1C5AA

Three-dimensional structure of porcine c5ades*arg from 1h nuclear magnetic resonance data
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
65
structure length
65
Chain Sequence
b'MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C5A ANAPHYLATOXIN
publication title Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.
pubmed doi rcsb
source organism Sus scrofa domestica
molecule tags Complement factor
total genus 27
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1990-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01821 ANATO Anaphylotoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.91.20 Mainly Alpha Up-down Bundle Influenza Virus Matrix Protein; Chain A, domain 1 Anaphylotoxins (complement system) 1c5aA00
3HQBA 4I6OA 4HW5A 3KLSA 2A73B 4P3AA 4P3BA 4UU9C 4HWJA 3CU7A 4WB2A 5B4PB 1CFAA 4P39A 1C5AA 2B39A 1KJSA 5JPNB 4FXKB 3HQAA 4WB3A
chains in the Genus database with same CATH superfamily
4IQ4A 3HQBA 4I6OA 4HW5A 3KLSA 2A73B 4D9JA 4P3AA 4PUSA 4P3BA 3VDXA 1AA7A 4UU9C 4HWJA 1EA3A 4FXGB 5JPMB 3CU7A 4WB2A 5B4PB 1CFAA 4P39A 1C5AA 2B39A 1KJSA 2Z16A 3MD2A 5JPNB 5CQEA 4FXKB 3HQAA 4ITVA 4WB3A
chains in the Genus database with same CATH topology
3HQBA 4I6OA 4HW5A 3KLSA 2A73B 4P3AA 4P3BA 4UU9C 4HWJA 3CU7A 4WB2A 5B4PB 1CFAA 4P39A 1C5AA 2B39A 1KJSA 5JPNB 4FXKB 3HQAA 4WB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQB A;  4I6O A;  4HW5 A;  3KLS A;  2A73 B;  4P3A A;  4P3B A;  4UU9 C;  4HWJ A;  3CU7 A;  4WB2 A;  5B4P B;  1CFA A;  4P39 A;  1C5A A;  2B39 A;  1KJS A;  5JPN B;  4FXK B;  3HQA A;  4WB3 A; 
#chains in the Genus database with same CATH topology
 4IQ4 A;  3HQB A;  4I6O A;  4HW5 A;  3KLS A;  2A73 B;  4D9J A;  4P3A A;  4PUS A;  4P3B A;  3VDX A;  1AA7 A;  4UU9 C;  4HWJ A;  1EA3 A;  4FXG B;  5JPM B;  3CU7 A;  4WB2 A;  5B4P B;  1CFA A;  4P39 A;  1C5A A;  2B39 A;  1KJS A;  2Z16 A;  3MD2 A;  5JPN B;  5CQE A;  4FXK B;  3HQA A;  4ITV A;  4WB3 A; 
#chains in the Genus database with same CATH homology
 3HQB A;  4I6O A;  4HW5 A;  3KLS A;  2A73 B;  4P3A A;  4P3B A;  4UU9 C;  4HWJ A;  3CU7 A;  4WB2 A;  5B4P B;  1CFA A;  4P39 A;  1C5A A;  2B39 A;  1KJS A;  5JPN B;  4FXK B;  3HQA A;  4WB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...