1COEA

Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study.
pubmed doi rcsb
source organism Naja atra
molecule tags Short neurotoxin
molecule keywords COBROTOXIN
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1coeA00
1KL8A 1L4WA 4UY2C 1CB9A 4BDTB 2HLRA 4BIKB 1RL5A 2NBTA 3HH7A 2L03A 1KBTA 2JQPA 1NORA 1FFJA 1BTEA 1PLOA 1IK8A 3PLCA 1KXIA 1NYUA 3FEVA 1NTNA 2BTXA 2L5SA 4FAOE 4OM5A 2QJ9C 1CREA 1HC9B 1NEAA 4DO8A 1BXPA 1CTXA 1IDHA 1JBDA 2H62C 1IDIA 1COEA 2QC1A 2MUOA 2H7ZA 1KBAA 1NYSA 1ES7B 3NEQA 1KC4A 1FSCA 3EVSC 1JE9A 5DZ5A 1IQ9A 2UWRA 3NDSA 1IDLA 4P7UA 1LXGA 1HC9A 4FAOC 1IDGA 2H64C 2JVEA 1QM7A 2CRSA 1HOYA 5EBXA 2MHYA 3EBXA 4XJJA 1CODA 1CDQA 1ABTA 3LAQU 4QTIU 2CCXA 1H0JA 2QJBC 2ABXA 2CRTA 1DRSA 1KFHA 2H62D 1YWHA 1LSIA 4OM4A 1CHVS 2UX2A 2N99A 2PJYC 1LX5B 1CDTA 2BHIA 1NXBA 4IYEA 3KFDI 1UG4A 1LXHA 1TXBA 2PJYB 3KFDE 2LA1A 1JGKA 1REWC 2H8UA 3QB4B 1KTZB 2GOOB 2H7ZB 2GOOC 6EBXA 2H64B 2K3GA 1FF4A 1NTXA 2MJ4A 1S4YA 5IMYC 2MJYA 1CXNA 1FASA 3BT2U 4LFTA 3VTSA 4EY8B 4RUDA 1CXOA 1TXAA 1KS6A 3BT1U 1IKCA 1QKEA 1TFSA 1CVOA 5IMTD 2LCRA 2CTXA 1M9ZA 3U74U 1ERAA 3U73U 2X8BB 2HLQA 2VLWA 1HAAA 1MR6A 1HAJA 1F8UB 2CDXA 2OFSA 1KU6B 1QKDA 2H5FA 2J8BA 1KBSA 1IJCA 4ZQYA 1TGXA 4HQPF 2ERAA 1B41B 1ERGA 1ZADA 3ERAA 3NH7A 1CRFA 1XT3A 4AEAA 2FD6U 2MJ0A 5DO6A 2I9BE 1ONJA 2MFAA 1MAHF 1LJZA 1V6PA 1F94A 1RGJA 1CDRA 1FSSB 1I02A 5DU1A 1FRAA 1G6MA 1VB0A 1W6BA 1CCQA 2QJAC 2MUPA 1CDSA
chains in the Genus database with same CATH superfamily
1KL8A 1L4WA 4UY2C 1CB9A 4BDTB 2HLRA 4BIKB 1RL5A 2NBTA 3HH7A 2L03A 1KBTA 2JQPA 1NORA 1FFJA 1BTEA 1PLOA 1IK8A 3PLCA 1KXIA 1NYUA 3FEVA 1NTNA 2BTXA 2L5SA 4FAOE 4OM5A 2QJ9C 1CREA 1HC9B 1NEAA 4DO8A 1BXPA 1CTXA 1IDHA 1JBDA 2H62C 1IDIA 1COEA 2QC1A 2MUOA 2H7ZA 1KBAA 1NYSA 1ES7B 3NEQA 1KC4A 1FSCA 3EVSC 1JE9A 5DZ5A 1IQ9A 2UWRA 3NDSA 1IDLA 4P7UA 1LXGA 1HC9A 4FAOC 1IDGA 2H64C 2JVEA 1QM7A 2CRSA 1HOYA 5EBXA 2MHYA 3EBXA 4XJJA 1CODA 1CDQA 1ABTA 3LAQU 4QTIU 2CCXA 1H0JA 2QJBC 2ABXA 2CRTA 1DRSA 1KFHA 2H62D 1YWHA 1LSIA 4OM4A 1CHVS 2UX2A 2N99A 2PJYC 1LX5B 1CDTA 2BHIA 1NXBA 4IYEA 3KFDI 1UG4A 1LXHA 1TXBA 4KSNA 2PJYB 3KFDE 2LA1A 1JGKA 1REWC 2H8UA 3QB4B 1KTZB 2GOOB 2H7ZB 2GOOC 6EBXA 2H64B 2K3GA 1FF4A 1NTXA 2MJ4A 1S4YA 5IMYC 2MJYA 1CXNA 1FASA 3BT2U 4LFTA 3VTSA 4EY8B 4RUDA 1CXOA 1TXAA 1KS6A 3BT1U 1IKCA 1QKEA 1TFSA 1CVOA 5IMTD 2LCRA 2CTXA 1M9ZA 3U74U 1ERAA 3U73U 2X8BB 2HLQA 2VLWA 1HAAA 1MR6A 1HAJA 1F8UB 2CDXA 2OFSA 1KU6B 1QKDA 2H5FA 2J8BA 1KBSA 1IJCA 4ZQYA 1TGXA 4HQPF 2ERAA 1B41B 1ERGA 1ZADA 3ERAA 3NH7A 1CRFA 1XT3A 4AEAA 2FD6U 2MJ0A 5DO6A 2I9BE 1ONJA 2MFAA 1MAHF 1LJZA 1V6PA 1F94A 1RGJA 1CDRA 1FSSB 1I02A 5DU1A 1FRAA 1G6MA 1VB0A 1W6BA 1CCQA 2QJAC 2MUPA 1CDSA
chains in the Genus database with same CATH topology
1KL8A 1L4WA 4UY2C 1CB9A 4BDTB 2HLRA 4BIKB 1RL5A 2NBTA 3HH7A 2L03A 1KBTA 2JQPA 1NORA 1FFJA 1BTEA 1PLOA 1IK8A 3PLCA 1KXIA 1NYUA 3FEVA 1NTNA 2BTXA 2L5SA 4FAOE 4OM5A 2QJ9C 1CREA 1HC9B 1NEAA 4DO8A 1BXPA 1CTXA 1IDHA 1JBDA 2H62C 1IDIA 1COEA 2QC1A 2MUOA 2H7ZA 1KBAA 1NYSA 1ES7B 3NEQA 1KC4A 1FSCA 3EVSC 1JE9A 5DZ5A 1IQ9A 2UWRA 3NDSA 1IDLA 4P7UA 1LXGA 1HC9A 4FAOC 1IDGA 2H64C 2JVEA 1QM7A 2CRSA 1HOYA 5EBXA 2MHYA 3EBXA 4XJJA 1CODA 1CDQA 1ABTA 3LAQU 4QTIU 2CCXA 1H0JA 2QJBC 2ABXA 2CRTA 1DRSA 1KFHA 2H62D 1YWHA 1LSIA 4OM4A 1CHVS 2UX2A 2N99A 2PJYC 1LX5B 1CDTA 2BHIA 1NXBA 4IYEA 3KFDI 1UG4A 1LXHA 1TXBA 4KSNA 2PJYB 3KFDE 2LA1A 1JGKA 1REWC 2H8UA 3QB4B 1KTZB 2GOOB 2H7ZB 2GOOC 6EBXA 2H64B 2K3GA 1FF4A 1NTXA 2MJ4A 1S4YA 5IMYC 2MJYA 1CXNA 1FASA 3BT2U 4LFTA 3VTSA 4EY8B 4RUDA 1CXOA 1TXAA 1KS6A 3BT1U 1IKCA 1QKEA 1TFSA 1CVOA 5IMTD 2LCRA 2CTXA 1M9ZA 3U74U 1ERAA 3U73U 2X8BB 2HLQA 2VLWA 1HAAA 1MR6A 1HAJA 1F8UB 2CDXA 2OFSA 1KU6B 1QKDA 2H5FA 2J8BA 1KBSA 1IJCA 4ZQYA 1TGXA 4HQPF 2ERAA 1B41B 1ERGA 1ZADA 3ERAA 3NH7A 1CRFA 1XT3A 4AEAA 2FD6U 2MJ0A 5DO6A 2I9BE 1ONJA 2MFAA 1MAHF 1LJZA 1V6PA 1F94A 1RGJA 1CDRA 1FSSB 1I02A 5DU1A 1FRAA 1G6MA 1VB0A 1W6BA 1CCQA 2QJAC 2MUPA 1CDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL8 A;  1L4W A;  4UY2 C;  1CB9 A;  4BDT B;  2HLR A;  4BIK B;  1RL5 A;  2NBT A;  3HH7 A;  2L03 A;  1KBT A;  2JQP A;  1NOR A;  1FFJ A;  1BTE A;  1PLO A;  1IK8 A;  3PLC A;  1KXI A;  1NYU A;  3FEV A;  1NTN A;  2BTX A;  2L5S A;  4FAO E;  4OM5 A;  2QJ9 C;  1CRE A;  1HC9 B;  1NEA A;  4DO8 A;  1BXP A;  1CTX A;  1IDH A;  1JBD A;  2H62 C;  1IDI A;  1COE A;  2QC1 A;  2MUO A;  2H7Z A;  1KBA A;  1NYS A;  1ES7 B;  3NEQ A;  1KC4 A;  1FSC A;  3EVS C;  1JE9 A;  5DZ5 A;  1IQ9 A;  2UWR A;  3NDS A;  1IDL A;  4P7U A;  1LXG A;  1HC9 A;  4FAO C;  1IDG A;  2H64 C;  2JVE A;  1QM7 A;  2CRS A;  1HOY A;  5EBX A;  2MHY A;  3EBX A;  4XJJ A;  1COD A;  1CDQ A;  1ABT A;  3LAQ U;  4QTI U;  2CCX A;  1H0J A;  2QJB C;  2ABX A;  2CRT A;  1DRS A;  1KFH A;  2H62 D;  1YWH A;  1LSI A;  4OM4 A;  1CHV S;  2UX2 A;  2N99 A;  2PJY C;  1LX5 B;  1CDT A;  2BHI A;  1NXB A;  4IYE A;  3KFD I;  1UG4 A;  1LXH A;  1TXB A;  2PJY B;  3KFD E;  2LA1 A;  1JGK A;  1REW C;  2H8U A;  3QB4 B;  1KTZ B;  2GOO B;  2H7Z B;  2GOO C;  6EBX A;  2H64 B;  2K3G A;  1FF4 A;  1NTX A;  2MJ4 A;  1S4Y A;  5IMY C;  2MJY A;  1CXN A;  1FAS A;  3BT2 U;  4LFT A;  3VTS A;  4EY8 B;  4RUD A;  1CXO A;  1TXA A;  1KS6 A;  3BT1 U;  1IKC A;  1QKE A;  1TFS A;  1CVO A;  5IMT D;  2LCR A;  2CTX A;  1M9Z A;  3U74 U;  1ERA A;  3U73 U;  2X8B B;  2HLQ A;  2VLW A;  1HAA A;  1MR6 A;  1HAJ A;  1F8U B;  2CDX A;  2OFS A;  1KU6 B;  1QKD A;  2H5F A;  2J8B A;  1KBS A;  1IJC A;  4ZQY A;  1TGX A;  4HQP F;  2ERA A;  1B41 B;  1ERG A;  1ZAD A;  3ERA A;  3NH7 A;  1CRF A;  1XT3 A;  4AEA A;  2FD6 U;  2MJ0 A;  5DO6 A;  2I9B E;  1ONJ A;  2MFA A;  1MAH F;  1LJZ A;  1V6P A;  1F94 A;  1RGJ A;  1CDR A;  1FSS B;  1I02 A;  5DU1 A;  1FRA A;  1G6M A;  1VB0 A;  1W6B A;  1CCQ A;  2QJA C;  2MUP A;  1CDS A; 
#chains in the Genus database with same CATH topology
 1KL8 A;  1L4W A;  4UY2 C;  1CB9 A;  4BDT B;  2HLR A;  4BIK B;  1RL5 A;  2NBT A;  3HH7 A;  2L03 A;  1KBT A;  2JQP A;  1NOR A;  1FFJ A;  1BTE A;  1PLO A;  1IK8 A;  3PLC A;  1KXI A;  1NYU A;  3FEV A;  1NTN A;  2BTX A;  2L5S A;  4FAO E;  4OM5 A;  2QJ9 C;  1CRE A;  1HC9 B;  1NEA A;  4DO8 A;  1BXP A;  1CTX A;  1IDH A;  1JBD A;  2H62 C;  1IDI A;  1COE A;  2QC1 A;  2MUO A;  2H7Z A;  1KBA A;  1NYS A;  1ES7 B;  3NEQ A;  1KC4 A;  1FSC A;  3EVS C;  1JE9 A;  5DZ5 A;  1IQ9 A;  2UWR A;  3NDS A;  1IDL A;  4P7U A;  1LXG A;  1HC9 A;  4FAO C;  1IDG A;  2H64 C;  2JVE A;  1QM7 A;  2CRS A;  1HOY A;  5EBX A;  2MHY A;  3EBX A;  4XJJ A;  1COD A;  1CDQ A;  1ABT A;  3LAQ U;  4QTI U;  2CCX A;  1H0J A;  2QJB C;  2ABX A;  2CRT A;  1DRS A;  1KFH A;  2H62 D;  1YWH A;  1LSI A;  4OM4 A;  1CHV S;  2UX2 A;  2N99 A;  2PJY C;  1LX5 B;  1CDT A;  2BHI A;  1NXB A;  4IYE A;  3KFD I;  1UG4 A;  1LXH A;  1TXB A;  4KSN A;  2PJY B;  3KFD E;  2LA1 A;  1JGK A;  1REW C;  2H8U A;  3QB4 B;  1KTZ B;  2GOO B;  2H7Z B;  2GOO C;  6EBX A;  2H64 B;  2K3G A;  1FF4 A;  1NTX A;  2MJ4 A;  1S4Y A;  5IMY C;  2MJY A;  1CXN A;  1FAS A;  3BT2 U;  4LFT A;  3VTS A;  4EY8 B;  4RUD A;  1CXO A;  1TXA A;  1KS6 A;  3BT1 U;  1IKC A;  1QKE A;  1TFS A;  1CVO A;  5IMT D;  2LCR A;  2CTX A;  1M9Z A;  3U74 U;  1ERA A;  3U73 U;  2X8B B;  2HLQ A;  2VLW A;  1HAA A;  1MR6 A;  1HAJ A;  1F8U B;  2CDX A;  2OFS A;  1KU6 B;  1QKD A;  2H5F A;  2J8B A;  1KBS A;  1IJC A;  4ZQY A;  1TGX A;  4HQP F;  2ERA A;  1B41 B;  1ERG A;  1ZAD A;  3ERA A;  3NH7 A;  1CRF A;  1XT3 A;  4AEA A;  2FD6 U;  2MJ0 A;  5DO6 A;  2I9B E;  1ONJ A;  2MFA A;  1MAH F;  1LJZ A;  1V6P A;  1F94 A;  1RGJ A;  1CDR A;  1FSS B;  1I02 A;  5DU1 A;  1FRA A;  1G6M A;  1VB0 A;  1W6B A;  1CCQ A;  2QJA C;  2MUP A;  1CDS A; 
#chains in the Genus database with same CATH homology
 1KL8 A;  1L4W A;  4UY2 C;  1CB9 A;  4BDT B;  2HLR A;  4BIK B;  1RL5 A;  2NBT A;  3HH7 A;  2L03 A;  1KBT A;  2JQP A;  1NOR A;  1FFJ A;  1BTE A;  1PLO A;  1IK8 A;  3PLC A;  1KXI A;  1NYU A;  3FEV A;  1NTN A;  2BTX A;  2L5S A;  4FAO E;  4OM5 A;  2QJ9 C;  1CRE A;  1HC9 B;  1NEA A;  4DO8 A;  1BXP A;  1CTX A;  1IDH A;  1JBD A;  2H62 C;  1IDI A;  1COE A;  2QC1 A;  2MUO A;  2H7Z A;  1KBA A;  1NYS A;  1ES7 B;  3NEQ A;  1KC4 A;  1FSC A;  3EVS C;  1JE9 A;  5DZ5 A;  1IQ9 A;  2UWR A;  3NDS A;  1IDL A;  4P7U A;  1LXG A;  1HC9 A;  4FAO C;  1IDG A;  2H64 C;  2JVE A;  1QM7 A;  2CRS A;  1HOY A;  5EBX A;  2MHY A;  3EBX A;  4XJJ A;  1COD A;  1CDQ A;  1ABT A;  3LAQ U;  4QTI U;  2CCX A;  1H0J A;  2QJB C;  2ABX A;  2CRT A;  1DRS A;  1KFH A;  2H62 D;  1YWH A;  1LSI A;  4OM4 A;  1CHV S;  2UX2 A;  2N99 A;  2PJY C;  1LX5 B;  1CDT A;  2BHI A;  1NXB A;  4IYE A;  3KFD I;  1UG4 A;  1LXH A;  1TXB A;  4KSN A;  2PJY B;  3KFD E;  2LA1 A;  1JGK A;  1REW C;  2H8U A;  3QB4 B;  1KTZ B;  2GOO B;  2H7Z B;  2GOO C;  6EBX A;  2H64 B;  2K3G A;  1FF4 A;  1NTX A;  2MJ4 A;  1S4Y A;  5IMY C;  2MJY A;  1CXN A;  1FAS A;  3BT2 U;  4LFT A;  3VTS A;  4EY8 B;  4RUD A;  1CXO A;  1TXA A;  1KS6 A;  3BT1 U;  1IKC A;  1QKE A;  1TFS A;  1CVO A;  5IMT D;  2LCR A;  2CTX A;  1M9Z A;  3U74 U;  1ERA A;  3U73 U;  2X8B B;  2HLQ A;  2VLW A;  1HAA A;  1MR6 A;  1HAJ A;  1F8U B;  2CDX A;  2OFS A;  1KU6 B;  1QKD A;  2H5F A;  2J8B A;  1KBS A;  1IJC A;  4ZQY A;  1TGX A;  4HQP F;  2ERA A;  1B41 B;  1ERG A;  1ZAD A;  3ERA A;  3NH7 A;  1CRF A;  1XT3 A;  4AEA A;  2FD6 U;  2MJ0 A;  5DO6 A;  2I9B E;  1ONJ A;  2MFA A;  1MAH F;  1LJZ A;  1V6P A;  1F94 A;  1RGJ A;  1CDR A;  1FSS B;  1I02 A;  5DU1 A;  1FRA A;  1G6M A;  1VB0 A;  1W6B A;  1CCQ A;  2QJA C;  2MUP A;  1CDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...