1CN7A

Yeast ribosomal protein l30
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
b'APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L30E
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 44
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1cn7A00
2QEXF 3CC4F 1YI2F 4C4WC 5FLXM 3V7QA 1CK2A 3NMUC 1M1KH 1RA4A 2KG4A 3GYQA 3NK6A 1ZWZA 3NVKE 2OTLF 1YIJF 1K9MH 3J81M 1H7MA 1YJ9F 3PAFA 3CCMF 2QI2A 3LWOC 3E1YA 3G6EF 3V7EA 2HVYD 4X3MA 1YHQF 2ALEA 1GZ0A 1VQPF 1X52A 3CCEF 1SDSA 1T0KB 4TZZA 2FC3A 3LWVC 2OZBA 5DCVA 3CC2F 5GAPK 3CCRF 3CCSF 1JJ2F 1YJWF 1K73H 3N4ZA 1YITF 3O85A 3CCVF 3HJWC 2QA4F 1VQMF 5A2QM 3CC7F 2KTVA 3CCLF 5FJ4C 1GO0A 1KQSF 3G71F 3CG6A 4NUTA 3OBWA 3VMFB 2KTUA 5GIPC 1KD1H 1K8AH 3IR9A 1X7PA 3CMEF 2BO1A 1VQ7F 1W41A 2AIFA 1VQNF 1VQOF 3SIVA 4LCKA 2JNBA 2VGNA 3LWRC 2LBWA 3NK7A 2WALA 3ON1A 5EWRA 3LWQC 3CXCF 3HAXD 2VGMA 1VQKF 1Q82H 1VQ4F 1IPAA 3I56F 1QVFF 3CCJF 1GO1A 2CZWA 1VQ6F 1PXWA 1X7OA 1DT9A 1NJIH 1W2BF 1N8RH 1W3EX 1YJNF 3CCUF 3FFMA 1XBIA 3N4YA 3WXMB 5GANK 3LWPC 1VQ5F 1NMUB 3JCMM 3OW2F 3J7AR 1E7KA 1Q7YH 3CPQA 3OBYA 4BW0B 3I55F 3CPWF 3CCQF 1CN7A 5G4UC 3RA6A 1Q81H 1S72F 1W42A 2OHWA 1M90H 3VI6A 2I6DA 1VQ9F 3PLAC 5GIOC 3RA5A 5IT9M 3NVIB 3E20B 3G4SF 1Q86H 1VQLF 3LFOA 3MCAB 3J80M 3CMAF 1RLGA 3CD6F 2OTJF 5EO3A 1QVGF 1VQ8F 4BY9D 1KC8H 5GINC 3JAMM 3SIUA 4X3LA 1W40A 5G4VC 2LBXA 3AGKA
chains in the Genus database with same CATH superfamily
2LCAA 3VCZA 3CC4F 5HY2A 1YI2F 1TVKB 4ZOLB 5JCOA 4YJ2B 1CK2A 3V3TA 5ITZB 4G4XA 5EIBC 3QUWA 3GYQA 3MDOA 3NK6A 2PHNA 4C82A 1ZWZA 5IJ9A 2OTLF 3VOAA 1H7MA 3PAFA 4IHJA 3KE1A 5HY0A 3DC2A 2P6YA 5J2UA 1OFUA 5GONB 1COMA 4DXDA 1VQPF 1X52A 3RYIB 3VIUA 1T0KB 2FC3A 2VAMA 1JJ2F 1K73H 1YITF 1Z5VA 5JH7A 3V4DA 5LOVB 3EORA 4ZHYB 4ZK7A 3JAKA 3CCLF 1UI9A 2GVIA 1GO0A 1IV4A 3CB2A 1KQSF 3VMFB 3JAWA 2RHLA 2UYNA 3IEWA 1K8AH 4BVQA 3CMEF 2V9YA 1W41A 4WBNB 5MN6A 1PF5A 4ZHQA 5JVDA 1RQ2A 3LWRC 2N48A 2WALA 2Z1EA 5KMGA 5LYJA 2BTUA 1TUBB 3BYQA 4ZI7A 3JARB 2HP3A 3OONA 2ZODA 4BT2A 3CXCF 2W8BC 4TV9A 2OTMA 1VQ4F 4I55A 4ERHA 1GO1A 1VQ6F 1PXWA 4LNUB 3D01A 3RYHB 2AMTA 1X7OA 3JATB 2ZOVA 1DT9A 1N8RH 5JCOC 3LWPC 5GANK 3OW2F 5EB0A 4EI8A 1E7KA 4O4IA 2RHJA 3K14A 1W59A 2EWCA 1JD1A 4X1IA 4BVSA 5IJ0A 5MN4A 5G4UC 1S72F 4G4WA 1VQ9F 4DRXA 3C9TA 3LMEA 5IJ9B 5GIOC 5LXTA 4B62A 5IT9M 5C8YA 3NVIB 3IMPA 3E20B 1VQLF 2PMPA 3LFOA 3J80M 3CMAF 2OTJF 3JALA 4IHJB 2ZAUA 4B5CA 5J2UB 1RLUA 3QHDA 3D00A 4BVRA 2HP0A 4BT6A 3JASA 1JFFA 2VAWA 3P4EA 5G4VC 4G88A 3AGKA 3ESJA 3S0HA 4C4WC 2AIZP 5CB4A 3WGNA 3HKDA 2RHHA 3JAWB 5KX5A 3FD5A 2KG4A 2ZF8A 4ZHQB 5JVDB 1K9MH 4C8IA 3LDTA 5JQGA 3CCMF 3WGKA 3LWOC 3QTYA 5KMGB 5LP6B 4ZI7B 1R1MA 1YHQF 2ALEA 2F9ZC 5HY1A 4I4TA 1NQ3A 4TV9B 1QD9A 3U0OA 3WGMA 3CCEF 2KGWA 2BTOA 3N2KA 3RYFA 4I55B 3WJPA 3WPWA 5GAPK 5EB1B 3IKFA 5EZYA 4G4YA 3RYCA 1ONIA 4C8GA 3HJWC 2QA4F 1XV2A 5A2QM 1J7HA 1Q8RA 3G71F 1W5FA 3CG6A 2KTUA 2GZLA 4I50B 1FSZA 5HWEA 1VQ7F 1VQOF 5EIBD 3S0YA 4DRXB 2R751 2ZVZA 3TD3A 4FFBA 2Q1YA 1JY8A 5CA0A 4O4LA 3LWQC 4PWTA 2DYYA 1IPAA 4F6RA 2IQQA 2G9IA 4YJ3A 1UFYA 3JASB 1W55A 2HX0A 1JN1A 1W2BF 2HS0A 1RQ7A 1XBIA 3JVHA 4XCQA 3CPQA 2CW4A 3OBYA 3CCQF 1CN7A 5HXUA 3HKDB 3IEQA 5KX5B 3C9SA 1U40A 2H6LA 2B33A 2UZHA 4IIJA 3TD4A 2HS4A 5MN5A 5JQGB 3HWUA 1CLIA 4O4HA 3WJRA 4O2BA 3S06A 4I4TB 4RQOA 3VTIC 3LYBA 4BY9D 5GINC 3C8LA 1YGYA 4BT7A 3N2KB 5BMVA 4X3LA 3RYFB 1VQVA 1GX1A 4M8IA 1VH8A 3HKCA 5EZYB 3RYCB 3I7TA 4C81A 2QEXF 3R0PA 3MBMA 3V7QA 5LOVA 1VK3A 4BT3A 3NMUC 3F0GA 2L26A 4G4VA 3KHNA 4TV8A 1IV1A 2UYPA 3NVKE 3VYUC 5FNVA 4FFBB 3F0FA 2QI2A 5CA0B 4X3MA 1FFXA 4O4LB 1GZ0A 3KJKA 3WJQA 5JH7B 1QU9A 5HY4A 4EI9A 1W5BA 4F6RB 4TZZA 3LWVC 3CC2F 1KNKA 2OZBA 4YJ3B 3C9UA 4X20A 2Z01A 1QAHA 3JAKB 3K12A 3O85A 5EYPA 1SZQA 1X25A 1SA0A 2UYNB 3FD6A 2MQEA 3CC7F 2KTVA 2YXZA 5HP8A 4NUTA 5HP7A 5GIPC 4B45A 2CSLA 3KIZA 1DBFA 1X7PA 3GHZA 3CYPB 5B8FA 4IIJB 3HKEA 3SIVA 4LCKA 5LYJB 1U43A 3GTZA 1YQNA 2JNBA 3S03A 3F6MA 2CHSA 4WBNA 3NK7A 5EWRA 2QTPA 3HAXD 2HRUA 4O4HB 2VGMA 1VQKF 3DDNA 4TUYA 4O2BB 2HQSC 5BMVB 4NWOB 2CVLA 4BT5A 3M84A 4O4IB 1NJIH 1W3EX 3CCUF 4BVTA 3FFMA 3N4YA 4HNAA 3WXMB 3RYHA 4X1IB 5IJ0B 1NMUB 3HKBA 3J7AR 4U3JA 1IV3A 4BW0B 3M4SA 3I55F 3B6NA 3T80A 3RA6A 1Q81H 5LXTB 1W42A 4ZHVA 3VI6A 2Z1FA 5C8YB 4U39A 2I6DA 3WPXA 5LA6A 3PLAC 4TV8B 1W57A 2RHOA 1FNJA 3JALB 3D54A 5FNVB 3ERNA 2HRYA 3S0WA 3ELCA 3ZO8A 4X1KA 3G4SF 3CD6F 1RLGA 2BTQB 5EO3A 2HP0B 3E22A 1QVGF 1FFXB 2HS3A 4X1YA 1JFFB 3S02A 5IYZA 1KC8H 3JAMM 3SIUA 4X20B 5CB4B 3N2GA 4O4JA 5EYPB 4O2AA 3VOBA 3ZOPA 1IV2A 3Q8HA 1SA0B 3RE3A 5FLXM 4RHAA 2H8CA 2FGYA 4ZHWA 2YYEA 2Q1XA 1M1KH 1RA4A 2R6R1 2CWJA 2CHTA 3HKEB 3UT5A 1YIJF 3J81M 2I6RA 4C8EA 4EI7A 1YJ9F 1VHAA 3K2XA 5CA1A 3F0DA 3E1YA 3G6EF 3V7EA 4EB6A 2HVYD 4KWEA 1OAPA 4E6EA 4TUYB 3ZP7A 1SDSA 5LP6A 5J2TA 5DCVA 3CCSF 3CCRF 1YJWF 1W5AA 3N4ZA 3CCVF 1VQMF 1TVKA 4HNAB 3K0TA 4ZOLA 4YJ2A 5FJ4C 3HKBB 4U3JB 3VYSC 5ITZA 5AVMA 3OBWA 1XHOA 1KD1H 3IR9A 2K1SA 3P0ZA 2BO1A 1H47A 3F0EA 2LBTA 3TD5A 2AIFA 1VQNF 2IAFA 5LA6B 2VGNA 2LBWA 4I50A 3L7QA 1U3LA 3ON1A 1Z5WA 4X1KB 2Z1UA 2UYJA 5GONA 3MCQA 1H48A 3E22B 1Q82H 3HTNA 4X1YB 3C9RA 4G4ZA 3RYIA 1KNJA 3I56F 1QVFF 5IYZB 5HXZA 3CCJF 3KJJA 2CZWA 3P10A 2VAPA 1T0AA 3ZP4A 2ZVYA 2IG8A 3IKEA 2VXYA 2NMUA 1ODEA 2UYKA 3VO8A 1YJNF 3N2GB 1W581 1VQ5F 4O4JB 3JCMM 4O2AB 1Q7YH 3CPWF 2Z1TA 2OHWA 2GLZA 1M90H 3VYTC 3MQWA 1U3PA 3RA5A 3UT5B 3FBAA 3I3FA 2DT4A 3WGLA 3CYQA 4B46A 1Q86H 1XRGA 3MCAB 1TUBA 3FPIA 5CA1B 3JARA 5EAZA 4BT4A 5LP6C 4EB6B 3HKCB 1FNKA 1VQ8F 3M1XA 2H8EA 4NQ3A 4LNUA 4R40B 2RB9A 5J2TB 3JATA 1W40A 1W5EA 3WGJA 2LBXA
chains in the Genus database with same CATH topology
2QEXF 3CC4F 5HY2A 1YI2F 4C4WC 5FLXM 3V7QA 1CK2A 3V3TA 2FGYA 3NMUC 1M1KH 1RA4A 2KG4A 3GYQA 3NK6A 1ZWZA 3NVKE 2OTLF 1YIJF 1K9MH 3J81M 1H7MA 4EI7A 1YJ9F 3PAFA 3CCMF 2QI2A 3LWOC 3E1YA 5HY0A 3G6EF 3V7EA 2HVYD 4X3MA 1YHQF 2ALEA 2F9ZC 1GZ0A 5HY1A 1VQPF 1X52A 3CCEF 1SDSA 1T0KB 4TZZA 2FC3A 5HY4A 4EI9A 3LWVC 2OZBA 3CC2F 5GAPK 3CCRF 3CCSF 1JJ2F 1YJWF 1K73H 3N4ZA 1YITF 3O85A 3CCVF 3HJWC 2QA4F 1VQMF 5A2QM 3CC7F 2KTVA 3CCLF 5FJ4C 1GO0A 1KQSF 3G71F 3CG6A 4NUTA 3OBWA 3VMFB 2KTUA 5GIPC 1KD1H 1K8AH 3IR9A 4BVQA 1X7PA 3CMEF 5DCVA 2BO1A 5HWEA 1VQ7F 1W41A 2AIFA 1VQNF 1VQOF 3SIVA 4LCKA 2JNBA 2VGNA 3LWRC 2LBWA 3NK7A 2WALA 3ON1A 5EWRA 3LWQC 3CXCF 3HAXD 2VGMA 1VQKF 1Q82H 1VQ4F 1IPAA 3I56F 1QVFF 5HXZA 3CCJF 1GO1A 2CZWA 1VQ6F 1PXWA 1X7OA 1DT9A 1NJIH 1W2BF 1N8RH 1W3EX 1YJNF 3CCUF 4BVTA 3FFMA 1XBIA 3N4YA 3WXMB 5GANK 3LWPC 1VQ5F 1NMUB 3JCMM 3OW2F 4XCQA 4EI8A 3J7AR 1E7KA 1Q7YH 3CPQA 3OBYA 4BW0B 3I55F 3CPWF 3CCQF 1CN7A 5HXUA 5G4UC 3RA6A 4BVSA 1Q81H 1S72F 1W42A 2OHWA 2GLZA 1M90H 3VI6A 2I6DA 1VQ9F 3PLAC 5GIOC 3RA5A 5IT9M 3NVIB 3E20B 3G4SF 1Q86H 1VQLF 3LFOA 3MCAB 3J80M 3CMAF 1RLGA 3CD6F 2OTJF 5EO3A 1QVGF 3D00A 4BVRA 1VQ8F 4BY9D 1KC8H 4NQ3A 5GINC 3JAMM 3SIUA 4X3LA 1W40A 5G4VC 2LBXA 3AGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX F;  3CC4 F;  1YI2 F;  4C4W C;  5FLX M;  3V7Q A;  1CK2 A;  3NMU C;  1M1K H;  1RA4 A;  2KG4 A;  3GYQ A;  3NK6 A;  1ZWZ A;  3NVK E;  2OTL F;  1YIJ F;  1K9M H;  3J81 M;  1H7M A;  1YJ9 F;  3PAF A;  3CCM F;  2QI2 A;  3LWO C;  3E1Y A;  3G6E F;  3V7E A;  2HVY D;  4X3M A;  1YHQ F;  2ALE A;  1GZ0 A;  1VQP F;  1X52 A;  3CCE F;  1SDS A;  1T0K B;  4TZZ A;  2FC3 A;  3LWV C;  2OZB A;  5DCV A;  3CC2 F;  5GAP K;  3CCR F;  3CCS F;  1JJ2 F;  1YJW F;  1K73 H;  3N4Z A;  1YIT F;  3O85 A;  3CCV F;  3HJW C;  2QA4 F;  1VQM F;  5A2Q M;  3CC7 F;  2KTV A;  3CCL F;  5FJ4 C;  1GO0 A;  1KQS F;  3G71 F;  3CG6 A;  4NUT A;  3OBW A;  3VMF B;  2KTU A;  5GIP C;  1KD1 H;  1K8A H;  3IR9 A;  1X7P A;  3CME F;  2BO1 A;  1VQ7 F;  1W41 A;  2AIF A;  1VQN F;  1VQO F;  3SIV A;  4LCK A;  2JNB A;  2VGN A;  3LWR C;  2LBW A;  3NK7 A;  2WAL A;  3ON1 A;  5EWR A;  3LWQ C;  3CXC F;  3HAX D;  2VGM A;  1VQK F;  1Q82 H;  1VQ4 F;  1IPA A;  3I56 F;  1QVF F;  3CCJ F;  1GO1 A;  2CZW A;  1VQ6 F;  1PXW A;  1X7O A;  1DT9 A;  1NJI H;  1W2B F;  1N8R H;  1W3E X;  1YJN F;  3CCU F;  3FFM A;  1XBI A;  3N4Y A;  3WXM B;  5GAN K;  3LWP C;  1VQ5 F;  1NMU B;  3JCM M;  3OW2 F;  3J7A R;  1E7K A;  1Q7Y H;  3CPQ A;  3OBY A;  4BW0 B;  3I55 F;  3CPW F;  3CCQ F;  1CN7 A;  5G4U C;  3RA6 A;  1Q81 H;  1S72 F;  1W42 A;  2OHW A;  1M90 H;  3VI6 A;  2I6D A;  1VQ9 F;  3PLA C;  5GIO C;  3RA5 A;  5IT9 M;  3NVI B;  3E20 B;  3G4S F;  1Q86 H;  1VQL F;  3LFO A;  3MCA B;  3J80 M;  3CMA F;  1RLG A;  3CD6 F;  2OTJ F;  5EO3 A;  1QVG F;  1VQ8 F;  4BY9 D;  1KC8 H;  5GIN C;  3JAM M;  3SIU A;  4X3L A;  1W40 A;  5G4V C;  2LBX A;  3AGK A; 
#chains in the Genus database with same CATH topology
 2LCA A;  3VCZ A;  3CC4 F;  5HY2 A;  1YI2 F;  1TVK B;  4ZOL B;  5JCO A;  4YJ2 B;  1CK2 A;  3V3T A;  5ITZ B;  4G4X A;  5EIB C;  3QUW A;  3GYQ A;  3MDO A;  3NK6 A;  2PHN A;  4C82 A;  1ZWZ A;  5IJ9 A;  2OTL F;  3VOA A;  1H7M A;  3PAF A;  4IHJ A;  3KE1 A;  5HY0 A;  3DC2 A;  2P6Y A;  5J2U A;  1OFU A;  5GON B;  1COM A;  4DXD A;  1VQP F;  1X52 A;  3RYI B;  3VIU A;  1T0K B;  2FC3 A;  2VAM A;  1JJ2 F;  1K73 H;  1YIT F;  1Z5V A;  5JH7 A;  3V4D A;  5LOV B;  3EOR A;  4ZHY B;  4ZK7 A;  3JAK A;  3CCL F;  1UI9 A;  2GVI A;  1GO0 A;  1IV4 A;  3CB2 A;  1KQS F;  3VMF B;  3JAW A;  2RHL A;  2UYN A;  3IEW A;  1K8A H;  4BVQ A;  3CME F;  2V9Y A;  1W41 A;  4WBN B;  5MN6 A;  1PF5 A;  4ZHQ A;  5JVD A;  1RQ2 A;  3LWR C;  2N48 A;  2WAL A;  2Z1E A;  5KMG A;  5LYJ A;  2BTU A;  1TUB B;  3BYQ A;  4ZI7 A;  3JAR B;  2HP3 A;  3OON A;  2ZOD A;  4BT2 A;  3CXC F;  2W8B C;  4TV9 A;  2OTM A;  1VQ4 F;  4I55 A;  4ERH A;  1GO1 A;  1VQ6 F;  1PXW A;  4LNU B;  3D01 A;  3RYH B;  2AMT A;  1X7O A;  3JAT B;  2ZOV A;  1DT9 A;  1N8R H;  5JCO C;  3LWP C;  5GAN K;  3OW2 F;  5EB0 A;  4EI8 A;  1E7K A;  4O4I A;  2RHJ A;  3K14 A;  1W59 A;  2EWC A;  1JD1 A;  4X1I A;  4BVS A;  5IJ0 A;  5MN4 A;  5G4U C;  1S72 F;  4G4W A;  1VQ9 F;  4DRX A;  3C9T A;  3LME A;  5IJ9 B;  5GIO C;  5LXT A;  4B62 A;  5IT9 M;  5C8Y A;  3NVI B;  3IMP A;  3E20 B;  1VQL F;  2PMP A;  3LFO A;  3J80 M;  3CMA F;  2OTJ F;  3JAL A;  4IHJ B;  2ZAU A;  4B5C A;  5J2U B;  1RLU A;  3QHD A;  3D00 A;  4BVR A;  2HP0 A;  4BT6 A;  3JAS A;  1JFF A;  2VAW A;  3P4E A;  5G4V C;  4G88 A;  3AGK A;  3ESJ A;  3S0H A;  4C4W C;  2AIZ P;  5CB4 A;  3WGN A;  3HKD A;  2RHH A;  3JAW B;  5KX5 A;  3FD5 A;  2KG4 A;  2ZF8 A;  4ZHQ B;  5JVD B;  1K9M H;  4C8I A;  3LDT A;  5JQG A;  3CCM F;  3WGK A;  3LWO C;  3QTY A;  5KMG B;  5LP6 B;  4ZI7 B;  1R1M A;  1YHQ F;  2ALE A;  2F9Z C;  5HY1 A;  4I4T A;  1NQ3 A;  4TV9 B;  1QD9 A;  3U0O A;  3WGM A;  3CCE F;  2KGW A;  2BTO A;  3N2K A;  3RYF A;  4I55 B;  3WJP A;  3WPW A;  5GAP K;  5EB1 B;  3IKF A;  5EZY A;  4G4Y A;  3RYC A;  1ONI A;  4C8G A;  3HJW C;  2QA4 F;  1XV2 A;  5A2Q M;  1J7H A;  1Q8R A;  3G71 F;  1W5F A;  3CG6 A;  2KTU A;  2GZL A;  4I50 B;  1FSZ A;  5HWE A;  1VQ7 F;  1VQO F;  5EIB D;  3S0Y A;  4DRX B;  2R75 1;  2ZVZ A;  3TD3 A;  4FFB A;  2Q1Y A;  1JY8 A;  5CA0 A;  4O4L A;  3LWQ C;  4PWT A;  2DYY A;  1IPA A;  4F6R A;  2IQQ A;  2G9I A;  4YJ3 A;  1UFY A;  3JAS B;  1W55 A;  2HX0 A;  1JN1 A;  1W2B F;  2HS0 A;  1RQ7 A;  1XBI A;  3JVH A;  4XCQ A;  3CPQ A;  2CW4 A;  3OBY A;  3CCQ F;  1CN7 A;  5HXU A;  3HKD B;  3IEQ A;  5KX5 B;  3C9S A;  1U40 A;  2H6L A;  2B33 A;  2UZH A;  4IIJ A;  3TD4 A;  2HS4 A;  5MN5 A;  5JQG B;  3HWU A;  1CLI A;  4O4H A;  3WJR A;  4O2B A;  3S06 A;  4I4T B;  4RQO A;  3VTI C;  3LYB A;  4BY9 D;  5GIN C;  3C8L A;  1YGY A;  4BT7 A;  3N2K B;  5BMV A;  4X3L A;  3RYF B;  1VQV A;  1GX1 A;  4M8I A;  1VH8 A;  3HKC A;  5EZY B;  3RYC B;  3I7T A;  4C81 A;  2QEX F;  3R0P A;  3MBM A;  3V7Q A;  5LOV A;  1VK3 A;  4BT3 A;  3NMU C;  3F0G A;  2L26 A;  4G4V A;  3KHN A;  4TV8 A;  1IV1 A;  2UYP A;  3NVK E;  3VYU C;  5FNV A;  4FFB B;  3F0F A;  2QI2 A;  5CA0 B;  4X3M A;  1FFX A;  4O4L B;  1GZ0 A;  3KJK A;  3WJQ A;  5JH7 B;  1QU9 A;  5HY4 A;  4EI9 A;  1W5B A;  4F6R B;  4TZZ A;  3LWV C;  3CC2 F;  1KNK A;  2OZB A;  4YJ3 B;  3C9U A;  4X20 A;  2Z01 A;  1QAH A;  3JAK B;  3K12 A;  3O85 A;  5EYP A;  1SZQ A;  1X25 A;  1SA0 A;  2UYN B;  3FD6 A;  2MQE A;  3CC7 F;  2KTV A;  2YXZ A;  5HP8 A;  4NUT A;  5HP7 A;  5GIP C;  4B45 A;  2CSL A;  3KIZ A;  1DBF A;  1X7P A;  3GHZ A;  3CYP B;  5B8F A;  4IIJ B;  3HKE A;  3SIV A;  4LCK A;  5LYJ B;  1U43 A;  3GTZ A;  1YQN A;  2JNB A;  3S03 A;  3F6M A;  2CHS A;  4WBN A;  3NK7 A;  5EWR A;  2QTP A;  3HAX D;  2HRU A;  4O4H B;  2VGM A;  1VQK F;  3DDN A;  4TUY A;  4O2B B;  2HQS C;  5BMV B;  4NWO B;  2CVL A;  4BT5 A;  3M84 A;  4O4I B;  1NJI H;  1W3E X;  3CCU F;  4BVT A;  3FFM A;  3N4Y A;  4HNA A;  3WXM B;  3RYH A;  4X1I B;  5IJ0 B;  1NMU B;  3HKB A;  3J7A R;  4U3J A;  1IV3 A;  4BW0 B;  3M4S A;  3I55 F;  3B6N A;  3T80 A;  3RA6 A;  1Q81 H;  5LXT B;  1W42 A;  4ZHV A;  3VI6 A;  2Z1F A;  5C8Y B;  4U39 A;  2I6D A;  3WPX A;  5LA6 A;  3PLA C;  4TV8 B;  1W57 A;  2RHO A;  1FNJ A;  3JAL B;  3D54 A;  5FNV B;  3ERN A;  2HRY A;  3S0W A;  3ELC A;  3ZO8 A;  4X1K A;  3G4S F;  3CD6 F;  1RLG A;  2BTQ B;  5EO3 A;  2HP0 B;  3E22 A;  1QVG F;  1FFX B;  2HS3 A;  4X1Y A;  1JFF B;  3S02 A;  5IYZ A;  1KC8 H;  3JAM M;  3SIU A;  4X20 B;  5CB4 B;  3N2G A;  4O4J A;  5EYP B;  4O2A A;  3VOB A;  3ZOP A;  1IV2 A;  3Q8H A;  1SA0 B;  3RE3 A;  5FLX M;  4RHA A;  2H8C A;  2FGY A;  4ZHW A;  2YYE A;  2Q1X A;  1M1K H;  1RA4 A;  2R6R 1;  2CWJ A;  2CHT A;  3HKE B;  3UT5 A;  1YIJ F;  3J81 M;  2I6R A;  4C8E A;  4EI7 A;  1YJ9 F;  1VHA A;  3K2X A;  5CA1 A;  3F0D A;  3E1Y A;  3G6E F;  3V7E A;  4EB6 A;  2HVY D;  4KWE A;  1OAP A;  4E6E A;  4TUY B;  3ZP7 A;  1SDS A;  5LP6 A;  5J2T A;  5DCV A;  3CCS F;  3CCR F;  1YJW F;  1W5A A;  3N4Z A;  3CCV F;  1VQM F;  1TVK A;  4HNA B;  3K0T A;  4ZOL A;  4YJ2 A;  5FJ4 C;  3HKB B;  4U3J B;  3VYS C;  5ITZ A;  5AVM A;  3OBW A;  1XHO A;  1KD1 H;  3IR9 A;  2K1S A;  3P0Z A;  2BO1 A;  1H47 A;  3F0E A;  2LBT A;  3TD5 A;  2AIF A;  1VQN F;  2IAF A;  5LA6 B;  2VGN A;  2LBW A;  4I50 A;  3L7Q A;  1U3L A;  3ON1 A;  1Z5W A;  4X1K B;  2Z1U A;  2UYJ A;  5GON A;  3MCQ A;  1H48 A;  3E22 B;  1Q82 H;  3HTN A;  4X1Y B;  3C9R A;  4G4Z A;  3RYI A;  1KNJ A;  3I56 F;  1QVF F;  5IYZ B;  5HXZ A;  3CCJ F;  3KJJ A;  2CZW A;  3P10 A;  2VAP A;  1T0A A;  3ZP4 A;  2ZVY A;  2IG8 A;  3IKE A;  2VXY A;  2NMU A;  1ODE A;  2UYK A;  3VO8 A;  1YJN F;  3N2G B;  1W58 1;  1VQ5 F;  4O4J B;  3JCM M;  4O2A B;  1Q7Y H;  3CPW F;  2Z1T A;  2OHW A;  2GLZ A;  1M90 H;  3VYT C;  3MQW A;  1U3P A;  3RA5 A;  3UT5 B;  3FBA A;  3I3F A;  2DT4 A;  3WGL A;  3CYQ A;  4B46 A;  1Q86 H;  1XRG A;  3MCA B;  1TUB A;  3FPI A;  5CA1 B;  3JAR A;  5EAZ A;  4BT4 A;  5LP6 C;  4EB6 B;  3HKC B;  1FNK A;  1VQ8 F;  3M1X A;  2H8E A;  4NQ3 A;  4LNU A;  4R40 B;  2RB9 A;  5J2T B;  3JAT A;  1W40 A;  1W5E A;  3WGJ A;  2LBX A; 
#chains in the Genus database with same CATH homology
 2QEX F;  3CC4 F;  5HY2 A;  1YI2 F;  4C4W C;  5FLX M;  3V7Q A;  1CK2 A;  3V3T A;  2FGY A;  3NMU C;  1M1K H;  1RA4 A;  2KG4 A;  3GYQ A;  3NK6 A;  1ZWZ A;  3NVK E;  2OTL F;  1YIJ F;  1K9M H;  3J81 M;  1H7M A;  4EI7 A;  1YJ9 F;  3PAF A;  3CCM F;  2QI2 A;  3LWO C;  3E1Y A;  5HY0 A;  3G6E F;  3V7E A;  2HVY D;  4X3M A;  1YHQ F;  2ALE A;  2F9Z C;  1GZ0 A;  5HY1 A;  1VQP F;  1X52 A;  3CCE F;  1SDS A;  1T0K B;  4TZZ A;  2FC3 A;  5HY4 A;  4EI9 A;  3LWV C;  2OZB A;  3CC2 F;  5GAP K;  3CCR F;  3CCS F;  1JJ2 F;  1YJW F;  1K73 H;  3N4Z A;  1YIT F;  3O85 A;  3CCV F;  3HJW C;  2QA4 F;  1VQM F;  5A2Q M;  3CC7 F;  2KTV A;  3CCL F;  5FJ4 C;  1GO0 A;  1KQS F;  3G71 F;  3CG6 A;  4NUT A;  3OBW A;  3VMF B;  2KTU A;  5GIP C;  1KD1 H;  1K8A H;  3IR9 A;  4BVQ A;  1X7P A;  3CME F;  5DCV A;  2BO1 A;  5HWE A;  1VQ7 F;  1W41 A;  2AIF A;  1VQN F;  1VQO F;  3SIV A;  4LCK A;  2JNB A;  2VGN A;  3LWR C;  2LBW A;  3NK7 A;  2WAL A;  3ON1 A;  5EWR A;  3LWQ C;  3CXC F;  3HAX D;  2VGM A;  1VQK F;  1Q82 H;  1VQ4 F;  1IPA A;  3I56 F;  1QVF F;  5HXZ A;  3CCJ F;  1GO1 A;  2CZW A;  1VQ6 F;  1PXW A;  1X7O A;  1DT9 A;  1NJI H;  1W2B F;  1N8R H;  1W3E X;  1YJN F;  3CCU F;  4BVT A;  3FFM A;  1XBI A;  3N4Y A;  3WXM B;  5GAN K;  3LWP C;  1VQ5 F;  1NMU B;  3JCM M;  3OW2 F;  4XCQ A;  4EI8 A;  3J7A R;  1E7K A;  1Q7Y H;  3CPQ A;  3OBY A;  4BW0 B;  3I55 F;  3CPW F;  3CCQ F;  1CN7 A;  5HXU A;  5G4U C;  3RA6 A;  4BVS A;  1Q81 H;  1S72 F;  1W42 A;  2OHW A;  2GLZ A;  1M90 H;  3VI6 A;  2I6D A;  1VQ9 F;  3PLA C;  5GIO C;  3RA5 A;  5IT9 M;  3NVI B;  3E20 B;  3G4S F;  1Q86 H;  1VQL F;  3LFO A;  3MCA B;  3J80 M;  3CMA F;  1RLG A;  3CD6 F;  2OTJ F;  5EO3 A;  1QVG F;  3D00 A;  4BVR A;  1VQ8 F;  4BY9 D;  1KC8 H;  4NQ3 A;  5GIN C;  3JAM M;  3SIU A;  4X3L A;  1W40 A;  5G4V C;  2LBX A;  3AGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...