1CFEA

P14a, nmr, 20 structures
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
b'QNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGAGENLAKGGGDFTGRAAVQLWVSERPSYNYATNQCVGGKKCRHYTQVVWRNSVRLGCGRARCNNGWWFISCNYDPVGNWIGQRPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PATHOGENESIS-RELATED PROTEIN P14A
publication title NMR solution structure of the pathogenesis-related protein P14a.
pubmed doi rcsb
source organism Solanum lycopersicum
molecule tags Pathogenesis-related protein
total genus 35
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00188 CAP Cysteine-rich secretory protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.33.10 Alpha Beta 3-Layer(aba) Sandwich Pathogenesis-related Protein p14a CAP 1cfeA00
3Q2UA 3MZ8A 3Q2RA 2DDAA 3NT8A 4G2UA 5ETEA 2GIZA 4AIWA 1SMBA 3S6UA 1XTAA 3U3LC 4IFAA 4NUNA 5JYSA 3S6SA 2VZNA 4H0AA 1WVRA 4P27A 4D53A 3U3UC 1RC9A 1U53A 1XX5A 4NUIA 4LY5A 2EPFA 4NUKA 4TPVA 3S6VA 2DDBA 3U3NC 1QNXA 4NUOA 1CFEA
chains in the Genus database with same CATH superfamily
3Q2UA 3MZ8A 3Q2RA 2DDAA 3NT8A 4G2UA 5ETEA 2GIZA 4AIWA 1SMBA 3S6UA 1XTAA 3U3LC 4IFAA 4NUNA 5JYSA 3S6SA 2VZNA 4H0AA 1WVRA 4P27A 4D53A 3U3UC 1RC9A 1U53A 1XX5A 4NUIA 4LY5A 2EPFA 4NUKA 4TPVA 3S6VA 2DDBA 3U3NC 1QNXA 4NUOA 1CFEA
chains in the Genus database with same CATH topology
3Q2UA 3MZ8A 3Q2RA 2DDAA 3NT8A 4G2UA 5ETEA 2GIZA 4AIWA 1SMBA 3S6UA 1XTAA 3U3LC 4IFAA 4NUNA 5JYSA 3S6SA 2VZNA 4H0AA 1WVRA 4P27A 4D53A 3U3UC 1RC9A 1U53A 1XX5A 4NUIA 4LY5A 2EPFA 4NUKA 4TPVA 3S6VA 2DDBA 3U3NC 1QNXA 4NUOA 1CFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2U A;  3MZ8 A;  3Q2R A;  2DDA A;  3NT8 A;  4G2U A;  5ETE A;  2GIZ A;  4AIW A;  1SMB A;  3S6U A;  1XTA A;  3U3L C;  4IFA A;  4NUN A;  5JYS A;  3S6S A;  2VZN A;  4H0A A;  1WVR A;  4P27 A;  4D53 A;  3U3U C;  1RC9 A;  1U53 A;  1XX5 A;  4NUI A;  4LY5 A;  2EPF A;  4NUK A;  4TPV A;  3S6V A;  2DDB A;  3U3N C;  1QNX A;  4NUO A;  1CFE A; 
#chains in the Genus database with same CATH topology
 3Q2U A;  3MZ8 A;  3Q2R A;  2DDA A;  3NT8 A;  4G2U A;  5ETE A;  2GIZ A;  4AIW A;  1SMB A;  3S6U A;  1XTA A;  3U3L C;  4IFA A;  4NUN A;  5JYS A;  3S6S A;  2VZN A;  4H0A A;  1WVR A;  4P27 A;  4D53 A;  3U3U C;  1RC9 A;  1U53 A;  1XX5 A;  4NUI A;  4LY5 A;  2EPF A;  4NUK A;  4TPV A;  3S6V A;  2DDB A;  3U3N C;  1QNX A;  4NUO A;  1CFE A; 
#chains in the Genus database with same CATH homology
 3Q2U A;  3MZ8 A;  3Q2R A;  2DDA A;  3NT8 A;  4G2U A;  5ETE A;  2GIZ A;  4AIW A;  1SMB A;  3S6U A;  1XTA A;  3U3L C;  4IFA A;  4NUN A;  5JYS A;  3S6S A;  2VZN A;  4H0A A;  1WVR A;  4P27 A;  4D53 A;  3U3U C;  1RC9 A;  1U53 A;  1XX5 A;  4NUI A;  4LY5 A;  2EPF A;  4NUK A;  4TPV A;  3S6V A;  2DDB A;  3U3N C;  1QNX A;  4NUO A;  1CFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...