  1RE4 A;  5CCG A;  2KYV A;  2R44 A;  3I56 P;  3L74 G;  3CX5 I;  1FE6 A;  1UII A;  2E75 B;  1LTB C;  1SQV K;  3MUD A;  1M7L A;  1Q86 Q;  1M1J A;  1URQ D;  2JWA A;  1Q81 Q;  3TNU B;  1BCC E;  2A06 E;  3M9Q A;  3RL0 C;  2W83 C;  2FY8 A;  3CXH D;  2Z5H A;  3PJS K;  1X9V A;  3H1H J;  1CI6 B;  3E1I A;  3VYI A;  2BCC E;  4WVZ A;  1SLQ A;  1IFN A;  1SFC C;  2I1K A;  1ZR2 A;  5DJU B;  1D7M A;  1FDM A;  3SSU A;  1SQQ G;  1SQP J;  2FFD A;  2Y0D A;  2AEJ A;  3VMA A;  3JCU E;  2R3C A;  1EQ7 A;  2XND H;  4KHX A;  1BSH A;  1YIJ P;  2ZYA A;  4ASW A;  1GD2 E;  2OTL P;  1KB9 D;  3V4Q A;  4PJ0 E;  2KSE A;  1JO5 A;  4H13 D;  2JO1 A;  1FJK A;  1GL2 D;  4N6J A;  2KK7 A;  4Y99 C;  1MFT A;  2J58 A;  1JUN A;  1KQF B;  2N9B A;  3MGN A;  2KLV A;  5B5E E;  1VF5 D;  1PL5 A;  3L70 G;  2JJL A;  1MV8 A;  1USE A;  1PP9 E;  1WRG A;  3MD0 A;  1VQ9 P;  4C7N B;  3VTP C;  2ZT9 C;  1IFP A;  2QJP C;  1SQV J;  2AEF A;  3CCS P;  1GK6 A;  2K9Y A;  2O1K A;  1BGY J;  2W6B A;  1KYO I;  3HUS B;  1VQ8 P;  1EZV I;  1L0L K;  2E74 C;  3BAT A;  3H1K E;  2QEX P;  4RKU J;  4WBA A;  2KZI A;  3H1L G;  1T2K C;  3AEB C;  3OA7 A;  3M9B A;  3KDP B;  1KMI Z;  1CSB A;  1JY3 N;  2YMK A;  3S9O A;  2OYI A;  2YKQ A;  1PIX A;  3RL0 D;  3L37 A;  3TGU E;  3CXH E;  2LXC B;  2QA4 P;  1NAY A;  1AJY A;  2IBZ G;  1SFC D;  1SQB E;  1NTZ E;  2WT7 A;  1RQV A;  1OIP A;  3H1I E;  1P84 D;  3RK3 E;  3RK2 D;  3OJA B;  3L75 J;  1RY3 A;  2KS1 A;  3CMA P;  1S5L H;  1L4A A;  5AVZ B;  3WMM 0;  1KB9 E;  2IZ1 A;  5CCH D;  1HWT C;  1OZH A;  2JKV A;  1SQX G;  3CX5 D;  1A02 F;  3IR9 A;  3CCM P;  3L72 J;  1X8Y A;  3H6P A;  1L0L J;  2GM4 A;  1PGO A;  2J59 M;  1LWU A;  2MJZ A;  3H1J J;  2ZT9 D;  3I55 P;  4CPG A;  1FZC C;  3RK3 B;  3USS A;  2PP6 A;  1LTJ B;  4XFJ A;  4ZMD A;  3LID A;  2WPR A;  2K1A A;  1CW5 A;  2E74 D;  5E79 E;  1K73 Q;  1KFM A;  4WY4 C;  1RF0 C;  4AQR D;  1R5L A;  4DOJ A;  3B5N B;  1VQM P;  5KJ7 A;  3M0D A;  3Q5P A;  1N86 A;  1T2K D;  1EDL A;  1LT1 A;  3A0B E;  5KTB A;  3VN0 A;  1LP1 B;  3HD7 D;  2QVA A;  3TF5 A;  1NYH A;  2XU6 A;  1IFJ A;  1JTH B;  5AW1 B;  4QMA A;  2O01 N;  2QJY B;  1N7S A;  2P58 A;  4YXW H;  1GW3 A;  3T97 B;  5B5E H;  2P2U A;  2ZAE B;  1BCC J;  1YYC A;  1AQT A;  3A3Y B;  1P84 E;  2D2C C;  3C8V A;  4XE5 B;  2Q7C A;  4PV1 C;  1SQQ D;  3CL3 D;  1OVV A;  4H44 B;  1XTG B;  1PFI A;  2YIU B;  5GTI H;  3D6Z A;  2E75 C;  1M1J B;  1QEX A;  3CX5 E;  4D6T G;  4YTP C;  3QWO C;  2YMY A;  2KP8 A;  1NTZ K;  1QVF O;  1JY3 P;  1OW7 A;  3CXH H;  2FFD B;  5APT A;  3L70 D;  3AE5 C;  3U59 A;  4M3L A;  3Q5S A;  1DEE G;  2QM8 A;  1HH0 A;  3TDK A;  1PP9 J;  2L91 A;  4N78 D;  1DEB A;  4BWN A;  1NH4 A;  3SWK A;  1UIX A;  1NKZ B;  1KB9 H;  4KT0 J;  3L74 E;  5AW0 B;  2B87 A;  3H1K J;  3H1L D;  2XDJ A;  2PRR A;  2CPS A;  1M8O B;  4A7P A;  2IFN A;  3B4S A;  3C1L A;  1GTW A;  5AVR B;  2ITA A;  2YKO A;  1IFM A;  3TGU J;  4UB8 E;  5TIS H;  1ZW0 A;  3HE4 A;  4PV1 D;  2WPV B;  3HUS C;  5KLV G;  4RO0 A;  2O3J A;  1K9M Q;  1Q82 Q;  1KQG B;  2R3S A;  1SQB J;  1NTZ J;  3FGA D;  5TJH A;  2QG4 A;  3L36 A;  3H1I J;  2E75 D;  1FZB A;  1RHZ B;  2WTY A;  1M56 D;  3L73 G;  2K3R A;  3BRV B;  2WSF H;  1SQX D;  4I7Z B;  1YI2 P;  5AW8 B;  2HYN A;  1RF1 A;  4C46 A;  1M1K Q;  2WT7 B;  3CWB G;  5APY A;  1W2B O;  2PFX A;  1HF9 A;  2ZXX A;  4OWF A;  3S4R A;  2B88 A;  1LT9 A;  2O1J A;  1ZRT D;  2Q3I A;  3CCE P;  2KS1 B;  1T6A A;  3EFF K;  2JP3 A;  1L4A B;  3V5B A;  1KIL C;  1URQ A;  2FXP A;  4RES B;  5EFW B;  1DIP A;  1NTK G;  1P84 H;  2IX7 C;  4N78 E;  1ZN5 A;  1NVO A;  1E5W A;  3WUV A;  1LJ2 A;  1S72 P;  5AVY B;  3O6Q A;  3H1L E;  1A02 J;  3CX5 H;  2BEQ D;  1LWU B;  3AE1 C;  4K35 A;  2WSF J;  2ZVO B;  4DCK A;  3G3Z A;  1X0T A;  3MTU E;  3AE4 C;  5AW2 B;  1N2D C;  3CCJ P;  1H0T B;  3UIA A;  2ZFC A;  3GF7 A;  1YIT P;  2N1T D;  1LTJ C;  2IBZ E;  2KNC A;  1GL2 A;  4PD4 I;  3AE9 C;  3AEE C;  2QE7 H;  1OMI A;  3PRJ A;  4JBZ A;  1QL2 A;  5APX A;  1N7S B;  1KOR A;  3CD6 P;  1OW8 A;  2YKP A;  5AW9 B;  1PPJ G;  4D6T D;  2GA1 A;  2XKM A;  3RBX A;  2QJY C; 
#chains in the Genus database with same CATH homology
 2B88 A;  4ZNC A;  1EDL A;  1LT1 A;  2KS1 B;  1FC2 C;  2OTK E;  3PH0 A;  4BXL A;  1Y47 A;  4KJM A;  2LXC B;  2RKL A;  2LXB A;  5DJU B;  1S3J A;  1LP1 B;  5EFW B;  4HB1 A;  2QVA A;  3ZDM A;  2Q1K A;  1NVO A;  5CBN A;  5DJT B;  4HKZ H;  4EYY Q;  4GOF A;  4MN4 C;  2M5A B;  3MZW B;  2P58 A;  2I8D A;  2B87 A;  5C39 A;  1EDI A;  2UWJ E;  4ASW A;  1U7J A;  2ZAE B;  2KUB A;  1SS1 A;  1JM0 A;  1OVU A;  2KZJ A;  1EC5 A;  4K35 A;  2KIK A;  2B89 A;  1LP1 A;  1OVR A;  1X0T A;  1OVV A;  1MFT A;  4GOD A;  3FXD A;  1ZW0 A;  2M5A A;  1H0T B;  2SPZ A;  1Q2N A;  5K5G B;  1BDC A;  4IOI H;  4GOE A;  1H0T A;  2KI7 B;  2QRX A;  4HJG H;  3MHV A;  4NPE A;  2LR2 A;  4K3A A;  4WWI A;  3QWO C;  4NPD A;  4ASV A;  5CBO A;  1U7M A;  2R44 A;  3RGU A;  4CPG A;  2WMM A;  2K3R A;  2M0B A;  1EDJ A;  3S1K A;  1EDK A;  4NPF X;  2HR3 A;  4ZMD A;  1BDD A;  1ZXG A;  3FXE A;  4JBZ A;  1DEE G;  2JWD A;  2KZI A;  2B87 B;  1JMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...