1CCQA

Nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two forms of cytotoxin II (cardiotoxin) from Naja naja oxiana in aqueous solution: spatial structures with tightly bound water molecules.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PROTEIN (CYTOTOXIN 2)
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1999-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ccqA00
1BXPA 1CB9A 1KBTA 2ERAA 1CDQA 1CDTA 1LSIA 2NBTA 2HLRA 2JVEA 1LX5B 1NYSA 1DRSA 4AEAA 1KU6B 1CREA 2PJYC 2FD6U 2MFAA 1NORA 1KS6A 2MHYA 3HH7A 1CDRA 2JQPA 3KFDI 4OM5A 1UG4A 1KC4A 2J8BA 2X8BB 1IJCA 2H5FA 4QTIU 1QKEA 1ERGA 1KTZB 1TXBA 4FAOC 3NEQA 1B41B 4ZQYA 1CXNA 3NH7A 2LCRA 4RUDA 2CDXA 3KFDE 2OFSA 1HAAA 3QB4B 5IMTD 2L5SA 3BT1U 4UY2C 4EY8B 2GOOC 5DU1A 1CODA 1IKCA 1CHVS 1V6PA 2CRSA 1RL5A 3EVSC 2MJYA 1KL8A 1FSSB 2H64C 2N99A 1F94A 3U73U 1LXHA 1IDGA 1TGXA 2CCXA 2L03A 2QJBC 3NDSA 3U74U 1TXAA 1MR6A 1COEA 1XT3A 1BTEA 1IK8A 1I02A 2UX2A 1L4WA 2HLQA 1VB0A 1RGJA 2H8UA 2CTXA 2ABXA 2MJ0A 6EBXA 2H7ZA 2I9BE 1NEAA 1H0JA 3EBXA 1NTXA 4BDTB 1ABTA 4P7UA 1NXBA 2CRTA 2H7ZB 1KBAA 1KXIA 5EBXA 1JGKA 2MUPA 2MJ4A 2MUOA 1REWC 1TFSA 1NTNA 1FF4A 1MAHF 2PJYB 1CVOA 2H62C 1CXOA 1G6MA 1ES7B 4FAOE 1HC9B 1M9ZA 1NYUA 1S4YA 1W6BA 1HC9A 1IDHA 4LFTA 1CRFA 4DO8A 2BHIA 2GOOB 1ERAA 1F8UB 1QM7A 1YWHA 2H62D 4OM4A 5DO6A 1CDSA 3ERAA 2VLWA 1FFJA 1ZADA 1KBSA 3BT2U 3LAQU 1IQ9A 2QJ9C 1IDLA 5DZ5A 2H64B 1CCQA 1LXGA 4XJJA 1IDIA 4IYEA 4HQPF 1JBDA 1LJZA 1CTXA 2K3GA 4BIKB 1FRAA 3VTSA 1KFHA 1JE9A 1PLOA 1QKDA 1ONJA 1HOYA 1HAJA 2QC1A 1FSCA 2QJAC 3PLCA 2BTXA 5IMYC 1FASA 2UWRA 3FEVA 2LA1A
chains in the Genus database with same CATH superfamily
1BXPA 1CB9A 1KBTA 2ERAA 1CDQA 1CDTA 1LSIA 2NBTA 2HLRA 2JVEA 1LX5B 1NYSA 1DRSA 4AEAA 1KU6B 1CREA 2PJYC 2FD6U 2MFAA 1NORA 1KS6A 2MHYA 3HH7A 1CDRA 2JQPA 3KFDI 4OM5A 1UG4A 1KC4A 2J8BA 2X8BB 1IJCA 2H5FA 4QTIU 1QKEA 1ERGA 1KTZB 1TXBA 4FAOC 3NEQA 1B41B 4ZQYA 1CXNA 3NH7A 2LCRA 4RUDA 2CDXA 3KFDE 2OFSA 1HAAA 3QB4B 5IMTD 2L5SA 3BT1U 4UY2C 4EY8B 2GOOC 5DU1A 1CODA 1IKCA 1CHVS 1V6PA 2CRSA 1RL5A 3EVSC 2MJYA 1KL8A 1FSSB 2H64C 2N99A 1F94A 3U73U 1LXHA 1IDGA 1TGXA 2CCXA 2L03A 2QJBC 3NDSA 3U74U 1TXAA 1MR6A 1COEA 1XT3A 1BTEA 1IK8A 1I02A 2UX2A 1L4WA 2HLQA 1VB0A 1RGJA 2H8UA 2CTXA 2ABXA 2MJ0A 6EBXA 2H7ZA 2I9BE 1NEAA 1H0JA 3EBXA 1NTXA 4BDTB 1ABTA 4P7UA 1NXBA 2CRTA 2H7ZB 1KBAA 1KXIA 5EBXA 1JGKA 2MUPA 2MJ4A 2MUOA 1REWC 1TFSA 1NTNA 1FF4A 1MAHF 2PJYB 1CVOA 2H62C 1CXOA 1G6MA 1ES7B 4FAOE 1HC9B 1M9ZA 4KSNA 1NYUA 1S4YA 1W6BA 1HC9A 1IDHA 4LFTA 1CRFA 4DO8A 2BHIA 2GOOB 1ERAA 1F8UB 1QM7A 1YWHA 2H62D 4OM4A 5DO6A 1CDSA 3ERAA 2VLWA 1FFJA 1ZADA 1KBSA 3BT2U 3LAQU 1IQ9A 2QJ9C 1IDLA 5DZ5A 2H64B 1CCQA 1LXGA 4XJJA 1IDIA 4IYEA 4HQPF 1JBDA 1LJZA 1CTXA 2K3GA 4BIKB 1FRAA 3VTSA 1KFHA 1JE9A 1PLOA 1QKDA 1ONJA 1HOYA 1HAJA 2QC1A 1FSCA 2QJAC 3PLCA 2BTXA 5IMYC 1FASA 2UWRA 3FEVA 2LA1A
chains in the Genus database with same CATH topology
1BXPA 1CB9A 1KBTA 2ERAA 1CDQA 1CDTA 1LSIA 2NBTA 2HLRA 2JVEA 1LX5B 1NYSA 1DRSA 4AEAA 1KU6B 1CREA 2PJYC 2FD6U 2MFAA 1NORA 1KS6A 2MHYA 3HH7A 1CDRA 2JQPA 3KFDI 4OM5A 1UG4A 1KC4A 2J8BA 2X8BB 1IJCA 2H5FA 4QTIU 1QKEA 1ERGA 1KTZB 1TXBA 4FAOC 3NEQA 1B41B 4ZQYA 1CXNA 3NH7A 2LCRA 4RUDA 2CDXA 3KFDE 2OFSA 1HAAA 3QB4B 5IMTD 2L5SA 3BT1U 4UY2C 4EY8B 2GOOC 5DU1A 1CODA 1IKCA 1CHVS 1V6PA 2CRSA 1RL5A 3EVSC 2MJYA 1KL8A 1FSSB 2H64C 2N99A 1F94A 3U73U 1LXHA 1IDGA 1TGXA 2CCXA 2L03A 2QJBC 3NDSA 3U74U 1TXAA 1MR6A 1COEA 1XT3A 1BTEA 1IK8A 1I02A 2UX2A 1L4WA 2HLQA 1VB0A 1RGJA 2H8UA 2CTXA 2ABXA 2MJ0A 6EBXA 2H7ZA 2I9BE 1NEAA 1H0JA 3EBXA 1NTXA 4BDTB 1ABTA 4P7UA 1NXBA 2CRTA 2H7ZB 1KBAA 1KXIA 5EBXA 1JGKA 2MUPA 2MJ4A 2MUOA 1REWC 1TFSA 1NTNA 1FF4A 1MAHF 2PJYB 1CVOA 2H62C 1CXOA 1G6MA 1ES7B 4FAOE 1HC9B 1M9ZA 4KSNA 1NYUA 1S4YA 1W6BA 1HC9A 1IDHA 4LFTA 1CRFA 4DO8A 2BHIA 2GOOB 1ERAA 1F8UB 1QM7A 1YWHA 2H62D 4OM4A 5DO6A 1CDSA 3ERAA 2VLWA 1FFJA 1ZADA 1KBSA 3BT2U 3LAQU 1IQ9A 2QJ9C 1IDLA 5DZ5A 2H64B 1CCQA 1LXGA 4XJJA 1IDIA 4IYEA 4HQPF 1JBDA 1LJZA 1CTXA 2K3GA 4BIKB 1FRAA 3VTSA 1KFHA 1JE9A 1PLOA 1QKDA 1ONJA 1HOYA 1HAJA 2QC1A 1FSCA 2QJAC 3PLCA 2BTXA 5IMYC 1FASA 2UWRA 3FEVA 2LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXP A;  1CB9 A;  1KBT A;  2ERA A;  1CDQ A;  1CDT A;  1LSI A;  2NBT A;  2HLR A;  2JVE A;  1LX5 B;  1NYS A;  1DRS A;  4AEA A;  1KU6 B;  1CRE A;  2PJY C;  2FD6 U;  2MFA A;  1NOR A;  1KS6 A;  2MHY A;  3HH7 A;  1CDR A;  2JQP A;  3KFD I;  4OM5 A;  1UG4 A;  1KC4 A;  2J8B A;  2X8B B;  1IJC A;  2H5F A;  4QTI U;  1QKE A;  1ERG A;  1KTZ B;  1TXB A;  4FAO C;  3NEQ A;  1B41 B;  4ZQY A;  1CXN A;  3NH7 A;  2LCR A;  4RUD A;  2CDX A;  3KFD E;  2OFS A;  1HAA A;  3QB4 B;  5IMT D;  2L5S A;  3BT1 U;  4UY2 C;  4EY8 B;  2GOO C;  5DU1 A;  1COD A;  1IKC A;  1CHV S;  1V6P A;  2CRS A;  1RL5 A;  3EVS C;  2MJY A;  1KL8 A;  1FSS B;  2H64 C;  2N99 A;  1F94 A;  3U73 U;  1LXH A;  1IDG A;  1TGX A;  2CCX A;  2L03 A;  2QJB C;  3NDS A;  3U74 U;  1TXA A;  1MR6 A;  1COE A;  1XT3 A;  1BTE A;  1IK8 A;  1I02 A;  2UX2 A;  1L4W A;  2HLQ A;  1VB0 A;  1RGJ A;  2H8U A;  2CTX A;  2ABX A;  2MJ0 A;  6EBX A;  2H7Z A;  2I9B E;  1NEA A;  1H0J A;  3EBX A;  1NTX A;  4BDT B;  1ABT A;  4P7U A;  1NXB A;  2CRT A;  2H7Z B;  1KBA A;  1KXI A;  5EBX A;  1JGK A;  2MUP A;  2MJ4 A;  2MUO A;  1REW C;  1TFS A;  1NTN A;  1FF4 A;  1MAH F;  2PJY B;  1CVO A;  2H62 C;  1CXO A;  1G6M A;  1ES7 B;  4FAO E;  1HC9 B;  1M9Z A;  1NYU A;  1S4Y A;  1W6B A;  1HC9 A;  1IDH A;  4LFT A;  1CRF A;  4DO8 A;  2BHI A;  2GOO B;  1ERA A;  1F8U B;  1QM7 A;  1YWH A;  2H62 D;  4OM4 A;  5DO6 A;  1CDS A;  3ERA A;  2VLW A;  1FFJ A;  1ZAD A;  1KBS A;  3BT2 U;  3LAQ U;  1IQ9 A;  2QJ9 C;  1IDL A;  5DZ5 A;  2H64 B;  1CCQ A;  1LXG A;  4XJJ A;  1IDI A;  4IYE A;  4HQP F;  1JBD A;  1LJZ A;  1CTX A;  2K3G A;  4BIK B;  1FRA A;  3VTS A;  1KFH A;  1JE9 A;  1PLO A;  1QKD A;  1ONJ A;  1HOY A;  1HAJ A;  2QC1 A;  1FSC A;  2QJA C;  3PLC A;  2BTX A;  5IMY C;  1FAS A;  2UWR A;  3FEV A;  2LA1 A; 
#chains in the Genus database with same CATH topology
 1BXP A;  1CB9 A;  1KBT A;  2ERA A;  1CDQ A;  1CDT A;  1LSI A;  2NBT A;  2HLR A;  2JVE A;  1LX5 B;  1NYS A;  1DRS A;  4AEA A;  1KU6 B;  1CRE A;  2PJY C;  2FD6 U;  2MFA A;  1NOR A;  1KS6 A;  2MHY A;  3HH7 A;  1CDR A;  2JQP A;  3KFD I;  4OM5 A;  1UG4 A;  1KC4 A;  2J8B A;  2X8B B;  1IJC A;  2H5F A;  4QTI U;  1QKE A;  1ERG A;  1KTZ B;  1TXB A;  4FAO C;  3NEQ A;  1B41 B;  4ZQY A;  1CXN A;  3NH7 A;  2LCR A;  4RUD A;  2CDX A;  3KFD E;  2OFS A;  1HAA A;  3QB4 B;  5IMT D;  2L5S A;  3BT1 U;  4UY2 C;  4EY8 B;  2GOO C;  5DU1 A;  1COD A;  1IKC A;  1CHV S;  1V6P A;  2CRS A;  1RL5 A;  3EVS C;  2MJY A;  1KL8 A;  1FSS B;  2H64 C;  2N99 A;  1F94 A;  3U73 U;  1LXH A;  1IDG A;  1TGX A;  2CCX A;  2L03 A;  2QJB C;  3NDS A;  3U74 U;  1TXA A;  1MR6 A;  1COE A;  1XT3 A;  1BTE A;  1IK8 A;  1I02 A;  2UX2 A;  1L4W A;  2HLQ A;  1VB0 A;  1RGJ A;  2H8U A;  2CTX A;  2ABX A;  2MJ0 A;  6EBX A;  2H7Z A;  2I9B E;  1NEA A;  1H0J A;  3EBX A;  1NTX A;  4BDT B;  1ABT A;  4P7U A;  1NXB A;  2CRT A;  2H7Z B;  1KBA A;  1KXI A;  5EBX A;  1JGK A;  2MUP A;  2MJ4 A;  2MUO A;  1REW C;  1TFS A;  1NTN A;  1FF4 A;  1MAH F;  2PJY B;  1CVO A;  2H62 C;  1CXO A;  1G6M A;  1ES7 B;  4FAO E;  1HC9 B;  1M9Z A;  4KSN A;  1NYU A;  1S4Y A;  1W6B A;  1HC9 A;  1IDH A;  4LFT A;  1CRF A;  4DO8 A;  2BHI A;  2GOO B;  1ERA A;  1F8U B;  1QM7 A;  1YWH A;  2H62 D;  4OM4 A;  5DO6 A;  1CDS A;  3ERA A;  2VLW A;  1FFJ A;  1ZAD A;  1KBS A;  3BT2 U;  3LAQ U;  1IQ9 A;  2QJ9 C;  1IDL A;  5DZ5 A;  2H64 B;  1CCQ A;  1LXG A;  4XJJ A;  1IDI A;  4IYE A;  4HQP F;  1JBD A;  1LJZ A;  1CTX A;  2K3G A;  4BIK B;  1FRA A;  3VTS A;  1KFH A;  1JE9 A;  1PLO A;  1QKD A;  1ONJ A;  1HOY A;  1HAJ A;  2QC1 A;  1FSC A;  2QJA C;  3PLC A;  2BTX A;  5IMY C;  1FAS A;  2UWR A;  3FEV A;  2LA1 A; 
#chains in the Genus database with same CATH homology
 1BXP A;  1CB9 A;  1KBT A;  2ERA A;  1CDQ A;  1CDT A;  1LSI A;  2NBT A;  2HLR A;  2JVE A;  1LX5 B;  1NYS A;  1DRS A;  4AEA A;  1KU6 B;  1CRE A;  2PJY C;  2FD6 U;  2MFA A;  1NOR A;  1KS6 A;  2MHY A;  3HH7 A;  1CDR A;  2JQP A;  3KFD I;  4OM5 A;  1UG4 A;  1KC4 A;  2J8B A;  2X8B B;  1IJC A;  2H5F A;  4QTI U;  1QKE A;  1ERG A;  1KTZ B;  1TXB A;  4FAO C;  3NEQ A;  1B41 B;  4ZQY A;  1CXN A;  3NH7 A;  2LCR A;  4RUD A;  2CDX A;  3KFD E;  2OFS A;  1HAA A;  3QB4 B;  5IMT D;  2L5S A;  3BT1 U;  4UY2 C;  4EY8 B;  2GOO C;  5DU1 A;  1COD A;  1IKC A;  1CHV S;  1V6P A;  2CRS A;  1RL5 A;  3EVS C;  2MJY A;  1KL8 A;  1FSS B;  2H64 C;  2N99 A;  1F94 A;  3U73 U;  1LXH A;  1IDG A;  1TGX A;  2CCX A;  2L03 A;  2QJB C;  3NDS A;  3U74 U;  1TXA A;  1MR6 A;  1COE A;  1XT3 A;  1BTE A;  1IK8 A;  1I02 A;  2UX2 A;  1L4W A;  2HLQ A;  1VB0 A;  1RGJ A;  2H8U A;  2CTX A;  2ABX A;  2MJ0 A;  6EBX A;  2H7Z A;  2I9B E;  1NEA A;  1H0J A;  3EBX A;  1NTX A;  4BDT B;  1ABT A;  4P7U A;  1NXB A;  2CRT A;  2H7Z B;  1KBA A;  1KXI A;  5EBX A;  1JGK A;  2MUP A;  2MJ4 A;  2MUO A;  1REW C;  1TFS A;  1NTN A;  1FF4 A;  1MAH F;  2PJY B;  1CVO A;  2H62 C;  1CXO A;  1G6M A;  1ES7 B;  4FAO E;  1HC9 B;  1M9Z A;  4KSN A;  1NYU A;  1S4Y A;  1W6B A;  1HC9 A;  1IDH A;  4LFT A;  1CRF A;  4DO8 A;  2BHI A;  2GOO B;  1ERA A;  1F8U B;  1QM7 A;  1YWH A;  2H62 D;  4OM4 A;  5DO6 A;  1CDS A;  3ERA A;  2VLW A;  1FFJ A;  1ZAD A;  1KBS A;  3BT2 U;  3LAQ U;  1IQ9 A;  2QJ9 C;  1IDL A;  5DZ5 A;  2H64 B;  1CCQ A;  1LXG A;  4XJJ A;  1IDI A;  4IYE A;  4HQP F;  1JBD A;  1LJZ A;  1CTX A;  2K3G A;  4BIK B;  1FRA A;  3VTS A;  1KFH A;  1JE9 A;  1PLO A;  1QKD A;  1ONJ A;  1HOY A;  1HAJ A;  2QC1 A;  1FSC A;  2QJA C;  3PLC A;  2BTX A;  5IMY C;  1FAS A;  2UWR A;  3FEV A;  2LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...