1BYMA

Solution structures of the c-terminal domain of diphtheria toxin repressor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
97
structure length
97
Chain Sequence
b'NPIPGLDELGVGNSDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (DIPHTHERIA TOXIN REPRESSOR)
publication title Solution structure and peptide binding studies of the C-terminal src homology 3-like domain of the diphtheria toxin repressor protein.
pubmed doi rcsb
source organism Corynebacterium diphtheriae
molecule tags Gene regulation
total genus 8
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1998-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18357 DtxR Diphteria toxin repressor SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bymA00
3HRTA 3HRSA 2QQ9A 1G3SA 2QQBA 1U8RA 3HRUA 2GCXA 1QVPA 2QQAA 3E19A 4O5VA 1P92A 1BI3A 1BI1A 1QW1A 2K4YA 1BYMA 1G3TA 1FX7A 1BI0A 1FWZA 2K5IA 1BI2A 4O6JA 1G3WA 2H3JA 3MHXA 3GLXA 1G3YA 2K5LA 2K5FA 5CVIA 2LX9A
chains in the Genus database with same CATH superfamily
3OYEA 1QP2A 1KK7A 1AD5A 1QKXA 3CCUQ 1BI1A 2QK0A 2JS2A 3CC4Q 2GTJA 7AT1B 1YP5A 2G6FX 4KBMB 4PJOF 4PNOA 1YN8A 1OPLA 4OP0A 1AT1B 4M7AF 2NYSA 4JJCA 4XU1A 1UEBA 3CCJQ 1YIJT 3M4GA 1SKUB 4XTYA 4RTYA 2DL5A 2DO3A 3WXMB 1Q82R 2O2OA 3C0CA 5IN1A 3OYLA 2CDTA 4FW1A 3V7CA 2DEQA 1VQ9Q 2DLPA 2EGCA 3P8BB 2PVGB 3J7AF 3CBPA 4M7DC 2QQAA 1YWPA 2DF6A 1AZEA 4HKEA 1UGQB 4F14A 2QA4Q 1NZ9A 3QWXX 1MMNA 2YHTA 5FU7C 9ATCB 3I55A 1H3ZA 2AZVA 2DTHA 3V8JA 1M3BA 1OX8A 2A28A 4FIBA 4M78G 5GAOl 1MHNA 3H0FA 2YRCA 3D7SB 3QDRB 3VRYA 1LVKA 1QVPA 1BU1A 2PUKB 1QCOA 1UGRB 4N4GA 3NTIA 4D6WA 1H641 3G6EA 3CPWS 5IHIA 4M4ZA 1Z9ZA 2OTLQ 1K73R 1YITQ 1GBRA 2L3QA 2K2MA 1VQ6Q 1MMAA 1X6GA 3PFSA 5FWBA 5FROA 2RJFA 2F69A 4QVDA 3CD6A 3SWNA 4JLIA 1PSEA 2XIDA 4AFZC 5GMKm 2FZGB 4AG2C 2C06A 2I0NA 1Y57A 2JTFA 4PFPA 2LTOA 2W0ZA 2DL7A 4LNPA 2EYYA 2D8JA 4LUEA 3SD4A 2RI3A 2I2LA 2DILA 2MYSA 4BE2A 5L23A 4M7DG 1D3BB 1B34A 2DD4A 1VQ8Q 1NBEB 3QYHB 3VS1A 3OYGA 4OF1A 4YTLA 4BB7A 5GANf 4JRIA 4E7HA 2HDAA 1Q86R 3EFSA 3UT1A 1YJNQ 3BE3A 3OYMA 5C6SA 1NPPA 2XI9A 1CKBA 3OSVA 3PIPA 2CREA 4BUGA 5GANg 2LVMA 2HKNA 4DQ2A 3NPFA 3EG9B 2LQ8A 1WJSA 1O9SA 3PGGA 3CPWP 1K8AU 4UC4A 5ECAA 3LWIA 5KYWB 3REAB 4QVCA 2EAYA 1JU5C 2L2PA 1M1KR 4QKUA 2CT3A 1RACB 3EH2A 2FPEA 2M1HA 2PZ1A 3TCJA 3E9FA 2YSQA 1SF9A 4M75G 4AFUC 2XKOC 2ZPBB 2QQRA 4Q5WA 2AKLA 4J6WA 1I0CA 3M54A 3EFRA 2H3JA 3OS0A 2KR3A 2B8AA 2K5LA 4M78E 5I22A 4HCZA 1K9MR 2ZPIB 3HPWA 1SSHA 2DRMA 2NUTA 3OMGA 2IPOB 3CCRT 1Q7YR 2DNUA 2AIRB 1Q81R 2MAMA 2EJFA 1X2QA 1V1CA 3BDUA 1UGSB 4JJNK 2QTVA 1XOVA 3VYGA 2RHYA 3I35A 4A53A 1WI7A 1WIEA 4PJJA 3I56T 5CCAA 2DZCA 5CO7A 4DBQA 3HTRA 3UDCA 1SRLA 1VQLT 4GLKA 2DA9A 1AWOA 1M1FA 1OULA 1G2BA 1X75C 2JW4A 5IHNA 2V8IA 2F5TX 1VQ5T 4LDXA 1MNEA 4LDWA 1D1CA 1HXDA 4L6V5 3JCMd 2JT4A 1DJ7B 1LOJA 3OS1A 4C0GA 2KEAA 3A8MB 2X4WA 2M9UA 4RCCA 3JCMh 2A36A 2XD0A 4KH1B 1G5VA 4ELZC 4WF2A 2FEIA 1PM3A 1ZSZB 4C92E 2P4RA 2RMOA 2RK1A 3MPUB 5GANh 2X3XD 3CPWA 2K3BA 2E10A 2EYQA 4CC3A 3TSZA 1WHJA 2E3IA 2MMPA 2O4XA 1SEMA 1YHQA 3JB9J 3CC2Q 2DL8A 1YFNA 3DLLA 4M75E 4Z8AA 5LJ5j 1UHFA 3CBOA 1M2OA 3F70A 3HL8A 2EKHA 2AK5A 4OB0B 1SSFA 2DTIA 3EGDA 2FZKB 2O01E 1VIFA 3SWNB 4MMLA 1YI2A 1KSWA 2JTMA 2YT6A 4IUTA 3MHXA 1C1AA 1IRXA 2JVVA 2M0OA 4CC4B 4KULA 2XU8A 2CP2A 1UGVA 3DKMA 5CK9A 4AMCA 1M5Q1 2EBPA 4XK8E 3OS2A 4C0ZA 2Y4YA 3CC7A 1M8MA 3CCJA 1B34B 1QMCA 2DJZA 4RTVA 4Y91A 4F7UB 2J6FA 4AT1B 3EG3A 2MCNA 2HL5C 3OYHA 1YIJQ 4X34A 2DD5A 2F2XA 3M0RA 1WNLA 3E9GA 3FLGA 1VQPT 2H3EB 2CSQA 2AHJB 1YJWA 1W6XA 2ABLA 2SRCA 1U8RA 1KJWA 3KXTA 3QJ6A 1VQ9A 3QHSA 5KYXA 4RTZA 4DBFA 2HZYA 5HY6A 4JS5A 1UFFA 1N6AA 2DAQA 2DMOA 5GAMf 1KIKA 2QA4A 1YJ9A 4ATOA 3MKDA 2FB7A 2P0KA 3CCVQ 4BACA 2DVJA 4MZTA 5FU7B 4E7SA 3HRTA 1ARKA 4EMKA 4RCBA 3RKXA 4M77A 5GAMg 4R56A 2CP5A 1VQMQ 2H8HA 5LJ5d 2CGHA 4L59A 3A98A 4FYWB 1FMWA 1UJYA 2QTXA 3RBBB 2OTLA 2JNGA 2RB6A 1WX6A 3UA6A 2RM4A 2V1RA 3SEMA 4M7DF 3REBB 1NYFA 4XU0A 5GAOr 4CC7A 4OGEA 2RHIA 3META 3H9NA 2D0NA 1GBQA 4OB1B 3QO3A 1VQNT 3L1AA 4FYVB 2PVOB 3NGPA 2JJ9A 4PJOA 4E2FB 4DBHA 1MUZA 2RNAA 4A4GA 3JV3A 3L2WA 1Q82U 4PJNA 2GQIA 3S3MA 2QEXT 8ATCB 3R6OA 4J9BA 4F16A 2LX7A 1SHFA 4BD3A 4BDYA 3HSBA 3VYHB 3VS4A 2MI6A 5KYYA 1YJNA 3LH5A 3CCQT 2FRWA 2QYZA 2EFIA 1FX7A 4XTWA 4FW2A 2E5KA 5CKDA 3VUBA 2LRQA 2RF0A 3G1JA 3VS6A 2D8HA 5IAYA 5GJWB 2LNVA 2CP0A 2E64A 1O75A 2SEMA 5CVIA 2QGFB 2RHUA 5FU6C 3GNFB 4FT2A 3OB9A 1OX9A 4E6RA 3QWYA 2O9SA 3CMAT 2RPNA 3LGLA 1ZA1B 5A2QE 2HL3A 4M7AE 3BY7A 1GRIA 2YUNA 4KGXB 3UF4A 2RQWA 1RAFB 1PHTA 2R58A 3QZ5B 3M9QA 1AHJB 2KQWA 3NMZC 5CKFA 1QWEA 3M56A 5GANe 5FW9A 2K7AA 1VQKT 2HEQA 4OMMA 4DOVA 1QW1A 3E2UA 3M0PA 4A63B 1ABQA 4ZGJB 2KRSA 2YWWA 3CCRQ 1QVFS 1N9RA 1N8RR 3A1PA 4HCCA 4C5GA 1U1TA 1ZA2B 1SPKA 1ZBJA 2CP7A 2KYBA 3GF5A 2FPDA 4OMNA 5GJVB 1GL5A 1R8OB 2M0YA 1UDLA 3I56Q 3ZBDA 1JXOA 4ELYC 2YRVA 4X9CA 5IXFA 1M90R 2CKKA 1VQLQ 1KQ2A 2F5KA 1KC8U 5KYUB 5IHKA 4DA4A 1K0SA 1OPKA 3QBYA 1IZ6A 2E6NA 2ECZA 3DB3A 1VQ5Q 1UJ0A 2OJ2A 1FYNA 3V8KA 4FCYA 4M77D 2MPXC 2DXBA 3RMSA 5KYXB 2YDLA 1D0ZA 1M2VA 3UA7A 1H8KA 4J5YA 1M27C 1VQ7A 1M1KU 2O9VA 2MK5A 1VYTA 4O6JA 4R0KA 1QCNA 4JRQA 2KT1A 4F04B 4D8KA 2KDSA 3AT1B 2BUDA 1OOTA 2C0TA 3S6WA 5D6YA 2JM9A 4IUVA 2KRMA 3FJPA 3ULRB 1BKBA 5GAOn 1K9MU 1W4SA 4PJOD 1Q7YU 2E41A 1YNZA 3RUXA 3BDLA 1Q81U 2V8KA 4ZGEB 2XICA 1RI9A 1ZUKA 3JCMc 2E65A 1G3SA 3M0UA 2COWA 3VS0A 4PJOB 3GNGA 3X20B 2VB6A 2ATCB 2DYBA 3SWNC 4ZNXA 5DLOA 1VYVA 2VKNA 1PSFA 3CCSA 1KD1U 3CCET 4EMHA 2LCSA 1XQHA 2XDDA 3G71T 1QVGS 3G4ST 1MV0B 2BZ8A 4OMOA 1NJIR 5KYYB 4J9GA 2R5MA 4PJMA 5D6XA 3A5ZB 5CKHA 2CSIA 2ESWA 2FO0A 2L0AA 2WACA 5HKCA 1LNXA 3FB9A 3CCVA 1ZUUA 1VQ4Q 4DEYA 2EPDA 4RG2A 1D1AA 1K4US 1X01A 3VJPA 2KNBB 3ER0A 2BZXA 1EIFA 2OI3A 1ZHIA 1BBZA 4PL6A 1VQMA 1WHKA 2EJGA 1RL2A 1Q82C 2LT4A 1IHWA 2L3PA 4QT7A 1QVFA 4RTXA 2XG8D 4Z89A 5D6WA 4JZ4A 1X43A 3L2UA 3UPUA 2A37A 2K3XA 2FVUA 3RMQA 2ENMA 2JOYA 4C8QD 1QVGP 3X25B 1S72A 5GAMe 4JJDA 2KMTA 2E12A 3CCLA 4F7UG 2ZZDA 3I55T 3PT9A 3IQLA 1VQNQ 4Y28E 3OYJA 2BKDN 2CYZB 2FPFA 4C8QB 2DL3A 3JCMf 1BI3A 2KT8A 2PUOB 3DLMA 3GP8A 5GAN7 3G6ET 1X27A 1PD1A 2CUBA 3JCMg 1UTIA 1BIAA 1D0XA 2X4XA 1OZ2A 1M3AA 4XU2A 1M2VB 3CD6T 4M78A 3CCQQ 4JUVA 4C5HA 5GAOq 4E7ZA 2EKOA 2ED0A 2M51A 4J9IA 5IH2A 5FU6B 5LJ3j 2P0QA 2RQVA 2E3HA 3QKJA 3EG0A 3EHRA 1YCSB 2KROA 3HFNA 3CMAQ 2LJ0A 4EIKA 4AG1C 4FM4B 1NEBA 3OYCA 3HRUA 4N4IA 1G8XA 2EGAA 1KC8C 4N4HA 3VRZA 2EIFA 3M59A 2DERA 3SB2A 3M53A 1W70A 2KGTA 1RAAB 2AT1B 1KHCA 3TEEA 2P84A 2L8DA 2ZPHB 1AWJA 1VQKQ 1XTDA 3C4SA 2DRKA 3AHUA 2OTJQ 5AYFA 5FLXE 2PVDB 2VXEA 2X35A 1QVGA 1JQQA 3PIOA 3JB9D 1I8FA 1RLQC 5GAN6 3EHQA 3DB4A 2A08A 1WJRA 4J8OA 2DXUA 1BCOA 3JCMQ 4FL6A 3Q1JA 4WCIA 4LD9K 4C92A 4F7UE 3OMCA 2K5FA 2YLCA 1OEBA 4MZMA 2AKKA 1K9MC 1QQJA 1ABOA 1Q7YC 1YCYA 2HD0A 3U23A 2DL4A 4M75A 5LJ3d 4IIMA 3TQ7P 3QSUA 3S3OA 1JJ2S 4M7DE 1BCMA 1ZUYA 2K5IA 3FDRA 3CCMQ 3QUIA 4J6XA 5GAN3 3JCMb 4OMPA 2L89A 1IHVA 2KXDA 1G3YA 1WHGA 2ROTA 1M4ZA 3CMEA 4BE1A 5FRNA 1VUBA 3PNWC 5LJ5f 1I81A 1RLPC 4ORZA 1KD1C 4AFSC 5GMKj 1TUGB 1XJWB 4EMKC 1U5SA 4M77C 2EW3A 1GCQA 1I1JA 4CI0C 1MGQA 5LJ5g 3OYDA 1I5OB 4AFQC 2HAXA 2XMFA 1J3TA 3LX7A 4Z88A 1KQ1A 3EGXA 2K2VA 3HRSA 4OB2B 1WDXA 2QDYB 1N8RU 2R57A 2PU9B 5J3BA 4HA8A 1WA7A 1TG0A 4X9DA 3V7SA 2MF2A 3CCUA 4LDVA 5FWCA 4GLMA 3CC4A 4FYYB 2EYZA 1M90U 4Y92A 3T9NA 2VWFA 2DM1A 2FZCB 4M78D 2MIOA 3C94A 1RAEB 5I21A 3PTAA 4PJOC 4A4FA 1D09B 1PCXA 1JJ2P 2QQBA 1RAGB 1R0CB 5EC7A 3ZL7C 1YHQT 2HQEA 2E70A 2Y90A 3G71Q 5IT9E 3G4SQ 3RIRA 2DTOA 4PKCC 4M78B 3WVDB 1YI2T 2HBWA 2COYA 3OYNA 1ACMB 2LT1A 1VQ4A 2YXYA 2L3RA 1HJDA 2J06A 4ZTFA 3CCJT 3CC7T 4LXCA 3SHWA 3VS3A 2KXCA 1T0JA 1Z9QA 5CQXA 2MWOA 2DKGA 4PJLA 3MP1A 1MNDA 2CZ7B 2QG9B 1WXUA 1N27A 1YJWT 1TXQA 3V7RA 1M3CA 4F7UF 1RAIB 1P92A 2RI2A 1VQ9T 1SG5A 1Y71A 4WTOB 1I5LA 1S1NA 4C92D 2D9TA 2EWNA 3MJXA 1JRIA 2RHXA 1YJ9T 2NUTB 1NLPC 5LJ5h 4B9WA 1YITA 1VQ6A 2EJ9A 4RG8A 2L3SA 2EQKA 1CSKA 5GAN2 1JO8A 2J05A 4J9EA 4C5EA 1K76A 4M75D 2KSSA 4C92B 2DX1A 1NJIU 3I55Q 4VUBA 3TSWA 2VASA 3M0SA 4A4EA 1W2BS 3L2VA 4CRIA 1Y0MA 4M7AA 4XTVA 1K8AC 1JJ2A 2EQMA 4C8QC 4A4KA 2DPPB 1Y96A 3BW1A 1VQ8A 2Y4XA 4E47A 3G6EQ 4M75B 1BIBA 1U1SA 1HD3A 4TVRA 1PG5B 2CH4W 4LUDA 5DY9A 2F2VA 4IIOA 1QP3A 3VKIA 3CD6Q 1IREB 2JZ2A 4OMFB 2BZYA 3OA6A 3I9QA 1D0YA 4LDYA 3EAEA 3CMAA 1YWOA 2K9GA 1IGUA 2HQHA 1AVZC 2RQRA 5GAOp 4RUGA 3H6ZA 3JCMe 3M0QA 4XTUA 5HCKA 2FHDA 2VV5A 3M57A 1KQSS 1IO6A 3EGXB 1BK2A 3PMTA 2FYKA 2O4XB 2XDBA 3MEWA 4EPCA 4HT8A 4BE0A 1K73U 3OBWA 2OTJA 2J6OA 1W2BP 3A8GB 1WJQA 4E7KA 2VGNA 1TTHB 3EGDB 3MEUA 2RH2A 4X1VA 4C8QG 3RESA 2HKQB 2WSEE 2ZCFB 4FSSA 5A0GA 1WFWA 3H8ZA 1WPYA 5GAN8 4NS5A 3JB9I 2X3WD 3GIBA 2FRYA 3JCMW 2OX7A 2WSCE 3O5ZA 4ZGDB 1JXMA 3FJ5A 3FC3A 2VC8A 5IXBA 1B3QA 3TREA 1ZLMA 2O31A 1EFNA 2A7YA 4KUIA 1Q86U 4PFOA 3M0TA 4RKUE 2DBKA 2JMCA 3FRNA 1VQOT 1NG2A 2X4JA 3CCMA 1VIEA 2D6FA 5J39A 1KQSP 5M9OA 2R5AA 2E6ZA 1E7OA 2NLUA 3QIIA 2B86A 2JUFA 4L5GA 4J9HA 3HHTB 2NUPA 1SHGA 1TUDA 1M90C 1F1BB 3OSSC 1K9AA 2RI5A 2GTOA 1OU8A 1IB8A 2CP6A 2QI2A 5I2SA 4XU3A 3GLXA 4EMKB 1D3BA 4M77B 2CZ0B 2DE0X 3OQ5A 2OAWA 3MO8A 1QVFP 3CXCS 4R55A 3EGUA 1HK9A 1A0NB 1FMKA 3GBQA 3C12A 5GAN4 3CC2A 1ZBXA 3I5SA 3OYBA 3QYGB 1EZZB 3E1SA 1T3SA 1G3TA 2X9HA 4N0AA 1D1BA 2HQXA 1UG1A 1VQ7T 1Q95G 4M7AD 1WQ7A 1IGQA 4NOYA 2K6DA 4JLGA 4E7JA 1W2BA 2CT4A 3MEVA 4HVWA 1VOMA 1TOVA 2LCCA 1UGPB 5A0LA 3JB9G 4C8QE 3QG1A 5LJ5e 1OU9A 2EGEA 2LP5A 4B6MA 2W10A 4M7AB 3HP9A 3LGFA 2KYMA 1PRLC 2LJ3A 3C95A 2EQJA 3OYAA 1Y96B 2RQTA 1G83A 1YHQQ 3FEOA 2KE9A 1YIJA 2GQVA 5CR2A 1YI2Q 1OQKA 1BYMA 2LZ6B 3A8HB 4M78C 1VQPQ 1QKWA 3CCST 2P0PA 1OZ3A 2ZPFB 3UATA 3CXCP 3CBMA 3ME9A 4JDSA 3M58A 1TSFA 2MWPA 2KVQG 1KQSA 4II1A 3VS7A 3NFCA 4J7IA 3CC7Q 2KI7A 3CPFA 5CQYA 1NJIC 2K57A 1M1GA 3JB9H 4QQGA 4C5IA 2LDMA 1FWZA 2E4HA 4K11A 5A0DA 1YJWQ 4FSXA 1B07A 4BI4A 4A54A 1X2KA 3CCVT 1IXDA 2ZGWA 1YJ9Q 2A0FB 2LCLA 1I4K1 1VQMT 1ZSZA 2DIQA 1OV3A 1WXBA 2BIVA 1UB4A 3JCMX 4ZTJA 5GAN5 4J9DA 2QQ9A 1WHLA 5CIUA 4C92C 1HSQA 2LQKA 4FU6A 3OS5A 5LJ3f 1QLYA 2HCKA 1T0HA 2YUPA 2GFAA 1RI0A 1N5ZA 2GFUA 1LPLA 2X4YA 3KUFA 4KGZB 3JCMV 2EVRA 2QEXQ 3PE0A 5LJ3g 1K73C 1S72T 4M75C 5KYNA 5KCOA 3CCLT 2QQSA 2LQWA 3H0HA 2C0OA 4LE9A 2NUPB 1TWBA 1C6VX 4JPBW 2YRDA 1AEYA 3EG2A 4JZ3A 3J81E 4OVAA 3CXCA 2JMAA 4C8QF 3JCMJ 1PNJA 3QZ9B 1WZOA 1GFCA 2IG0A 4F7UA 4D8DA 1Y7XA 4J6YA 3GPLA 2RO0A 3FIFA 1KC8R 1GCQC 3VV0A 3PMIA 3PVLA 4C0DB 5KE3A 4NL3A 1WYXA 1Q86C 2K4YA 4IURA 3RNJA 5I2MA 3L2QA 4ZN3A 2ED1A 4C92G 1TH7A 1H3HA 3LW5E 2LC4A 2DK3A 3L2RA 1TU0B 4M7DA 1WHHA 1MMGA 3J80E 1UECA 3CCRA 1VYUA 3V8LA 1RABB 1OI1A 1PKSA 3MEAA 2RHZA 5GANj 4IUQA 3E19A 1M1KC 2EQIA 3I56A 4Z02A 1V76A 1VQLA 2M02A 4PFZA 3H41A 1H92A 2CP3A 4BY6B 3BFMA 5LL6S 4RMOA 1PKTA 2V26A 4GY5A 1M9SA 1WHMA 5CKEA 4RTWA 1VQ5A 3TVTA 4XTZA 2E1HA 3L42A 1VQOQ 2F2WA 4FT4A 1Q81C 4HXJA 3VUZA 2RQUA 3M55A 4NL2A 1ZQ1A 4HT9A 1FMVA 3URGA 1E6GA 3HKSA 4IUPA 1M8VA 5LJ3h 1R77A 3NHNA 2RK2A 1KD1R 5GAOm 4HCKA 4OMQA 4ME7A 2EYXA 1YBYA 2NUZA 3JB9F 5EG2A 4CC2A 2QDLA 3QPHA 4HVUA 2CZ6B 8AT1B 2C0IA 3OYYA 1WLPB 3OBYA 4IUUA 2KBTA 3OYKA 1RADB 2QGGA 3CMET 3A8LB 2LNHB 2XK0A 2JTEA 1UE9A 1VQ7Q 5GANd 2JXBA 2DEUA 5D7UA 3X26B 2VUBA 1TS9A 2PQWA 3GOXA 2JS0A 3M4YA 4XTXA 3EFOA 1ZSGA 3JRZA 4E7LA 3S3NA 3P8HA 1UHCA 5J26A 3CCEQ 2VXFA 4LDUA 2HNIA 1JBMA 1X6BA 4M7AC 2L5QA 3RKWA 2XHCA 1MMDA 2K3YA 2LMJA 4EDUA 4KUDK 3CCUT 1VQPA 1BB9A 4KGVB 3CC4T 4HVVA 1XNIA 1GXIE 2COZA 3THKA 4M77G 4DOWA 2M16A 1E6HA 1NM7A 3CCSQ 4HCBA 2BE7D 3RDVA 5C0MA 1FXXA 3R6NA 3A8OB 4P5NA 4IKFA 4C0FA 4M7DD 4JJBA 5KYUA 3HFOA 3VS5A 1QWFA 2RJEA 3MP6A 1HYOA 3MCAB 2VYTA 5GMKh 4MDXA 5HK3A 4M78F 4QW2A 3EG1A 3EH1A 1GFDA 2MOXA 3G7ZA 1VQ4T 4M7DB 4PJOG 4MMKA 3UWNA 3KFVA 2DXTA 5FRMA 2DVEA 2DXCA 3VS2A 3LWHA 2PTKA 1KG1A 4J83A 4M7AG 1MV3A 4B9XA 5AT1B 3NTKA 2OAUA 4ZN1A 2QA4T 1PWTA 3X24B 2PNIA 2FL7A 3JCMP 1KHIA 1VA7A 3JSCA 3SDZA 1VQNA 2KAFA 3X28B 2YUQA 4DEXA 1NEGA 3ASKA 2JN0A 1K8AR 1U3OA 6AT1B 5GAMj 2V1QA 5GMKi 2HBPA 1X69A 3RR6A 1PD0A 4BI3A 2QEXA 1AOJA 2OTLT 2LQNA 4JS4A 1YITT 4KRTA 3OW2S 1VQ6T 1GCPA 1ZX6A 2EYWA 2QASA 1B7TA 2ZPEB 4LD6A 3CCQA 2J6KA 2CH4A 1S72Q 3CCLQ 3M5AA 4F17A 2HMAA 2ZPGB 2F1LA 2RJDA 2HSPA 2NWMA 2IIMA 3VU3C 1AWWA 1KFZA 4C92F 2QAZA 4M77E 1V29B 2RN8A 3LH0A 1VQ8T 1NPRA 1RAHB 2CZ1B 4OMLA 5LJ3e 2YUOA 5HK0A 3QJYA 5I11A 4DBRA 2GGRA 2ZAEA 2ROLA 2LJ1A 4PLLA 5DLQE 1YJNT 2VVKA 4M75F 3OY9A 3INZA 5L8RE 1NLOC 2CS7A 1NE8A 1I07A 2LX9A 4N0AC 4C0DC 3SFMA 2Z0WA 1VQKA 2GCXA 4MZPA 4KH0B 4KT0E 2RA2A 2O88A 4LN2A 1LCKA 4RTUA 3JAME 1X6OA 4PJOE 2P4TA 4OGCA 4ANJA 2A3LA 2BTTA 3EFOB 2GBQA 1BI0A 1RUWA 3OW2P 2FG0A 4E7IA 5GAMd 1LJOA 3H0IA 4EMGA 2IVWA 1R0BG 2V8JA 1T3LA 5GAMh 2OTJT 4PLIA 3O8VA 1EX4A 2JM8A 1JB0E 1WGSA 2AZSA 3P8DA 2HSEB 3CEYA 2CUDA 4XQ3A 1VQOA 4BY6C 1BI2A 2KK4A 2RJCA 4JRPA 1M30A 1AWXA 2D1XA 1OYXA 3WVEB 3ZFJA 3MP8A 1N8RC 4J7FA 5KE2A 2DYIA 3N5BB 4A4HA 2EQUA 4J9FA 4O5VA 1W1FA 3OYIA 4XAXB 4C8QA 2WSFE 3NTHA 2KY9A 3QDFA 1K1ZA 3RKYA 1PRMC 2DJQA 2XDPA 2X51A 1K0XA 1U06A 4RTTA 4ESRA 4QVZA 1PC0A 2BE9B 3OYFA 3CCMT 4MDWA 3PVQA 3RERA 2KRNA 4PK4A 1NYGA 4GBQA 2DFUA 2DZ9A 2DIGA 5GMKe 2E5QA 3L2ZA 3LLRA 4QQ6A 4BDZA 3CMEQ 5DM7R 3ZEHA 3TU4K 4OB3B 5GMKl 5CKBA 1QCFA 2GF7A 4J9CA 4JRKA 3EG9A 5KCHA 4QQDA 1N9SA 1UUEA 2GNCA 1ZSZC 2D0QB 1TUCA 1SRMA 5KYWA 1JEGA 1WQWA 3CCEA 3KBGA 4M77F 3OW2A 4FYXB 1CKAA 3I5RA 4V2SA 2VGMA 3QXEB 3CC2T 2DBMA 1AZGB 3G71A 1G3WA 2RD1A 1C0MA 3G4SA 2QXFA 3LYIA 2G3RA 2K79A 2YLBA 3CQTA 2J7IA 5CAIA 5KH6A 2DETA 4BI8B 1Y07A 1WXTA
chains in the Genus database with same CATH topology
3GNFB 4A4FA 2RO0A 3OB9A 4FT2A 1QP2A 3OYEA 3FIFA 2QQBA 3VV0A 3PMIA 3CMAT 1YHQT 2HQEA 4C0DB 5KE3A 1BI1A 3LGLA 4NL3A 2E70A 2Y90A 1Q86C 2K4YA 4IURA 5IT9E 3RIRA 5A2QE 5I2MA 2DTOA 3L2QA 4ZN3A 4C92G 1TH7A 4M7AE 3LW5E 2LC4A 2DK3A 3BY7A 4KBMB 4PKCC 3L2RA 4M7DA 4M78B 3QZ5B 3WVDB 2R58A 1YI2T 4PJOF 3J80E 4PNOA 3M9QA 3CCRA 4PJOC 3V8LA 4OP0A 1AHJB 2KQWA 1OI1A 3OYNA 5CKFA 4M7AF 3M56A 3MEAA 2RHZA 5GANj 5GANe 4XU1A 1UEBA 4IUQA 2LT1A 1VQKT 3E19A 1YIJT 3M4GA 1VQ4A 4DOVA 1QW1A 2L3RA 1M1KC 4XTYA 3I56A 2DO3A 4ZTFA 4Z02A 3CCJT 3CC7T 3WXMB 4ZGJB 1QVFS 1VQLA 1N9RA 4HCCA 5CQXA 4C5GA 5IN1A 3OYLA 2MWOA 2DKGA 1U1TA 4BY6B 3BFMA 5LL6S 3MP1A 4RMOA 2CZ7B 3GF5A 3V7CA 2DEQA 4GY5A 1N27A 1M9SA 1YJWT 5CKEA 1R8OB 2PVGB 3P8BB 3V7RA 4F7UF 1VQ5A 3CBPA 3J7AF 4M7DC 2QQAA 4XTZA 3ZBDA 2E1HA 4ELYC 2YRVA 1P92A 4X9CA 4HKEA 3L42A 1UGQB 2CKKA 2RI2A 1VQ9T 1Y71A 1I5LA 4FT4A 2F5KA 1Q81C 1NZ9A 1KQ2A 1KC8U 4C92D 2YHTA 5FU7C 2D9TA 4DA4A 3VUZA 3M55A 4NL2A 3I55A 1ZQ1A 2DTHA 3QBYA 1H3ZA 1IZ6A 4HT9A 3V8JA 2EWNA 1JRIA 2RHXA 2E6NA 3URGA 3DB3A 1YJ9T 3HKSA 4IUPA 5LJ5h 4B9WA 5LJ3h 1YITA 1M8VA 1VQ6A 3V8KA 2EJ9A 4RG8A 4FIBA 4M78G 2EQKA 4M77D 5GAOl 1MHNA 2RK2A 2DXBA 3RMSA 5GAN2 3QDRB 5GAOm 1QVPA 2PUKB 1UGRB 4ME7A 4N4GA 4C5EA 4M75D 3NTIA 2KSSA 4D6WA 1H641 4C92B 3G6EA 3CPWS 1YBYA 1NJIU 4J5YA 1VQ7A 5EG2A 3JB9F 4VUBA 1M1KU 3QPHA 4A4EA 1W2BS 2CZ6B 3L2VA 4O6JA 3PFSA 4BI8B 4CRIA 5FROA 2RJFA 4JRQA 2F69A 4M7AA 4QVDA 4XTVA 1K8AC 1JJ2A 3CD6A 3OYYA 3SWNA 2EQMA 2KDSA 3OBYA 1PSEA 4JLIA 4A4KA 4IUUA 4C8QC 2DPPB 2BUDA 2XIDA 5GMKm 1Y96A 3OYKA 3BW1A 1VQ8A 3S6WA 3CMET 2Y4XA 4E47A 3A8LB 5D6YA 2XK0A 4M75B 2C06A 1BIBA 1U1SA 2JTFA 5GANd 2LTOA 4IUVA 3FJPA 1BKBA 4TVRA 5GAOn 1K9MU 1W4SA 3X26B 4PJOD 5DY9A 2VUBA 2E41A 2PQWA 1Q7YU 3GOXA 1QP3A 3RUXA 3SD4A 3VKIA 2RI3A 2I2LA 3BDLA 3M4YA 2V8KA 1IREB 4XTXA 4BE2A 1Q81U 4M7DG 1D3BB 4ZGEB 1B34A 2DD4A 2JZ2A 4OMFB 2XICA 3OA6A 3QYHB 3JRZA 3PTAA 4LDYA 4E7LA 3JCMc 3OYGA 3P8HA 3S3NA 4OF1A 3EAEA 4YTLA 4BB7A 3CMAA 5GANf 2E65A 1G3SA 5J26A 4JRIA 4E7HA 3EFSA 2VXFA 4LDUA 3UT1A 2HNIA 1JBMA 3OYMA 4M7AC 4PJOB 3GNGA 2L5QA 3X20B 5C6SA 5GAOp 3RKWA 3H6ZA 3SWNC 5DLOA 3JCMe 2XHCA 4XTUA 1NPPA 1PSFA 3CCSA 2K3YA 2XI9A 3PIPA 3OSVA 1KD1U 3CCET 4BUGA 2FHDA 5GANg 2VV5A 4EDUA 3M57A 2LVMA 4EMHA 1KQSS 4DQ2A 4KUDK 3CCUT 2LQ8A 1VQPA 1XQHA 2XDDA 3PMTA 2FYKA 1WJSA 3G71T 2O4XB 3CC4T 1QVGS 2XDBA 1O9SA 3MEWA 1XNIA 3PGGA 4EPCA 3G4ST 4HT8A 1GXIE 1K8AU 4UC4A 4BE0A 1K73U 3OBWA 3LWIA 4QVCA 2OTJA 2EAYA 4M77G 4DOWA 2M16A 2R5MA 4HCBA 3A8GB 3TCJA 1WJQA 2M1HA 5D6XA 2VGNA 4E7KA 5C0MA 3E9FA 3A5ZB 3MEUA 4C8QG 2RH2A 1FXXA 4M75G 5CKHA 3RESA 2XKOC 2ZPBB 3A8OB 4P5NA 2WSEE 2ZCFB 5A0GA 4IKFA 2QQRA 4Q5WA 3H8ZA 4J6WA 4C0FA 4M7DD 1WPYA 3M54A 5GAN8 3EFRA 2WACA 2H3JA 4NS5A 5HKCA 3OS0A 3JB9I 3GIBA 3JCMW 3HFOA 1LNXA 2B8AA 2K5LA 4M78E 2WSCE 3FB9A 4HCZA 2RJEA 3MP6A 3MCAB 2ZPIB 2VYTA 3HPWA 5GMKh 4MDXA 4ZGDB 3CCVA 3CCRT 3OMGA 5HK3A 4RG2A 1X01A 3FC3A 3VJPA 4M78F 4QW2A 2VC8A 2MAMA 3ER0A 2EJFA 1EIFA 3BDUA 4JJNK 1UGSB 3TREA 1XOVA 1ZHIA 3VYGA 2RHYA 3G7ZA 1VQ4T 2A7YA 4M7DB 4A53A 4PJOG 4PL6A 4KUIA 4MMKA 1VQMA 3UWNA 2DXTA 1Q86U 5FRMA 3I56T 2DVEA 2DXCA 3LWHA 5CCAA 2DZCA 4RKUE 5CO7A 1KG1A 4J83A 3UDCA 4M7AG 2EJGA 1RL2A 4B9XA 3NTKA 2OAUA 3FRNA 4ZN1A 1VQOT 2LT4A 2X4JA 4GLKA 3CCMA 2QA4T 1Q82C 1VQLT 3X24B 1QVFA 2FL7A 2XG8D 3JCMP 1KHIA 1VIEA 1M1FA 2D6FA 5D6WA 3JSCA 1X75C 3UPUA 2V8IA 5J39A 2F5TX 2K3XA 3SDZA 3L2UA 1VQNA 2FVUA 2KAFA 3RMQA 5M9OA 1VQ5T 2R5AA 3X28B 4LDXA 2E6ZA 2JOYA 2NLUA 3QIIA 4C8QD 2JUFA 4L5GA 4LDWA 3HHTB 1HXDA 4L6V5 3JCMd 3X25B 3ASKA 1M90C 1DJ7B 2JN0A 1LOJA 3OSSC 2RI5A 1S72A 3OS1A 4C0GA 5GAMe 5GAMj 5GMKi 2QI2A 3A8MB 5I2SA 2KMTA 2E12A 2HBPA 3GLXA 4XU3A 4F7UG 3CCLA 2X4WA 2ZZDA 4EMKB 3I55T 1D3BA 2M9UA 4M77B 4RCCA 3PT9A 3JCMh 4BI3A 5I21A 4Y28E 2CZ0B 2QEXA 2OTLT 4JS4A 2XD0A 3OQ5A 1YITT 1G5VA 3OW2S 1VQ6T 4ELZC 3OYJA 2BKDN 2CYZB 4C8QB 2ZPEB 3MO8A 4LD6A 4WF2A 4R55A 3CXCS 3JCMf 3CCQA 1BI3A 1HK9A 2PUOB 3DLMA 3C12A 5GAN4 3GP8A 5GAN7 1ZBXA 3CC2A 3OYBA 4C92E 3QYGB 3E1SA 4N0AA 1G3TA 3M5AA 3G6ET 2ZPGB 2HQXA 2RJDA 1VQ7T 2RK1A 5GANh 3CPWA 4M7AD 1WQ7A 2E10A 2EYQA 4NOYA 4JLGA 3JCMg 3VU3C 1BIAA 4E7JA 2X4XA 4C92F 1OZ2A 1W2BA 4M77E 4XU2A 3CD6T 2MMPA 4M78A 2O4XA 1V29B 3MEVA 4JUVA 4C5HA 5GAOq 2EKOA 1YHQA 3JB9J 2LCCA 1UGPB 3LH0A 5A0LA 3JB9G 4C8QE 1VQ8T 3DLLA 4M75E 1NPRA 2CZ1B 3QG1A 5FU6B 5LJ5j 5LJ5e 3CBOA 5LJ3j 3F70A 5LJ3e 3HL8A 2P0QA 5HK0A 4OB0B 3QJYA 1SSFA 2DTIA 3QKJA 4M7AB 2O01E 1VIFA 3HP9A 4PLLA 4MMLA 5DLQE 3SWNB 1YI2A 3LGFA 4M75F 2JTMA 3OY9A 1YJNT 4IUTA 3C95A 3INZA 3MHXA 5L8RE 3HFNA 2CS7A 2EQJA 3OYAA 1Y96B 1NE8A 2JVVA 2M0OA 4KULA 4FM4B 3FEOA 2XU8A 2LX9A 3DKMA 4N0AC 4C0DC 5CK9A 3SFMA 3OYCA 1VQKA 1YIJA 2GQVA 3HRUA 4N4IA 2GCXA 5CR2A 4MZPA 1M5Q1 4KT0E 4XK8E 3OS2A 2RA2A 3JAME 4C0ZA 2Y4YA 1X6OA 4PJOE 1KC8C 2P4TA 3CC7A 4N4HA 3CCJA 4OGCA 2EIFA 3M59A 1BYMA 1B34B 3SB2A 3A8HB 4M78C 3M53A 2A3LA 2DJZA 3CCST 2P0PA 4Y91A 1BI0A 1KHCA 1OZ3A 3TEEA 4F7UB 2L8DA 4E7IA 2ZPFB 3OYHA 2ZPHB 5GAMd 1LJOA 3CBMA 1XTDA 3C4SA 3ME9A 4JDSA 4X34A 4EMGA 3AHUA 2DD5A 1VQPT 3E9GA 1WNLA 2MWPA 2IVWA 3FLGA 2PVDB 2KVQG 2AHJB 3M58A 5AYFA 5FLXE 1YJWA 1KQSA 4II1A 2VXEA 3NFCA 2X35A 1U8RA 2V8JA 4J7IA 1QVGA 3PIOA 3JB9D 3KXTA 1I8FA 5GAMh 2OTJT 3CPFA 3QJ6A 4PLIA 2K57A 3O8VA 5CQYA 5GAN6 1NJIC 3QHSA 1VQ9A 3DB4A 1M1GA 3JB9H 4QQGA 1WJRA 4J8OA 1JB0E 2DXUA 3JCMQ 5HY6A 1WGSA 4C5IA 4JS5A 3Q1JA 1N6AA 3P8DA 4FL6A 2DAQA 2LDMA 3CEYA 5GAMf 1FWZA 4LD9K 4XQ3A 1VQOA 4C92A 4BY6C 5A0DA 1BI2A 2KK4A 2RJCA 4F7UE 2QA4A 3OMCA 1YJ9A 4ATOA 4JRPA 2FB7A 1OYXA 3C94A 2P0KA 4FSXA 3WVEB 4BACA 2K5FA 3ZFJA 2YLCA 3MP8A 4MZTA 5FU7B 4BI4A 1N8RC 3HRTA 4MZMA 4J7FA 4EMKA 4RCBA 3RKXA 4M77A 5KE2A 4A54A 5GAMg 3N5BB 4A4HA 1K9MC 2EQUA 3CCVT 4R56A 4O5VA 1Q7YC 3OYIA 4XAXB 3GPLA 4C8QA 2WSFE 1YCYA 2HD0A 2KY9A 2ZGWA 3NTHA 4M75A 2CGHA 4L59A 5LJ3d 5LJ5d 3RKYA 2LCLA 3QSUA 2XDPA 3S3OA 1JJ2S 1I4K1 4M7DE 2K5IA 3FDRA 2QTXA 3QUIA 4J6XA 5GAN3 2DIQA 3JCMb 1VQMT 2L89A 2OTLA 2JNGA 1G3YA 2BIVA 2RB6A 1UB4A 1M4ZA 4QVZA 2RM4A 3JCMX 3CMEA 4BE1A 5GAN5 4ZTJA 4M7DF 3OYFA 1VUBA 3CCMT 4XU0A 5GAOr 5FRNA 2QQ9A 4OGEA 4MDWA 3RERA 5CIUA 2RHIA 3PNWC 4C92C 2LQKA 3META 4FU6A 5LJ5f 1I81A 3OS5A 5LJ3f 4OB1B 3QO3A 1KD1C 2DZ9A 2GFAA 1VQNT 3L1AA 1RI0A 2DIGA 2GFUA 5GMKe 5GMKj 2PVOB 2E5QA 3L2ZA 3LLRA 4PJOA 4EMKC 4M77C 4QQ6A 4BDZA 2X4YA 3KUFA 4CI0C 3JCMV 1MGQA 5DM7R 5LJ5g 3OYDA 3ZEHA 3TU4K 4OB3B 5GMKl 5LJ3g 5CKBA 1S72T 1K73C 2HAXA 3LX7A 4M75C 4A4GA 2GF7A 4JRKA 1KQ1A 5KCOA 3CCLT 2QQSA 2K2VA 3HRSA 3L2WA 1Q82U 4OB2B 5KCHA 4QQDA 3S3MA 1N9SA 2QEXT 2QDYB 1N8RU 3R6OA 2D0QB 4BD3A 2R57A 4BDYA 2PU9B 1WQWA 3HSBA 5J3BA 3VYHB 4HA8A 2MI6A 3KBGA 4M77F 3CCEA 3OW2A 1YJNA 4X9DA 3CCQT 3V7SA 2MF2A 3J81E 3CCUA 4OVAA 4LDVA 2EFIA 3CXCA 1FX7A 2VGMA 3QXEB 4XTWA 3CC2T 4V2SA 5CKDA 3VUBA 2LRQA 4C8QF 3JCMJ 3G71A 3QZ9B 1G3WA 3CC4A 2RD1A 1M90U 3G4SA 2QXFA 3LYIA 2IG0A 5IAYA 3T9NA 2G3RA 4F7UA 2YLBA 2LNVA 5CAIA 5KH6A 2E64A 4M78D 1O75A 1Y7XA 5CVIA 1Y07A 4J6YA 2RHUA 5FU6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRT A;  3HRS A;  2QQ9 A;  1G3S A;  2QQB A;  1U8R A;  3HRU A;  2GCX A;  1QVP A;  2QQA A;  3E19 A;  4O5V A;  1P92 A;  1BI3 A;  1BI1 A;  1QW1 A;  2K4Y A;  1BYM A;  1G3T A;  1FX7 A;  1BI0 A;  1FWZ A;  2K5I A;  1BI2 A;  4O6J A;  1G3W A;  2H3J A;  3MHX A;  3GLX A;  1G3Y A;  2K5L A;  2K5F A;  5CVI A;  2LX9 A; 
#chains in the Genus database with same CATH topology
 3OYE A;  1QP2 A;  1KK7 A;  1AD5 A;  1QKX A;  3CCU Q;  1BI1 A;  2QK0 A;  2JS2 A;  3CC4 Q;  2GTJ A;  7AT1 B;  1YP5 A;  2G6F X;  4KBM B;  4PJO F;  4PNO A;  1YN8 A;  1OPL A;  4OP0 A;  1AT1 B;  4M7A F;  2NYS A;  4JJC A;  4XU1 A;  1UEB A;  3CCJ Q;  1YIJ T;  3M4G A;  1SKU B;  4XTY A;  4RTY A;  2DL5 A;  2DO3 A;  3WXM B;  1Q82 R;  2O2O A;  3C0C A;  5IN1 A;  3OYL A;  2CDT A;  4FW1 A;  3V7C A;  2DEQ A;  1VQ9 Q;  2DLP A;  2EGC A;  3P8B B;  2PVG B;  3J7A F;  3CBP A;  4M7D C;  2QQA A;  1YWP A;  2DF6 A;  1AZE A;  4HKE A;  1UGQ B;  4F14 A;  2QA4 Q;  1NZ9 A;  3QWX X;  1MMN A;  2YHT A;  5FU7 C;  9ATC B;  3I55 A;  1H3Z A;  2AZV A;  2DTH A;  3V8J A;  1M3B A;  1OX8 A;  2A28 A;  4FIB A;  4M78 G;  5GAO l;  1MHN A;  3H0F A;  2YRC A;  3D7S B;  3QDR B;  3VRY A;  1LVK A;  1QVP A;  1BU1 A;  2PUK B;  1QCO A;  1UGR B;  4N4G A;  3NTI A;  4D6W A;  1H64 1;  3G6E A;  3CPW S;  5IHI A;  4M4Z A;  1Z9Z A;  2OTL Q;  1K73 R;  1YIT Q;  1GBR A;  2L3Q A;  2K2M A;  1VQ6 Q;  1MMA A;  1X6G A;  3PFS A;  5FWB A;  5FRO A;  2RJF A;  2F69 A;  4QVD A;  3CD6 A;  3SWN A;  4JLI A;  1PSE A;  2XID A;  4AFZ C;  5GMK m;  2FZG B;  4AG2 C;  2C06 A;  2I0N A;  1Y57 A;  2JTF A;  4PFP A;  2LTO A;  2W0Z A;  2DL7 A;  4LNP A;  2EYY A;  2D8J A;  4LUE A;  3SD4 A;  2RI3 A;  2I2L A;  2DIL A;  2MYS A;  4BE2 A;  5L23 A;  4M7D G;  1D3B B;  1B34 A;  2DD4 A;  1VQ8 Q;  1NBE B;  3QYH B;  3VS1 A;  3OYG A;  4OF1 A;  4YTL A;  4BB7 A;  5GAN f;  4JRI A;  4E7H A;  2HDA A;  1Q86 R;  3EFS A;  3UT1 A;  1YJN Q;  3BE3 A;  3OYM A;  5C6S A;  1NPP A;  2XI9 A;  1CKB A;  3OSV A;  3PIP A;  2CRE A;  4BUG A;  5GAN g;  2LVM A;  2HKN A;  4DQ2 A;  3NPF A;  3EG9 B;  2LQ8 A;  1WJS A;  1O9S A;  3PGG A;  3CPW P;  1K8A U;  4UC4 A;  5ECA A;  3LWI A;  5KYW B;  3REA B;  4QVC A;  2EAY A;  1JU5 C;  2L2P A;  1M1K R;  4QKU A;  2CT3 A;  1RAC B;  3EH2 A;  2FPE A;  2M1H A;  2PZ1 A;  3TCJ A;  3E9F A;  2YSQ A;  1SF9 A;  4M75 G;  4AFU C;  2XKO C;  2ZPB B;  2QQR A;  4Q5W A;  2AKL A;  4J6W A;  1I0C A;  3M54 A;  3EFR A;  2H3J A;  3OS0 A;  2KR3 A;  2B8A A;  2K5L A;  4M78 E;  5I22 A;  4HCZ A;  1K9M R;  2ZPI B;  3HPW A;  1SSH A;  2DRM A;  2NUT A;  3OMG A;  2IPO B;  3CCR T;  1Q7Y R;  2DNU A;  2AIR B;  1Q81 R;  2MAM A;  2EJF A;  1X2Q A;  1V1C A;  3BDU A;  1UGS B;  4JJN K;  2QTV A;  1XOV A;  3VYG A;  2RHY A;  3I35 A;  4A53 A;  1WI7 A;  1WIE A;  4PJJ A;  3I56 T;  5CCA A;  2DZC A;  5CO7 A;  4DBQ A;  3HTR A;  3UDC A;  1SRL A;  1VQL T;  4GLK A;  2DA9 A;  1AWO A;  1M1F A;  1OUL A;  1G2B A;  1X75 C;  2JW4 A;  5IHN A;  2V8I A;  2F5T X;  1VQ5 T;  4LDX A;  1MNE A;  4LDW A;  1D1C A;  1HXD A;  4L6V 5;  3JCM d;  2JT4 A;  1DJ7 B;  1LOJ A;  3OS1 A;  4C0G A;  2KEA A;  3A8M B;  2X4W A;  2M9U A;  4RCC A;  3JCM h;  2A36 A;  2XD0 A;  4KH1 B;  1G5V A;  4ELZ C;  4WF2 A;  2FEI A;  1PM3 A;  1ZSZ B;  4C92 E;  2P4R A;  2RMO A;  2RK1 A;  3MPU B;  5GAN h;  2X3X D;  3CPW A;  2K3B A;  2E10 A;  2EYQ A;  4CC3 A;  3TSZ A;  1WHJ A;  2E3I A;  2MMP A;  2O4X A;  1SEM A;  1YHQ A;  3JB9 J;  3CC2 Q;  2DL8 A;  1YFN A;  3DLL A;  4M75 E;  4Z8A A;  5LJ5 j;  1UHF A;  3CBO A;  1M2O A;  3F70 A;  3HL8 A;  2EKH A;  2AK5 A;  4OB0 B;  1SSF A;  2DTI A;  3EGD A;  2FZK B;  2O01 E;  1VIF A;  3SWN B;  4MML A;  1YI2 A;  1KSW A;  2JTM A;  2YT6 A;  4IUT A;  3MHX A;  1C1A A;  1IRX A;  2JVV A;  2M0O A;  4CC4 B;  4KUL A;  2XU8 A;  2CP2 A;  1UGV A;  3DKM A;  5CK9 A;  4AMC A;  1M5Q 1;  2EBP A;  4XK8 E;  3OS2 A;  4C0Z A;  2Y4Y A;  3CC7 A;  1M8M A;  3CCJ A;  1B34 B;  1QMC A;  2DJZ A;  4RTV A;  4Y91 A;  4F7U B;  2J6F A;  4AT1 B;  3EG3 A;  2MCN A;  2HL5 C;  3OYH A;  1YIJ Q;  4X34 A;  2DD5 A;  2F2X A;  3M0R A;  1WNL A;  3E9G A;  3FLG A;  1VQP T;  2H3E B;  2CSQ A;  2AHJ B;  1YJW A;  1W6X A;  2ABL A;  2SRC A;  1U8R A;  1KJW A;  3KXT A;  3QJ6 A;  1VQ9 A;  3QHS A;  5KYX A;  4RTZ A;  4DBF A;  2HZY A;  5HY6 A;  4JS5 A;  1UFF A;  1N6A A;  2DAQ A;  2DMO A;  5GAM f;  1KIK A;  2QA4 A;  1YJ9 A;  4ATO A;  3MKD A;  2FB7 A;  2P0K A;  3CCV Q;  4BAC A;  2DVJ A;  4MZT A;  5FU7 B;  4E7S A;  3HRT A;  1ARK A;  4EMK A;  4RCB A;  3RKX A;  4M77 A;  5GAM g;  4R56 A;  2CP5 A;  1VQM Q;  2H8H A;  5LJ5 d;  2CGH A;  4L59 A;  3A98 A;  4FYW B;  1FMW A;  1UJY A;  2QTX A;  3RBB B;  2OTL A;  2JNG A;  2RB6 A;  1WX6 A;  3UA6 A;  2RM4 A;  2V1R A;  3SEM A;  4M7D F;  3REB B;  1NYF A;  4XU0 A;  5GAO r;  4CC7 A;  4OGE A;  2RHI A;  3MET A;  3H9N A;  2D0N A;  1GBQ A;  4OB1 B;  3QO3 A;  1VQN T;  3L1A A;  4FYV B;  2PVO B;  3NGP A;  2JJ9 A;  4PJO A;  4E2F B;  4DBH A;  1MUZ A;  2RNA A;  4A4G A;  3JV3 A;  3L2W A;  1Q82 U;  4PJN A;  2GQI A;  3S3M A;  2QEX T;  8ATC B;  3R6O A;  4J9B A;  4F16 A;  2LX7 A;  1SHF A;  4BD3 A;  4BDY A;  3HSB A;  3VYH B;  3VS4 A;  2MI6 A;  5KYY A;  1YJN A;  3LH5 A;  3CCQ T;  2FRW A;  2QYZ A;  2EFI A;  1FX7 A;  4XTW A;  4FW2 A;  2E5K A;  5CKD A;  3VUB A;  2LRQ A;  2RF0 A;  3G1J A;  3VS6 A;  2D8H A;  5IAY A;  5GJW B;  2LNV A;  2CP0 A;  2E64 A;  1O75 A;  2SEM A;  5CVI A;  2QGF B;  2RHU A;  5FU6 C;  3GNF B;  4FT2 A;  3OB9 A;  1OX9 A;  4E6R A;  3QWY A;  2O9S A;  3CMA T;  2RPN A;  3LGL A;  1ZA1 B;  5A2Q E;  2HL3 A;  4M7A E;  3BY7 A;  1GRI A;  2YUN A;  4KGX B;  3UF4 A;  2RQW A;  1RAF B;  1PHT A;  2R58 A;  3QZ5 B;  3M9Q A;  1AHJ B;  2KQW A;  3NMZ C;  5CKF A;  1QWE A;  3M56 A;  5GAN e;  5FW9 A;  2K7A A;  1VQK T;  2HEQ A;  4OMM A;  4DOV A;  1QW1 A;  3E2U A;  3M0P A;  4A63 B;  1ABQ A;  4ZGJ B;  2KRS A;  2YWW A;  3CCR Q;  1QVF S;  1N9R A;  1N8R R;  3A1P A;  4HCC A;  4C5G A;  1U1T A;  1ZA2 B;  1SPK A;  1ZBJ A;  2CP7 A;  2KYB A;  3GF5 A;  2FPD A;  4OMN A;  5GJV B;  1GL5 A;  1R8O B;  2M0Y A;  1UDL A;  3I56 Q;  3ZBD A;  1JXO A;  4ELY C;  2YRV A;  4X9C A;  5IXF A;  1M90 R;  2CKK A;  1VQL Q;  1KQ2 A;  2F5K A;  1KC8 U;  5KYU B;  5IHK A;  4DA4 A;  1K0S A;  1OPK A;  3QBY A;  1IZ6 A;  2E6N A;  2ECZ A;  3DB3 A;  1VQ5 Q;  1UJ0 A;  2OJ2 A;  1FYN A;  3V8K A;  4FCY A;  4M77 D;  2MPX C;  2DXB A;  3RMS A;  5KYX B;  2YDL A;  1D0Z A;  1M2V A;  3UA7 A;  1H8K A;  4J5Y A;  1M27 C;  1VQ7 A;  1M1K U;  2O9V A;  2MK5 A;  1VYT A;  4O6J A;  4R0K A;  1QCN A;  4JRQ A;  2KT1 A;  4F04 B;  4D8K A;  2KDS A;  3AT1 B;  2BUD A;  1OOT A;  2C0T A;  3S6W A;  5D6Y A;  2JM9 A;  4IUV A;  2KRM A;  3FJP A;  3ULR B;  1BKB A;  5GAO n;  1K9M U;  1W4S A;  4PJO D;  1Q7Y U;  2E41 A;  1YNZ A;  3RUX A;  3BDL A;  1Q81 U;  2V8K A;  4ZGE B;  2XIC A;  1RI9 A;  1ZUK A;  3JCM c;  2E65 A;  1G3S A;  3M0U A;  2COW A;  3VS0 A;  4PJO B;  3GNG A;  3X20 B;  2VB6 A;  2ATC B;  2DYB A;  3SWN C;  4ZNX A;  5DLO A;  1VYV A;  2VKN A;  1PSF A;  3CCS A;  1KD1 U;  3CCE T;  4EMH A;  2LCS A;  1XQH A;  2XDD A;  3G71 T;  1QVG S;  3G4S T;  1MV0 B;  2BZ8 A;  4OMO A;  1NJI R;  5KYY B;  4J9G A;  2R5M A;  4PJM A;  5D6X A;  3A5Z B;  5CKH A;  2CSI A;  2ESW A;  2FO0 A;  2L0A A;  2WAC A;  5HKC A;  1LNX A;  3FB9 A;  3CCV A;  1ZUU A;  1VQ4 Q;  4DEY A;  2EPD A;  4RG2 A;  1D1A A;  1K4U S;  1X01 A;  3VJP A;  2KNB B;  3ER0 A;  2BZX A;  1EIF A;  2OI3 A;  1ZHI A;  1BBZ A;  4PL6 A;  1VQM A;  1WHK A;  2EJG A;  1RL2 A;  1Q82 C;  2LT4 A;  1IHW A;  2L3P A;  4QT7 A;  1QVF A;  4RTX A;  2XG8 D;  4Z89 A;  5D6W A;  4JZ4 A;  1X43 A;  3L2U A;  3UPU A;  2A37 A;  2K3X A;  2FVU A;  3RMQ A;  2ENM A;  2JOY A;  4C8Q D;  1QVG P;  3X25 B;  1S72 A;  5GAM e;  4JJD A;  2KMT A;  2E12 A;  3CCL A;  4F7U G;  2ZZD A;  3I55 T;  3PT9 A;  3IQL A;  1VQN Q;  4Y28 E;  3OYJ A;  2BKD N;  2CYZ B;  2FPF A;  4C8Q B;  2DL3 A;  3JCM f;  1BI3 A;  2KT8 A;  2PUO B;  3DLM A;  3GP8 A;  5GAN 7;  3G6E T;  1X27 A;  1PD1 A;  2CUB A;  3JCM g;  1UTI A;  1BIA A;  1D0X A;  2X4X A;  1OZ2 A;  1M3A A;  4XU2 A;  1M2V B;  3CD6 T;  4M78 A;  3CCQ Q;  4JUV A;  4C5H A;  5GAO q;  4E7Z A;  2EKO A;  2ED0 A;  2M51 A;  4J9I A;  5IH2 A;  5FU6 B;  5LJ3 j;  2P0Q A;  2RQV A;  2E3H A;  3QKJ A;  3EG0 A;  3EHR A;  1YCS B;  2KRO A;  3HFN A;  3CMA Q;  2LJ0 A;  4EIK A;  4AG1 C;  4FM4 B;  1NEB A;  3OYC A;  3HRU A;  4N4I A;  1G8X A;  2EGA A;  1KC8 C;  4N4H A;  3VRZ A;  2EIF A;  3M59 A;  2DER A;  3SB2 A;  3M53 A;  1W70 A;  2KGT A;  1RAA B;  2AT1 B;  1KHC A;  3TEE A;  2P84 A;  2L8D A;  2ZPH B;  1AWJ A;  1VQK Q;  1XTD A;  3C4S A;  2DRK A;  3AHU A;  2OTJ Q;  5AYF A;  5FLX E;  2PVD B;  2VXE A;  2X35 A;  1QVG A;  1JQQ A;  3PIO A;  3JB9 D;  1I8F A;  1RLQ C;  5GAN 6;  3EHQ A;  3DB4 A;  2A08 A;  1WJR A;  4J8O A;  2DXU A;  1BCO A;  3JCM Q;  4FL6 A;  3Q1J A;  4WCI A;  4LD9 K;  4C92 A;  4F7U E;  3OMC A;  2K5F A;  2YLC A;  1OEB A;  4MZM A;  2AKK A;  1K9M C;  1QQJ A;  1ABO A;  1Q7Y C;  1YCY A;  2HD0 A;  3U23 A;  2DL4 A;  4M75 A;  5LJ3 d;  4IIM A;  3TQ7 P;  3QSU A;  3S3O A;  1JJ2 S;  4M7D E;  1BCM A;  1ZUY A;  2K5I A;  3FDR A;  3CCM Q;  3QUI A;  4J6X A;  5GAN 3;  3JCM b;  4OMP A;  2L89 A;  1IHV A;  2KXD A;  1G3Y A;  1WHG A;  2ROT A;  1M4Z A;  3CME A;  4BE1 A;  5FRN A;  1VUB A;  3PNW C;  5LJ5 f;  1I81 A;  1RLP C;  4ORZ A;  1KD1 C;  4AFS C;  5GMK j;  1TUG B;  1XJW B;  4EMK C;  1U5S A;  4M77 C;  2EW3 A;  1GCQ A;  1I1J A;  4CI0 C;  1MGQ A;  5LJ5 g;  3OYD A;  1I5O B;  4AFQ C;  2HAX A;  2XMF A;  1J3T A;  3LX7 A;  4Z88 A;  1KQ1 A;  3EGX A;  2K2V A;  3HRS A;  4OB2 B;  1WDX A;  2QDY B;  1N8R U;  2R57 A;  2PU9 B;  5J3B A;  4HA8 A;  1WA7 A;  1TG0 A;  4X9D A;  3V7S A;  2MF2 A;  3CCU A;  4LDV A;  5FWC A;  4GLM A;  3CC4 A;  4FYY B;  2EYZ A;  1M90 U;  4Y92 A;  3T9N A;  2VWF A;  2DM1 A;  2FZC B;  4M78 D;  2MIO A;  3C94 A;  1RAE B;  5I21 A;  3PTA A;  4PJO C;  4A4F A;  1D09 B;  1PCX A;  1JJ2 P;  2QQB A;  1RAG B;  1R0C B;  5EC7 A;  3ZL7 C;  1YHQ T;  2HQE A;  2E70 A;  2Y90 A;  3G71 Q;  5IT9 E;  3G4S Q;  3RIR A;  2DTO A;  4PKC C;  4M78 B;  3WVD B;  1YI2 T;  2HBW A;  2COY A;  3OYN A;  1ACM B;  2LT1 A;  1VQ4 A;  2YXY A;  2L3R A;  1HJD A;  2J06 A;  4ZTF A;  3CCJ T;  3CC7 T;  4LXC A;  3SHW A;  3VS3 A;  2KXC A;  1T0J A;  1Z9Q A;  5CQX A;  2MWO A;  2DKG A;  4PJL A;  3MP1 A;  1MND A;  2CZ7 B;  2QG9 B;  1WXU A;  1N27 A;  1YJW T;  1TXQ A;  3V7R A;  1M3C A;  4F7U F;  1RAI B;  1P92 A;  2RI2 A;  1VQ9 T;  1SG5 A;  1Y71 A;  4WTO B;  1I5L A;  1S1N A;  4C92 D;  2D9T A;  2EWN A;  3MJX A;  1JRI A;  2RHX A;  1YJ9 T;  2NUT B;  1NLP C;  5LJ5 h;  4B9W A;  1YIT A;  1VQ6 A;  2EJ9 A;  4RG8 A;  2L3S A;  2EQK A;  1CSK A;  5GAN 2;  1JO8 A;  2J05 A;  4J9E A;  4C5E A;  1K76 A;  4M75 D;  2KSS A;  4C92 B;  2DX1 A;  1NJI U;  3I55 Q;  4VUB A;  3TSW A;  2VAS A;  3M0S A;  4A4E A;  1W2B S;  3L2V A;  4CRI A;  1Y0M A;  4M7A A;  4XTV A;  1K8A C;  1JJ2 A;  2EQM A;  4C8Q C;  4A4K A;  2DPP B;  1Y96 A;  3BW1 A;  1VQ8 A;  2Y4X A;  4E47 A;  3G6E Q;  4M75 B;  1BIB A;  1U1S A;  1HD3 A;  4TVR A;  1PG5 B;  2CH4 W;  4LUD A;  5DY9 A;  2F2V A;  4IIO A;  1QP3 A;  3VKI A;  3CD6 Q;  1IRE B;  2JZ2 A;  4OMF B;  2BZY A;  3OA6 A;  3I9Q A;  1D0Y A;  4LDY A;  3EAE A;  3CMA A;  1YWO A;  2K9G A;  1IGU A;  2HQH A;  1AVZ C;  2RQR A;  5GAO p;  4RUG A;  3H6Z A;  3JCM e;  3M0Q A;  4XTU A;  5HCK A;  2FHD A;  2VV5 A;  3M57 A;  1KQS S;  1IO6 A;  3EGX B;  1BK2 A;  3PMT A;  2FYK A;  2O4X B;  2XDB A;  3MEW A;  4EPC A;  4HT8 A;  4BE0 A;  1K73 U;  3OBW A;  2OTJ A;  2J6O A;  1W2B P;  3A8G B;  1WJQ A;  4E7K A;  2VGN A;  1TTH B;  3EGD B;  3MEU A;  2RH2 A;  4X1V A;  4C8Q G;  3RES A;  2HKQ B;  2WSE E;  2ZCF B;  4FSS A;  5A0G A;  1WFW A;  3H8Z A;  1WPY A;  5GAN 8;  4NS5 A;  3JB9 I;  2X3W D;  3GIB A;  2FRY A;  3JCM W;  2OX7 A;  2WSC E;  3O5Z A;  4ZGD B;  1JXM A;  3FJ5 A;  3FC3 A;  2VC8 A;  5IXB A;  1B3Q A;  3TRE A;  1ZLM A;  2O31 A;  1EFN A;  2A7Y A;  4KUI A;  1Q86 U;  4PFO A;  3M0T A;  4RKU E;  2DBK A;  2JMC A;  3FRN A;  1VQO T;  1NG2 A;  2X4J A;  3CCM A;  1VIE A;  2D6F A;  5J39 A;  1KQS P;  5M9O A;  2R5A A;  2E6Z A;  1E7O A;  2NLU A;  3QII A;  2B86 A;  2JUF A;  4L5G A;  4J9H A;  3HHT B;  2NUP A;  1SHG A;  1TUD A;  1M90 C;  1F1B B;  3OSS C;  1K9A A;  2RI5 A;  2GTO A;  1OU8 A;  1IB8 A;  2CP6 A;  2QI2 A;  5I2S A;  4XU3 A;  3GLX A;  4EMK B;  1D3B A;  4M77 B;  2CZ0 B;  2DE0 X;  3OQ5 A;  2OAW A;  3MO8 A;  1QVF P;  3CXC S;  4R55 A;  3EGU A;  1HK9 A;  1A0N B;  1FMK A;  3GBQ A;  3C12 A;  5GAN 4;  3CC2 A;  1ZBX A;  3I5S A;  3OYB A;  3QYG B;  1EZZ B;  3E1S A;  1T3S A;  1G3T A;  2X9H A;  4N0A A;  1D1B A;  2HQX A;  1UG1 A;  1VQ7 T;  1Q95 G;  4M7A D;  1WQ7 A;  1IGQ A;  4NOY A;  2K6D A;  4JLG A;  4E7J A;  1W2B A;  2CT4 A;  3MEV A;  4HVW A;  1VOM A;  1TOV A;  2LCC A;  1UGP B;  5A0L A;  3JB9 G;  4C8Q E;  3QG1 A;  5LJ5 e;  1OU9 A;  2EGE A;  2LP5 A;  4B6M A;  2W10 A;  4M7A B;  3HP9 A;  3LGF A;  2KYM A;  1PRL C;  2LJ3 A;  3C95 A;  2EQJ A;  3OYA A;  1Y96 B;  2RQT A;  1G83 A;  1YHQ Q;  3FEO A;  2KE9 A;  1YIJ A;  2GQV A;  5CR2 A;  1YI2 Q;  1OQK A;  1BYM A;  2LZ6 B;  3A8H B;  4M78 C;  1VQP Q;  1QKW A;  3CCS T;  2P0P A;  1OZ3 A;  2ZPF B;  3UAT A;  3CXC P;  3CBM A;  3ME9 A;  4JDS A;  3M58 A;  1TSF A;  2MWP A;  2KVQ G;  1KQS A;  4II1 A;  3VS7 A;  3NFC A;  4J7I A;  3CC7 Q;  2KI7 A;  3CPF A;  5CQY A;  1NJI C;  2K57 A;  1M1G A;  3JB9 H;  4QQG A;  4C5I A;  2LDM A;  1FWZ A;  2E4H A;  4K11 A;  5A0D A;  1YJW Q;  4FSX A;  1B07 A;  4BI4 A;  4A54 A;  1X2K A;  3CCV T;  1IXD A;  2ZGW A;  1YJ9 Q;  2A0F B;  2LCL A;  1I4K 1;  1VQM T;  1ZSZ A;  2DIQ A;  1OV3 A;  1WXB A;  2BIV A;  1UB4 A;  3JCM X;  4ZTJ A;  5GAN 5;  4J9D A;  2QQ9 A;  1WHL A;  5CIU A;  4C92 C;  1HSQ A;  2LQK A;  4FU6 A;  3OS5 A;  5LJ3 f;  1QLY A;  2HCK A;  1T0H A;  2YUP A;  2GFA A;  1RI0 A;  1N5Z A;  2GFU A;  1LPL A;  2X4Y A;  3KUF A;  4KGZ B;  3JCM V;  2EVR A;  2QEX Q;  3PE0 A;  5LJ3 g;  1K73 C;  1S72 T;  4M75 C;  5KYN A;  5KCO A;  3CCL T;  2QQS A;  2LQW A;  3H0H A;  2C0O A;  4LE9 A;  2NUP B;  1TWB A;  1C6V X;  4JPB W;  2YRD A;  1AEY A;  3EG2 A;  4JZ3 A;  3J81 E;  4OVA A;  3CXC A;  2JMA A;  4C8Q F;  3JCM J;  1PNJ A;  3QZ9 B;  1WZO A;  1GFC A;  2IG0 A;  4F7U A;  4D8D A;  1Y7X A;  4J6Y A;  3GPL A;  2RO0 A;  3FIF A;  1KC8 R;  1GCQ C;  3VV0 A;  3PMI A;  3PVL A;  4C0D B;  5KE3 A;  4NL3 A;  1WYX A;  1Q86 C;  2K4Y A;  4IUR A;  3RNJ A;  5I2M A;  3L2Q A;  4ZN3 A;  2ED1 A;  4C92 G;  1TH7 A;  1H3H A;  3LW5 E;  2LC4 A;  2DK3 A;  3L2R A;  1TU0 B;  4M7D A;  1WHH A;  1MMG A;  3J80 E;  1UEC A;  3CCR A;  1VYU A;  3V8L A;  1RAB B;  1OI1 A;  1PKS A;  3MEA A;  2RHZ A;  5GAN j;  4IUQ A;  3E19 A;  1M1K C;  2EQI A;  3I56 A;  4Z02 A;  1V76 A;  1VQL A;  2M02 A;  4PFZ A;  3H41 A;  1H92 A;  2CP3 A;  4BY6 B;  3BFM A;  5LL6 S;  4RMO A;  1PKT A;  2V26 A;  4GY5 A;  1M9S A;  1WHM A;  5CKE A;  4RTW A;  1VQ5 A;  3TVT A;  4XTZ A;  2E1H A;  3L42 A;  1VQO Q;  2F2W A;  4FT4 A;  1Q81 C;  4HXJ A;  3VUZ A;  2RQU A;  3M55 A;  4NL2 A;  1ZQ1 A;  4HT9 A;  1FMV A;  3URG A;  1E6G A;  3HKS A;  4IUP A;  1M8V A;  5LJ3 h;  1R77 A;  3NHN A;  2RK2 A;  1KD1 R;  5GAO m;  4HCK A;  4OMQ A;  4ME7 A;  2EYX A;  1YBY A;  2NUZ A;  3JB9 F;  5EG2 A;  4CC2 A;  2QDL A;  3QPH A;  4HVU A;  2CZ6 B;  8AT1 B;  2C0I A;  3OYY A;  1WLP B;  3OBY A;  4IUU A;  2KBT A;  3OYK A;  1RAD B;  2QGG A;  3CME T;  3A8L B;  2LNH B;  2XK0 A;  2JTE A;  1UE9 A;  1VQ7 Q;  5GAN d;  2JXB A;  2DEU A;  5D7U A;  3X26 B;  2VUB A;  1TS9 A;  2PQW A;  3GOX A;  2JS0 A;  3M4Y A;  4XTX A;  3EFO A;  1ZSG A;  3JRZ A;  4E7L A;  3S3N A;  3P8H A;  1UHC A;  5J26 A;  3CCE Q;  2VXF A;  4LDU A;  2HNI A;  1JBM A;  1X6B A;  4M7A C;  2L5Q A;  3RKW A;  2XHC A;  1MMD A;  2K3Y A;  2LMJ A;  4EDU A;  4KUD K;  3CCU T;  1VQP A;  1BB9 A;  4KGV B;  3CC4 T;  4HVV A;  1XNI A;  1GXI E;  2COZ A;  3THK A;  4M77 G;  4DOW A;  2M16 A;  1E6H A;  1NM7 A;  3CCS Q;  4HCB A;  2BE7 D;  3RDV A;  5C0M A;  1FXX A;  3R6N A;  3A8O B;  4P5N A;  4IKF A;  4C0F A;  4M7D D;  4JJB A;  5KYU A;  3HFO A;  3VS5 A;  1QWF A;  2RJE A;  3MP6 A;  1HYO A;  3MCA B;  2VYT A;  5GMK h;  4MDX A;  5HK3 A;  4M78 F;  4QW2 A;  3EG1 A;  3EH1 A;  1GFD A;  2MOX A;  3G7Z A;  1VQ4 T;  4M7D B;  4PJO G;  4MMK A;  3UWN A;  3KFV A;  2DXT A;  5FRM A;  2DVE A;  2DXC A;  3VS2 A;  3LWH A;  2PTK A;  1KG1 A;  4J83 A;  4M7A G;  1MV3 A;  4B9X A;  5AT1 B;  3NTK A;  2OAU A;  4ZN1 A;  2QA4 T;  1PWT A;  3X24 B;  2PNI A;  2FL7 A;  3JCM P;  1KHI A;  1VA7 A;  3JSC A;  3SDZ A;  1VQN A;  2KAF A;  3X28 B;  2YUQ A;  4DEX A;  1NEG A;  3ASK A;  2JN0 A;  1K8A R;  1U3O A;  6AT1 B;  5GAM j;  2V1Q A;  5GMK i;  2HBP A;  1X69 A;  3RR6 A;  1PD0 A;  4BI3 A;  2QEX A;  1AOJ A;  2OTL T;  2LQN A;  4JS4 A;  1YIT T;  4KRT A;  3OW2 S;  1VQ6 T;  1GCP A;  1ZX6 A;  2EYW A;  2QAS A;  1B7T A;  2ZPE B;  4LD6 A;  3CCQ A;  2J6K A;  2CH4 A;  1S72 Q;  3CCL Q;  3M5A A;  4F17 A;  2HMA A;  2ZPG B;  2F1L A;  2RJD A;  2HSP A;  2NWM A;  2IIM A;  3VU3 C;  1AWW A;  1KFZ A;  4C92 F;  2QAZ A;  4M77 E;  1V29 B;  2RN8 A;  3LH0 A;  1VQ8 T;  1NPR A;  1RAH B;  2CZ1 B;  4OML A;  5LJ3 e;  2YUO A;  5HK0 A;  3QJY A;  5I11 A;  4DBR A;  2GGR A;  2ZAE A;  2ROL A;  2LJ1 A;  4PLL A;  5DLQ E;  1YJN T;  2VVK A;  4M75 F;  3OY9 A;  3INZ A;  5L8R E;  1NLO C;  2CS7 A;  1NE8 A;  1I07 A;  2LX9 A;  4N0A C;  4C0D C;  3SFM A;  2Z0W A;  1VQK A;  2GCX A;  4MZP A;  4KH0 B;  4KT0 E;  2RA2 A;  2O88 A;  4LN2 A;  1LCK A;  4RTU A;  3JAM E;  1X6O A;  4PJO E;  2P4T A;  4OGC A;  4ANJ A;  2A3L A;  2BTT A;  3EFO B;  2GBQ A;  1BI0 A;  1RUW A;  3OW2 P;  2FG0 A;  4E7I A;  5GAM d;  1LJO A;  3H0I A;  4EMG A;  2IVW A;  1R0B G;  2V8J A;  1T3L A;  5GAM h;  2OTJ T;  4PLI A;  3O8V A;  1EX4 A;  2JM8 A;  1JB0 E;  1WGS A;  2AZS A;  3P8D A;  2HSE B;  3CEY A;  2CUD A;  4XQ3 A;  1VQO A;  4BY6 C;  1BI2 A;  2KK4 A;  2RJC A;  4JRP A;  1M30 A;  1AWX A;  2D1X A;  1OYX A;  3WVE B;  3ZFJ A;  3MP8 A;  1N8R C;  4J7F A;  5KE2 A;  2DYI A;  3N5B B;  4A4H A;  2EQU A;  4J9F A;  4O5V A;  1W1F A;  3OYI A;  4XAX B;  4C8Q A;  2WSF E;  3NTH A;  2KY9 A;  3QDF A;  1K1Z A;  3RKY A;  1PRM C;  2DJQ A;  2XDP A;  2X51 A;  1K0X A;  1U06 A;  4RTT A;  4ESR A;  4QVZ A;  1PC0 A;  2BE9 B;  3OYF A;  3CCM T;  4MDW A;  3PVQ A;  3RER A;  2KRN A;  4PK4 A;  1NYG A;  4GBQ A;  2DFU A;  2DZ9 A;  2DIG A;  5GMK e;  2E5Q A;  3L2Z A;  3LLR A;  4QQ6 A;  4BDZ A;  3CME Q;  5DM7 R;  3ZEH A;  3TU4 K;  4OB3 B;  5GMK l;  5CKB A;  1QCF A;  2GF7 A;  4J9C A;  4JRK A;  3EG9 A;  5KCH A;  4QQD A;  1N9S A;  1UUE A;  2GNC A;  1ZSZ C;  2D0Q B;  1TUC A;  1SRM A;  5KYW A;  1JEG A;  1WQW A;  3CCE A;  3KBG A;  4M77 F;  3OW2 A;  4FYX B;  1CKA A;  3I5R A;  4V2S A;  2VGM A;  3QXE B;  3CC2 T;  2DBM A;  1AZG B;  3G71 A;  1G3W A;  2RD1 A;  1C0M A;  3G4S A;  2QXF A;  3LYI A;  2G3R A;  2K79 A;  2YLB A;  3CQT A;  2J7I A;  5CAI A;  5KH6 A;  2DET A;  4BI8 B;  1Y07 A;  1WXT A; 
#chains in the Genus database with same CATH homology
 3GNF B;  4A4F A;  2RO0 A;  3OB9 A;  4FT2 A;  1QP2 A;  3OYE A;  3FIF A;  2QQB A;  3VV0 A;  3PMI A;  3CMA T;  1YHQ T;  2HQE A;  4C0D B;  5KE3 A;  1BI1 A;  3LGL A;  4NL3 A;  2E70 A;  2Y90 A;  1Q86 C;  2K4Y A;  4IUR A;  5IT9 E;  3RIR A;  5A2Q E;  5I2M A;  2DTO A;  3L2Q A;  4ZN3 A;  4C92 G;  1TH7 A;  4M7A E;  3LW5 E;  2LC4 A;  2DK3 A;  3BY7 A;  4KBM B;  4PKC C;  3L2R A;  4M7D A;  4M78 B;  3QZ5 B;  3WVD B;  2R58 A;  1YI2 T;  4PJO F;  3J80 E;  4PNO A;  3M9Q A;  3CCR A;  4PJO C;  3V8L A;  4OP0 A;  1AHJ B;  2KQW A;  1OI1 A;  3OYN A;  5CKF A;  4M7A F;  3M56 A;  3MEA A;  2RHZ A;  5GAN j;  5GAN e;  4XU1 A;  1UEB A;  4IUQ A;  2LT1 A;  1VQK T;  3E19 A;  1YIJ T;  3M4G A;  1VQ4 A;  4DOV A;  1QW1 A;  2L3R A;  1M1K C;  4XTY A;  3I56 A;  2DO3 A;  4ZTF A;  4Z02 A;  3CCJ T;  3CC7 T;  3WXM B;  4ZGJ B;  1QVF S;  1VQL A;  1N9R A;  4HCC A;  5CQX A;  4C5G A;  5IN1 A;  3OYL A;  2MWO A;  2DKG A;  1U1T A;  4BY6 B;  3BFM A;  5LL6 S;  3MP1 A;  4RMO A;  2CZ7 B;  3GF5 A;  3V7C A;  2DEQ A;  4GY5 A;  1N27 A;  1M9S A;  1YJW T;  5CKE A;  1R8O B;  2PVG B;  3P8B B;  3V7R A;  4F7U F;  1VQ5 A;  3CBP A;  3J7A F;  4M7D C;  2QQA A;  4XTZ A;  3ZBD A;  2E1H A;  4ELY C;  2YRV A;  1P92 A;  4X9C A;  4HKE A;  3L42 A;  1UGQ B;  2CKK A;  2RI2 A;  1VQ9 T;  1Y71 A;  1I5L A;  4FT4 A;  2F5K A;  1Q81 C;  1NZ9 A;  1KQ2 A;  1KC8 U;  4C92 D;  2YHT A;  5FU7 C;  2D9T A;  4DA4 A;  3VUZ A;  3M55 A;  4NL2 A;  3I55 A;  1ZQ1 A;  2DTH A;  3QBY A;  1H3Z A;  1IZ6 A;  4HT9 A;  3V8J A;  2EWN A;  1JRI A;  2RHX A;  2E6N A;  3URG A;  3DB3 A;  1YJ9 T;  3HKS A;  4IUP A;  5LJ5 h;  4B9W A;  5LJ3 h;  1YIT A;  1M8V A;  1VQ6 A;  3V8K A;  2EJ9 A;  4RG8 A;  4FIB A;  4M78 G;  2EQK A;  4M77 D;  5GAO l;  1MHN A;  2RK2 A;  2DXB A;  3RMS A;  5GAN 2;  3QDR B;  5GAO m;  1QVP A;  2PUK B;  1UGR B;  4ME7 A;  4N4G A;  4C5E A;  4M75 D;  3NTI A;  2KSS A;  4D6W A;  1H64 1;  4C92 B;  3G6E A;  3CPW S;  1YBY A;  1NJI U;  4J5Y A;  1VQ7 A;  5EG2 A;  3JB9 F;  4VUB A;  1M1K U;  3QPH A;  4A4E A;  1W2B S;  2CZ6 B;  3L2V A;  4O6J A;  3PFS A;  4BI8 B;  4CRI A;  5FRO A;  2RJF A;  4JRQ A;  2F69 A;  4M7A A;  4QVD A;  4XTV A;  1K8A C;  1JJ2 A;  3CD6 A;  3OYY A;  3SWN A;  2EQM A;  2KDS A;  3OBY A;  1PSE A;  4JLI A;  4A4K A;  4IUU A;  4C8Q C;  2DPP B;  2BUD A;  2XID A;  5GMK m;  1Y96 A;  3OYK A;  3BW1 A;  1VQ8 A;  3S6W A;  3CME T;  2Y4X A;  4E47 A;  3A8L B;  5D6Y A;  2XK0 A;  4M75 B;  2C06 A;  1BIB A;  1U1S A;  2JTF A;  5GAN d;  2LTO A;  4IUV A;  3FJP A;  1BKB A;  4TVR A;  5GAO n;  1K9M U;  1W4S A;  3X26 B;  4PJO D;  5DY9 A;  2VUB A;  2E41 A;  2PQW A;  1Q7Y U;  3GOX A;  1QP3 A;  3RUX A;  3SD4 A;  3VKI A;  2RI3 A;  2I2L A;  3BDL A;  3M4Y A;  2V8K A;  1IRE B;  4XTX A;  4BE2 A;  1Q81 U;  4M7D G;  1D3B B;  4ZGE B;  1B34 A;  2DD4 A;  2JZ2 A;  4OMF B;  2XIC A;  3OA6 A;  3QYH B;  3JRZ A;  3PTA A;  4LDY A;  4E7L A;  3JCM c;  3OYG A;  3P8H A;  3S3N A;  4OF1 A;  3EAE A;  4YTL A;  4BB7 A;  3CMA A;  5GAN f;  2E65 A;  1G3S A;  5J26 A;  4JRI A;  4E7H A;  3EFS A;  2VXF A;  4LDU A;  3UT1 A;  2HNI A;  1JBM A;  3OYM A;  4M7A C;  4PJO B;  3GNG A;  2L5Q A;  3X20 B;  5C6S A;  5GAO p;  3RKW A;  3H6Z A;  3SWN C;  5DLO A;  3JCM e;  2XHC A;  4XTU A;  1NPP A;  1PSF A;  3CCS A;  2K3Y A;  2XI9 A;  3PIP A;  3OSV A;  1KD1 U;  3CCE T;  4BUG A;  2FHD A;  5GAN g;  2VV5 A;  4EDU A;  3M57 A;  2LVM A;  4EMH A;  1KQS S;  4DQ2 A;  4KUD K;  3CCU T;  2LQ8 A;  1VQP A;  1XQH A;  2XDD A;  3PMT A;  2FYK A;  1WJS A;  3G71 T;  2O4X B;  3CC4 T;  1QVG S;  2XDB A;  1O9S A;  3MEW A;  1XNI A;  3PGG A;  4EPC A;  3G4S T;  4HT8 A;  1GXI E;  1K8A U;  4UC4 A;  4BE0 A;  1K73 U;  3OBW A;  3LWI A;  4QVC A;  2OTJ A;  2EAY A;  4M77 G;  4DOW A;  2M16 A;  2R5M A;  4HCB A;  3A8G B;  3TCJ A;  1WJQ A;  2M1H A;  5D6X A;  2VGN A;  4E7K A;  5C0M A;  3E9F A;  3A5Z B;  3MEU A;  4C8Q G;  2RH2 A;  1FXX A;  4M75 G;  5CKH A;  3RES A;  2XKO C;  2ZPB B;  3A8O B;  4P5N A;  2WSE E;  2ZCF B;  5A0G A;  4IKF A;  2QQR A;  4Q5W A;  3H8Z A;  4J6W A;  4C0F A;  4M7D D;  1WPY A;  3M54 A;  5GAN 8;  3EFR A;  2WAC A;  2H3J A;  4NS5 A;  5HKC A;  3OS0 A;  3JB9 I;  3GIB A;  3JCM W;  3HFO A;  1LNX A;  2B8A A;  2K5L A;  4M78 E;  2WSC E;  3FB9 A;  4HCZ A;  2RJE A;  3MP6 A;  3MCA B;  2ZPI B;  2VYT A;  3HPW A;  5GMK h;  4MDX A;  4ZGD B;  3CCV A;  3CCR T;  3OMG A;  5HK3 A;  4RG2 A;  1X01 A;  3FC3 A;  3VJP A;  4M78 F;  4QW2 A;  2VC8 A;  2MAM A;  3ER0 A;  2EJF A;  1EIF A;  3BDU A;  4JJN K;  1UGS B;  3TRE A;  1XOV A;  1ZHI A;  3VYG A;  2RHY A;  3G7Z A;  1VQ4 T;  2A7Y A;  4M7D B;  4A53 A;  4PJO G;  4PL6 A;  4KUI A;  4MMK A;  1VQM A;  3UWN A;  2DXT A;  1Q86 U;  5FRM A;  3I56 T;  2DVE A;  2DXC A;  3LWH A;  5CCA A;  2DZC A;  4RKU E;  5CO7 A;  1KG1 A;  4J83 A;  3UDC A;  4M7A G;  2EJG A;  1RL2 A;  4B9X A;  3NTK A;  2OAU A;  3FRN A;  4ZN1 A;  1VQO T;  2LT4 A;  2X4J A;  4GLK A;  3CCM A;  2QA4 T;  1Q82 C;  1VQL T;  3X24 B;  1QVF A;  2FL7 A;  2XG8 D;  3JCM P;  1KHI A;  1VIE A;  1M1F A;  2D6F A;  5D6W A;  3JSC A;  1X75 C;  3UPU A;  2V8I A;  5J39 A;  2F5T X;  2K3X A;  3SDZ A;  3L2U A;  1VQN A;  2FVU A;  2KAF A;  3RMQ A;  5M9O A;  1VQ5 T;  2R5A A;  3X28 B;  4LDX A;  2E6Z A;  2JOY A;  2NLU A;  3QII A;  4C8Q D;  2JUF A;  4L5G A;  4LDW A;  3HHT B;  1HXD A;  4L6V 5;  3JCM d;  3X25 B;  3ASK A;  1M90 C;  1DJ7 B;  2JN0 A;  1LOJ A;  3OSS C;  2RI5 A;  1S72 A;  3OS1 A;  4C0G A;  5GAM e;  5GAM j;  5GMK i;  2QI2 A;  3A8M B;  5I2S A;  2KMT A;  2E12 A;  2HBP A;  3GLX A;  4XU3 A;  4F7U G;  3CCL A;  2X4W A;  2ZZD A;  4EMK B;  3I55 T;  1D3B A;  2M9U A;  4M77 B;  4RCC A;  3PT9 A;  3JCM h;  4BI3 A;  5I21 A;  4Y28 E;  2CZ0 B;  2QEX A;  2OTL T;  4JS4 A;  2XD0 A;  3OQ5 A;  1YIT T;  1G5V A;  3OW2 S;  1VQ6 T;  4ELZ C;  3OYJ A;  2BKD N;  2CYZ B;  4C8Q B;  2ZPE B;  3MO8 A;  4LD6 A;  4WF2 A;  4R55 A;  3CXC S;  3JCM f;  3CCQ A;  1BI3 A;  1HK9 A;  2PUO B;  3DLM A;  3C12 A;  5GAN 4;  3GP8 A;  5GAN 7;  1ZBX A;  3CC2 A;  3OYB A;  4C92 E;  3QYG B;  3E1S A;  4N0A A;  1G3T A;  3M5A A;  3G6E T;  2ZPG B;  2HQX A;  2RJD A;  1VQ7 T;  2RK1 A;  5GAN h;  3CPW A;  4M7A D;  1WQ7 A;  2E10 A;  2EYQ A;  4NOY A;  4JLG A;  3JCM g;  3VU3 C;  1BIA A;  4E7J A;  2X4X A;  4C92 F;  1OZ2 A;  1W2B A;  4M77 E;  4XU2 A;  3CD6 T;  2MMP A;  4M78 A;  2O4X A;  1V29 B;  3MEV A;  4JUV A;  4C5H A;  5GAO q;  2EKO A;  1YHQ A;  3JB9 J;  2LCC A;  1UGP B;  3LH0 A;  5A0L A;  3JB9 G;  4C8Q E;  1VQ8 T;  3DLL A;  4M75 E;  1NPR A;  2CZ1 B;  3QG1 A;  5FU6 B;  5LJ5 j;  5LJ5 e;  3CBO A;  5LJ3 j;  3F70 A;  5LJ3 e;  3HL8 A;  2P0Q A;  5HK0 A;  4OB0 B;  3QJY A;  1SSF A;  2DTI A;  3QKJ A;  4M7A B;  2O01 E;  1VIF A;  3HP9 A;  4PLL A;  4MML A;  5DLQ E;  3SWN B;  1YI2 A;  3LGF A;  4M75 F;  2JTM A;  3OY9 A;  1YJN T;  4IUT A;  3C95 A;  3INZ A;  3MHX A;  5L8R E;  3HFN A;  2CS7 A;  2EQJ A;  3OYA A;  1Y96 B;  1NE8 A;  2JVV A;  2M0O A;  4KUL A;  4FM4 B;  3FEO A;  2XU8 A;  2LX9 A;  3DKM A;  4N0A C;  4C0D C;  5CK9 A;  3SFM A;  3OYC A;  1VQK A;  1YIJ A;  2GQV A;  3HRU A;  4N4I A;  2GCX A;  5CR2 A;  4MZP A;  1M5Q 1;  4KT0 E;  4XK8 E;  3OS2 A;  2RA2 A;  3JAM E;  4C0Z A;  2Y4Y A;  1X6O A;  4PJO E;  1KC8 C;  2P4T A;  3CC7 A;  4N4H A;  3CCJ A;  4OGC A;  2EIF A;  3M59 A;  1BYM A;  1B34 B;  3SB2 A;  3A8H B;  4M78 C;  3M53 A;  2A3L A;  2DJZ A;  3CCS T;  2P0P A;  4Y91 A;  1BI0 A;  1KHC A;  1OZ3 A;  3TEE A;  4F7U B;  2L8D A;  4E7I A;  2ZPF B;  3OYH A;  2ZPH B;  5GAM d;  1LJO A;  3CBM A;  1XTD A;  3C4S A;  3ME9 A;  4JDS A;  4X34 A;  4EMG A;  3AHU A;  2DD5 A;  1VQP T;  3E9G A;  1WNL A;  2MWP A;  2IVW A;  3FLG A;  2PVD B;  2KVQ G;  2AHJ B;  3M58 A;  5AYF A;  5FLX E;  1YJW A;  1KQS A;  4II1 A;  2VXE A;  3NFC A;  2X35 A;  1U8R A;  2V8J A;  4J7I A;  1QVG A;  3PIO A;  3JB9 D;  3KXT A;  1I8F A;  5GAM h;  2OTJ T;  3CPF A;  3QJ6 A;  4PLI A;  2K57 A;  3O8V A;  5CQY A;  5GAN 6;  1NJI C;  3QHS A;  1VQ9 A;  3DB4 A;  1M1G A;  3JB9 H;  4QQG A;  1WJR A;  4J8O A;  1JB0 E;  2DXU A;  3JCM Q;  5HY6 A;  1WGS A;  4C5I A;  4JS5 A;  3Q1J A;  1N6A A;  3P8D A;  4FL6 A;  2DAQ A;  2LDM A;  3CEY A;  5GAM f;  1FWZ A;  4LD9 K;  4XQ3 A;  1VQO A;  4C92 A;  4BY6 C;  5A0D A;  1BI2 A;  2KK4 A;  2RJC A;  4F7U E;  2QA4 A;  3OMC A;  1YJ9 A;  4ATO A;  4JRP A;  2FB7 A;  1OYX A;  3C94 A;  2P0K A;  4FSX A;  3WVE B;  4BAC A;  2K5F A;  3ZFJ A;  2YLC A;  3MP8 A;  4MZT A;  5FU7 B;  4BI4 A;  1N8R C;  3HRT A;  4MZM A;  4J7F A;  4EMK A;  4RCB A;  3RKX A;  4M77 A;  5KE2 A;  4A54 A;  5GAM g;  3N5B B;  4A4H A;  1K9M C;  2EQU A;  3CCV T;  4R56 A;  4O5V A;  1Q7Y C;  3OYI A;  4XAX B;  3GPL A;  4C8Q A;  2WSF E;  1YCY A;  2HD0 A;  2KY9 A;  2ZGW A;  3NTH A;  4M75 A;  2CGH A;  4L59 A;  5LJ3 d;  5LJ5 d;  3RKY A;  2LCL A;  3QSU A;  2XDP A;  3S3O A;  1JJ2 S;  1I4K 1;  4M7D E;  2K5I A;  3FDR A;  2QTX A;  3QUI A;  4J6X A;  5GAN 3;  2DIQ A;  3JCM b;  1VQM T;  2L89 A;  2OTL A;  2JNG A;  1G3Y A;  2BIV A;  2RB6 A;  1UB4 A;  1M4Z A;  4QVZ A;  2RM4 A;  3JCM X;  3CME A;  4BE1 A;  5GAN 5;  4ZTJ A;  4M7D F;  3OYF A;  1VUB A;  3CCM T;  4XU0 A;  5GAO r;  5FRN A;  2QQ9 A;  4OGE A;  4MDW A;  3RER A;  5CIU A;  2RHI A;  3PNW C;  4C92 C;  2LQK A;  3MET A;  4FU6 A;  5LJ5 f;  1I81 A;  3OS5 A;  5LJ3 f;  4OB1 B;  3QO3 A;  1KD1 C;  2DZ9 A;  2GFA A;  1VQN T;  3L1A A;  1RI0 A;  2DIG A;  2GFU A;  5GMK e;  5GMK j;  2PVO B;  2E5Q A;  3L2Z A;  3LLR A;  4PJO A;  4EMK C;  4M77 C;  4QQ6 A;  4BDZ A;  2X4Y A;  3KUF A;  4CI0 C;  3JCM V;  1MGQ A;  5DM7 R;  5LJ5 g;  3OYD A;  3ZEH A;  3TU4 K;  4OB3 B;  5GMK l;  5LJ3 g;  5CKB A;  1S72 T;  1K73 C;  2HAX A;  3LX7 A;  4M75 C;  4A4G A;  2GF7 A;  4JRK A;  1KQ1 A;  5KCO A;  3CCL T;  2QQS A;  2K2V A;  3HRS A;  3L2W A;  1Q82 U;  4OB2 B;  5KCH A;  4QQD A;  3S3M A;  1N9S A;  2QEX T;  2QDY B;  1N8R U;  3R6O A;  2D0Q B;  4BD3 A;  2R57 A;  4BDY A;  2PU9 B;  1WQW A;  3HSB A;  5J3B A;  3VYH B;  4HA8 A;  2MI6 A;  3KBG A;  4M77 F;  3CCE A;  3OW2 A;  1YJN A;  4X9D A;  3CCQ T;  3V7S A;  2MF2 A;  3J81 E;  3CCU A;  4OVA A;  4LDV A;  2EFI A;  3CXC A;  1FX7 A;  2VGM A;  3QXE B;  4XTW A;  3CC2 T;  4V2S A;  5CKD A;  3VUB A;  2LRQ A;  4C8Q F;  3JCM J;  3G71 A;  3QZ9 B;  1G3W A;  3CC4 A;  2RD1 A;  1M90 U;  3G4S A;  2QXF A;  3LYI A;  2IG0 A;  5IAY A;  3T9N A;  2G3R A;  4F7U A;  2YLB A;  2LNV A;  5CAI A;  5KH6 A;  2E64 A;  4M78 D;  1O75 A;  1Y7X A;  5CVI A;  1Y07 A;  4J6Y A;  2RHU A;  5FU6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...