1COUA

Anticoagulant protein from the nematode ancylostoma caninum
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
b'KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NEMATODE ANTICOAGULANT PROTEIN C2)
publication title Inherent flexibility in a potent inhibitor of blood coagulation, recombinant nematode anticoagulant protein c2.
pubmed doi rcsb
source organism Ancylostoma caninum
molecule tags Blood clotting
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01826 TIL Trypsin Inhibitor like cysteine rich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1couA00
1MOXC 2YGOA 5E8DA 2MGPA 5L30L 2XBWL 2M74A 1LPZA 3KCGL 4YZUB 1BF9A 2P3UA 5JVZA 1PTHA 1K36A 4D0FA 1DX5I 5EGMB 3TK5B 1JBUL 1W7XL 4JYUL 2W2NE 1APOA 3N8WB 2P3FN 2WYGB 3N8YA 3PGHA 5IKQA 1RFNB 3GCXE 3P5BL 2P93L 2UWPB 1UZJA 4ISHL 3KL6B 4Z0LA 3BPSE 3HPTA 2VWLL 1LPKA 1CX2A 1WU1B 4X8VL 2WFTA 4COXA 2G00L 2KL7A 2B7DL 4CSYA 5JVYA 3TGFA 2Q1JB 2WFXB 2VH0B 2WG3C 4OTYA 4ZH8B 1GK5A 3SOVA 2BZ6L 2RNLA 1MQ6L 3LIWB 4BTUA 4C16A 3BT1A 1P0SL 1APQA 3LTFB 5CISA 3TK6B 3H5CB 1Q4GA 3EGFA 1YUKB 2W2OE 2EI8B 1DVAL 3HO5A 4CUDA 3Q3KB 3IJEB 2W26B 5CKNA 1EPIA 2EI7B 1NPEB 4BTIA 1ADXA 4Y7AB 2FLBL 1KSNB 3FFGL 1TPGA 2BQ7A 2UWOB 1UZKA 2WPME 2BOKL 2Y5GL 1PRHA 4BDWA 1FFMA 2J4IB 4RS0A 1MQ5L 1HAFA 1YO8A 4LMFA 1IQKL 1QFKL 1NFYB 1JL9A 4XLWA 1HREA 1CQEA 2Y5HL 4CUEA 4BDXA 2RA0L 1KLJL 4JYVL 1FF7A 3HO4A 2ADXA 1NFUB 1HCGB 2Y5FL 4X8TL 2VWMK 3FCSB 1CCFA 2OYEP 3R05A 1HJ7A 3LC5B 2FLGA 4ZXYL 1IQIL 4NGAL 4Z0KB 4Y76B 1G1QA 2F9BL 1LQDA 1NT0A 1I0UA 2GD4A 4Y6DB 1FAXL 2KV4A 6COXA 4MMXB 1WHEA 3NTGA 1A3PA 5I46L 3KQDL 5F1AA 3BT2A 2J38B 2W2PE 3QH0A 5COXA 3FBYA 4LORA 3CA7A 5JB9E 2WG4B 2K2SB 1Z6CA 2Y38A 2W2ME 4TGFA 2WPKE 1NZIA 2MGRA 2WPIE 3SOBB 1HT8A 1CVUA 2Y80B 1HT5A 2RHPA 2XC4L 4MMYB 1IP0A 3LN0A 3KQBL 1KIGL 1KLIL 1FE2A 3HS5A 5IKRA 3ZYJB 2D1JB 1DQBA 1L5GB 3N8YB 4Y7BB 1N7DA 1DIYA 1F7EA 4MMZB 2H9EL 2BQ6A 2VVCK 2BMGA 4OTJA 1F0RB 3CFWA 4YT6L 3TZIA 5K0HB 1LPGA 2FLRL 1G1RA 2Y81B 1AUTL 1DDXA 1C5MF 4NG9L 1IQJL 2PUQL 4ZHAB 2XC0L 3SOQA 4AQTA 3KQCL 1OB1C 4D90A 2P94L 1F0SB 4JZEL 2P95L 3NT1A 1XKAL 4ZXXL 1O5DL 2FD6A 1NFWB 4JZFL 2VVVL 1JV2B 2AYLA 2Y7ZB 1F7MA 2XBYL 2Y7XB 2P3TA 2WPJE 4ZAEB 4Z6AL 2YGPA 1B9WA 3DEMA 4O1ZA 5F19A 2BO2A 1U67A 3F6UL 5CKQA 4A7IA 1G2MB 1U8CB 4E1GA 3HO3A 5JB8E 1G2LB 2EI6B 3Q7DA 2Y82B 4Y79B 1NQLB 3U73A 5L2ZL 4BXWA 2XC5L 5JBBE 2NPRA 3LC3B 2BOUA 4X8SL 3CENL 4M10A 4RRWA 4RUTA 3N8VA 3ZYIB 2VVUL 3NTBA 1ATDA 3MDLA 5IKTA 3LN1A 2OYUP 2VWNL 3F1SB 1IQEL 1XFEA 4D0EA 3OLUA 1EPHA 4G1MB 1IQML 3K9XA 1UZQA 3POYA 2WPHE 1FAKL 1UZPA 2VWOL 3ENSA 2XBXL 3N8ZA 3OLTA 2WYJB 4YT7L 4NA9L 1IQNL 3M36L 1CEJA 4CUFA 2W2QE 2BQWA 2J2UB 3N8WA 1PXXA 2J34B 5KN5C 3V64C 1ATBA 4Y71B 2P16L 4PH9A 3QCWA 1IGZA 1X7AL 3NJPC 2XBVL 1IOXA 2UWLB 1YUFA 1LMJA 3ELAL 1HZ8A 1TLEA 2JKHL 1HRFA 4RRZA 4RRXA 3TBDA 3LTGD 4M11A 5JBAE 1M1XB 3IITB 1FJSL 3C9AC 3KRKA 1ATAA 2PHBB 3TH3L 5JW1A 3MQEA 2P28B 1EZQB 3GCWE 5L2YL 1EBVA 1EMNA 4BXSA 5KIRA 1EPGA 1HX2A 3RR3A 1YGCL 1G1SA 3ASIA 1IVOC 4O02B 1CVWL 1WHFA 1IJQA 1EMOA 2FZZL 2DDUA 2CJIB 2MHPA 4X8UL 1EQHA 1IQHL 1N1IA 3HS7A 4ISIL 1IQLL 5FDQA 1P9JA 2I9BA 4RRYA 4FM5A 3M37L 2PR3B 1V3XB 4XBMA 4XL1A 2KB9A 1HAEA 3CS7L 1IOEL 2W3KB 1EQGA 1IQGL 1SZBA 1Z6EL 5JBCE 3HS6A 4JZDL 1TOZA 2J94B 4BTTA 1ATEA 1IQFL 3V65B 1FSBA 2I9AA 1G1TA 3KK6A 5CKMA 3ZYGA 2BOHA 2VJ3A 1EPJA 2P26A 2VH6B 1K37A 2W3IB 1J9CL 3KQEL 1NFXB 2BOXA 1IGXA 2WPLE 1KLOA 1URKA 1XDTR 2J95B 3QMOA 3GISX 1CCVA 2P3FL 3LAQA 1YUGA 1ZAQA 2K2TA 5IKVA 3SW2A 1EGFA 3N8XA 1COUA 1L3YA 2TGFA 3U7UG 1W8BL 1PFXL 1EAIC 2W86A 1PGEA 1XKBA
chains in the Genus database with same CATH superfamily
1MOXC 2YGOA 5E8DA 2MGPA 5L30L 2XBWL 2M74A 1LPZA 3KCGL 4YZUB 1BF9A 4GU3A 2P3UA 5JVZA 1PTHA 1K36A 4D0FA 1DX5I 5EGMB 3TK5B 1JBUL 1W7XL 4JYUL 2W2NE 1APOA 3N8WB 2P3FN 2WYGB 3N8YA 3PGHA 5IKQA 1RFNB 3GCXE 3P5BL 2P93L 2UWPB 1UZJA 4ISHL 3KL6B 4Z0LA 3BPSE 3HPTA 2VWLL 1KKEA 1LPKA 1CX2A 1WU1B 4X8VL 2WFTA 4COXA 2G00L 2HORA 2KL7A 2B7DL 4CSYA 5JVYA 3TGFA 2Q1JB 2WFXB 2VH0B 2WG3C 4OTYA 4ZH8B 1GK5A 3SOVA 2BZ6L 2RNLA 1MQ6L 3LIWB 4BTUA 4C16A 3BT1A 1P0SL 1APQA 3LTFB 5CISA 3TK6B 3H5CB 1Q4GA 3EGFA 1YUKB 2W2OE 2EI8B 1DVAL 3HO5A 4CUDA 3Q3KB 3IJEB 2W26B 5CKNA 1EPIA 2EI7B 1NPEB 4BTIA 1ADXA 4Y7AB 2FLBL 1KSNB 3FFGL 1TPGA 2BQ7A 2UWOB 1UZKA 2WPME 2BOKL 2Y5GL 1PRHA 4BDWA 1FFMA 2J4IB 4RS0A 1MQ5L 1HAFA 1YO8A 4LMFA 1IQKL 1QFKL 1NFYB 1JL9A 4XLWA 1V1IA 1HREA 1CQEA 2Y5HL 4CUEA 4BDXA 2RA0L 1KLJL 4JYVL 1FF7A 3HO4A 2ADXA 1NFUB 1HCGB 2Y5FL 4X8TL 2VWMK 3FCSB 1CCFA 2OYEP 3R05A 1HJ7A 3LC5B 2FLGA 4ZXYL 1IQIL 4NGAL 4Z0KB 4Y76B 1G1QA 2F9BL 1LQDA 1NT0A 3S6XA 1I0UA 2GD4A 4Y6DB 1FAXL 2KV4A 6COXA 4MMXB 1WHEA 3NTGA 1A3PA 5I46L 3KQDL 5F1AA 2KNIA 3BT2A 2J38B 2W2PE 3QH0A 5COXA 3FBYA 2BSFA 4LORA 3CA7A 5JB9E 2WG4B 2K2SB 1Z6CA 2Y38A 2W2ME 4TGFA 2WPKE 1NZIA 2MGRA 2WPIE 3SOBB 1HT8A 1CVUA 2Y80B 1HT5A 2RHPA 2XC4L 4MMYB 1IP0A 3LN0A 3KQBL 1KIGL 1KLIL 1FE2A 3HS5A 5IKRA 3ZYJB 2D1JB 1DQBA 1L5GB 3N8YB 4Y7BB 1N7DA 1DIYA 1F7EA 4MMZB 2H9EL 2BQ6A 2VVCK 2BMGA 4OTJA 1F0RB 3CFWA 4YT6L 3TZIA 5K0HB 1LPGA 2FLRL 1G1RA 2Y81B 1AUTL 1DDXA 1C5MF 4NG9L 1IQJL 2PUQL 4ZHAB 2XC0L 3SOQA 4AQTA 3KQCL 1OB1C 4D90A 2P94L 1F0SB 4JZEL 2P95L 3NT1A 1XKAL 4ZXXL 1O5DL 2FD6A 1NFWB 4JZFL 2VVVL 1JV2B 2AYLA 2Y7ZB 1F7MA 2XBYL 2Y7XB 2P3TA 2WZPP 2WPJE 4ZAEB 4Z6AL 2YGPA 1B9WA 3DEMA 4O1ZA 5F19A 2BO2A 1U67A 3F6UL 5CKQA 4A7IA 1G2MB 1U8CB 4E1GA 3HO3A 5JB8E 1G2LB 2EI6B 3Q7DA 1LK9A 2Y82B 4Y79B 1NQLB 3U73A 5L2ZL 4BXWA 2XC5L 5JBBE 2NPRA 3LC3B 2BOUA 4X8SL 3CENL 4M10A 4RRWA 4RUTA 2BT8A 2H9EC 3N8VA 3ZYIB 2VVUL 3NTBA 1ATDA 3MDLA 5IKTA 3LN1A 2OYUP 2VWNL 3F1SB 1IQEL 1XFEA 4D0EA 3OLUA 1EPHA 4G1MB 1IQML 3K9XA 1UZQA 3POYA 2WPHE 1FAKL 1UZPA 2VWOL 3ENSA 2XBXL 3N8ZA 3OLTA 2WYJB 4YT7L 4NA9L 1IQNL 3M36L 1CEJA 4CUFA 2HOXA 2W2QE 2BQWA 2J2UB 3N8WA 1PXXA 2BT7A 2J34B 5KN5C 3V64C 1ATBA 4Y71B 2P16L 4PH9A 3QCWA 1IGZA 1X7AL 3NJPC 2XBVL 1IOXA 2UWLB 1YUFA 1LMJA 3ELAL 1HZ8A 1TLEA 2JKHL 1HRFA 4RRZA 4RRXA 3TBDA 3LTGD 4M11A 5JBAE 1M1XB 3IITB 1QIUA 1FJSL 3C9AC 3KRKA 1ATAA 2PHBB 3TH3L 5JW1A 3MQEA 2P28B 1EZQB 3GCWE 5L2YL 1EBVA 1EMNA 2JJLA 4A94C 4BXSA 5KIRA 1EPGA 1HX2A 3RR3A 1YGCL 1G1SA 3ASIA 1IVOC 4O02B 1CVWL 1WHFA 1IJQA 1EMOA 2FZZL 2DDUA 2CJIB 2MHPA 4X8UL 1EQHA 1IQHL 1N1IA 3HS7A 4ISIL 1IQLL 5FDQA 1P9JA 2I9BA 4RRYA 4FM5A 3M37L 2PR3B 1V3XB 4XBMA 4XL1A 2KB9A 1HAEA 3CS7L 1IOEL 2W3KB 1EQGA 1IQGL 1SZBA 1Z6EL 5JBCE 3HS6A 4JZDL 2YGQA 1TOZA 2J94B 4BTTA 1ATEA 1IQFL 3V65B 1FSBA 2I9AA 1G1TA 3KK6A 5CKMA 3ZYGA 2BOHA 2VJ3A 1LMMA 1EPJA 2P26A 2VH6B 1K37A 2W3IB 1V1HA 1J9CL 3KQEL 1NFXB 2BOXA 1IGXA 2WPLE 1KLOA 1URKA 1XDTR 2J95B 3QMOA 3GISX 1CCVA 2P3FL 3LAQA 1YUGA 1ZAQA 2K2TA 2VRSA 5IKVA 3SW2A 1EGFA 3N8XA 1COUA 1L3YA 2TGFA 3U7UG 1W8BL 1PFXL 1EAIC 2W86A 1PGEA 4GU4A 1XKBA
chains in the Genus database with same CATH topology
1MOXC 2YGOA 5E8DA 2MGPA 5L30L 2XBWL 2M74A 1LPZA 3KCGL 4YZUB 1BF9A 2P3UA 5JVZA 1PTHA 1K36A 4D0FA 1DX5I 5EGMB 3TK5B 1JBUL 1W7XL 4JYUL 2W2NE 1APOA 3N8WB 2P3FN 2WYGB 3N8YA 3PGHA 5IKQA 1RFNB 3GCXE 3P5BL 2P93L 2UWPB 1UZJA 4ISHL 3KL6B 4Z0LA 3BPSE 3HPTA 2VWLL 1LPKA 1CX2A 1WU1B 4X8VL 2WFTA 4COXA 2G00L 2KL7A 2B7DL 4CSYA 5JVYA 3TGFA 2Q1JB 2WFXB 2VH0B 2WG3C 4OTYA 4ZH8B 1GK5A 3SOVA 2BZ6L 2RNLA 1MQ6L 3LIWB 4BTUA 4C16A 3BT1A 1P0SL 1APQA 3LTFB 5CISA 3TK6B 3H5CB 1Q4GA 3EGFA 1YUKB 2W2OE 2EI8B 1DVAL 3HO5A 4CUDA 3Q3KB 3IJEB 2W26B 5CKNA 1EPIA 2EI7B 1NPEB 4BTIA 1ADXA 4Y7AB 2FLBL 1KSNB 3FFGL 1TPGA 2BQ7A 2UWOB 1UZKA 2WPME 2BOKL 2Y5GL 1PRHA 4BDWA 1FFMA 2J4IB 4RS0A 1MQ5L 1HAFA 1YO8A 4LMFA 1IQKL 1QFKL 1NFYB 1JL9A 4XLWA 1HREA 1CQEA 2Y5HL 4CUEA 4BDXA 2RA0L 1KLJL 4JYVL 1FF7A 3HO4A 2ADXA 1NFUB 1HCGB 2Y5FL 4X8TL 2VWMK 3FCSB 1CCFA 2OYEP 3R05A 1HJ7A 3LC5B 2FLGA 4ZXYL 1IQIL 4NGAL 4Z0KB 4Y76B 1G1QA 2F9BL 1LQDA 1NT0A 3S6XA 1I0UA 2GD4A 4Y6DB 1FAXL 2KV4A 6COXA 4MMXB 1WHEA 3NTGA 1A3PA 5I46L 3KQDL 5F1AA 2KNIA 3BT2A 2J38B 2W2PE 3QH0A 5COXA 3FBYA 4LORA 3CA7A 5JB9E 2WG4B 2K2SB 1Z6CA 2Y38A 2W2ME 4TGFA 2WPKE 1NZIA 2MGRA 2WPIE 3SOBB 1HT8A 1CVUA 2Y80B 1HT5A 2RHPA 2XC4L 4MMYB 1IP0A 3LN0A 3KQBL 1KIGL 1KLIL 1FE2A 3HS5A 5IKRA 3ZYJB 2D1JB 1DQBA 1L5GB 3N8YB 4Y7BB 1N7DA 1DIYA 1F7EA 4MMZB 2H9EL 2BQ6A 2VVCK 2BMGA 4OTJA 1F0RB 3CFWA 4YT6L 3TZIA 5K0HB 1LPGA 2FLRL 1G1RA 2Y81B 1AUTL 1DDXA 1C5MF 4NG9L 1IQJL 2PUQL 4ZHAB 2XC0L 3SOQA 4AQTA 3KQCL 1OB1C 4D90A 2P94L 1F0SB 4JZEL 2P95L 3NT1A 1XKAL 4ZXXL 1O5DL 2FD6A 1NFWB 4JZFL 2VVVL 1JV2B 2AYLA 2Y7ZB 1F7MA 2XBYL 2Y7XB 2P3TA 2WZPP 2WPJE 4ZAEB 4Z6AL 2YGPA 1B9WA 3DEMA 4O1ZA 5F19A 2BO2A 1U67A 3F6UL 5CKQA 4A7IA 1G2MB 1U8CB 4E1GA 3HO3A 5JB8E 1G2LB 2EI6B 3Q7DA 2Y82B 4Y79B 1NQLB 3U73A 5L2ZL 4BXWA 2XC5L 5JBBE 2NPRA 3LC3B 2BOUA 4X8SL 3CENL 4M10A 4RRWA 4RUTA 2H9EC 3N8VA 3ZYIB 2VVUL 3NTBA 1ATDA 3MDLA 5IKTA 3LN1A 2OYUP 2VWNL 3F1SB 1IQEL 1XFEA 4D0EA 3OLUA 1EPHA 4G1MB 1IQML 3K9XA 1UZQA 3POYA 2WPHE 1FAKL 1UZPA 2VWOL 3ENSA 2XBXL 3N8ZA 3OLTA 2WYJB 4YT7L 4NA9L 1IQNL 3M36L 1CEJA 4CUFA 2W2QE 2BQWA 2J2UB 3N8WA 1PXXA 2J34B 5KN5C 3V64C 1ATBA 4Y71B 2P16L 4PH9A 3QCWA 1IGZA 1X7AL 3NJPC 2XBVL 1IOXA 2UWLB 1YUFA 1LMJA 3ELAL 1HZ8A 1TLEA 2JKHL 1HRFA 4RRZA 4RRXA 3TBDA 3LTGD 4M11A 5JBAE 1M1XB 3IITB 1FJSL 3C9AC 3KRKA 1ATAA 2PHBB 3TH3L 5JW1A 3MQEA 2P28B 1EZQB 3GCWE 5L2YL 1EBVA 1EMNA 4A94C 4BXSA 5KIRA 1EPGA 1HX2A 3RR3A 1YGCL 1G1SA 3ASIA 1IVOC 4O02B 1CVWL 1WHFA 1IJQA 1EMOA 2FZZL 2DDUA 2CJIB 2MHPA 4X8UL 1EQHA 1IQHL 1N1IA 3HS7A 4ISIL 1IQLL 5FDQA 1P9JA 2I9BA 4RRYA 4FM5A 3M37L 2PR3B 1V3XB 4XBMA 4XL1A 2KB9A 1HAEA 3CS7L 1IOEL 2W3KB 1EQGA 1IQGL 1SZBA 1Z6EL 5JBCE 3HS6A 4JZDL 2YGQA 1TOZA 2J94B 4BTTA 1ATEA 1IQFL 3V65B 1FSBA 2I9AA 1G1TA 3KK6A 5CKMA 3ZYGA 2BOHA 2VJ3A 1LMMA 1EPJA 2P26A 2VH6B 1K37A 2W3IB 1J9CL 3KQEL 1NFXB 2BOXA 1IGXA 2WPLE 1KLOA 1URKA 1XDTR 2J95B 3QMOA 3GISX 1CCVA 2P3FL 3LAQA 1YUGA 1ZAQA 2K2TA 5IKVA 3SW2A 1EGFA 3N8XA 1COUA 1L3YA 2TGFA 3U7UG 1W8BL 1PFXL 1EAIC 2W86A 1PGEA 1XKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOX C;  2YGO A;  5E8D A;  2MGP A;  5L30 L;  2XBW L;  2M74 A;  1LPZ A;  3KCG L;  4YZU B;  1BF9 A;  2P3U A;  5JVZ A;  1PTH A;  1K36 A;  4D0F A;  1DX5 I;  5EGM B;  3TK5 B;  1JBU L;  1W7X L;  4JYU L;  2W2N E;  1APO A;  3N8W B;  2P3F N;  2WYG B;  3N8Y A;  3PGH A;  5IKQ A;  1RFN B;  3GCX E;  3P5B L;  2P93 L;  2UWP B;  1UZJ A;  4ISH L;  3KL6 B;  4Z0L A;  3BPS E;  3HPT A;  2VWL L;  1LPK A;  1CX2 A;  1WU1 B;  4X8V L;  2WFT A;  4COX A;  2G00 L;  2KL7 A;  2B7D L;  4CSY A;  5JVY A;  3TGF A;  2Q1J B;  2WFX B;  2VH0 B;  2WG3 C;  4OTY A;  4ZH8 B;  1GK5 A;  3SOV A;  2BZ6 L;  2RNL A;  1MQ6 L;  3LIW B;  4BTU A;  4C16 A;  3BT1 A;  1P0S L;  1APQ A;  3LTF B;  5CIS A;  3TK6 B;  3H5C B;  1Q4G A;  3EGF A;  1YUK B;  2W2O E;  2EI8 B;  1DVA L;  3HO5 A;  4CUD A;  3Q3K B;  3IJE B;  2W26 B;  5CKN A;  1EPI A;  2EI7 B;  1NPE B;  4BTI A;  1ADX A;  4Y7A B;  2FLB L;  1KSN B;  3FFG L;  1TPG A;  2BQ7 A;  2UWO B;  1UZK A;  2WPM E;  2BOK L;  2Y5G L;  1PRH A;  4BDW A;  1FFM A;  2J4I B;  4RS0 A;  1MQ5 L;  1HAF A;  1YO8 A;  4LMF A;  1IQK L;  1QFK L;  1NFY B;  1JL9 A;  4XLW A;  1HRE A;  1CQE A;  2Y5H L;  4CUE A;  4BDX A;  2RA0 L;  1KLJ L;  4JYV L;  1FF7 A;  3HO4 A;  2ADX A;  1NFU B;  1HCG B;  2Y5F L;  4X8T L;  2VWM K;  3FCS B;  1CCF A;  2OYE P;  3R05 A;  1HJ7 A;  3LC5 B;  2FLG A;  4ZXY L;  1IQI L;  4NGA L;  4Z0K B;  4Y76 B;  1G1Q A;  2F9B L;  1LQD A;  1NT0 A;  1I0U A;  2GD4 A;  4Y6D B;  1FAX L;  2KV4 A;  6COX A;  4MMX B;  1WHE A;  3NTG A;  1A3P A;  5I46 L;  3KQD L;  5F1A A;  3BT2 A;  2J38 B;  2W2P E;  3QH0 A;  5COX A;  3FBY A;  4LOR A;  3CA7 A;  5JB9 E;  2WG4 B;  2K2S B;  1Z6C A;  2Y38 A;  2W2M E;  4TGF A;  2WPK E;  1NZI A;  2MGR A;  2WPI E;  3SOB B;  1HT8 A;  1CVU A;  2Y80 B;  1HT5 A;  2RHP A;  2XC4 L;  4MMY B;  1IP0 A;  3LN0 A;  3KQB L;  1KIG L;  1KLI L;  1FE2 A;  3HS5 A;  5IKR A;  3ZYJ B;  2D1J B;  1DQB A;  1L5G B;  3N8Y B;  4Y7B B;  1N7D A;  1DIY A;  1F7E A;  4MMZ B;  2H9E L;  2BQ6 A;  2VVC K;  2BMG A;  4OTJ A;  1F0R B;  3CFW A;  4YT6 L;  3TZI A;  5K0H B;  1LPG A;  2FLR L;  1G1R A;  2Y81 B;  1AUT L;  1DDX A;  1C5M F;  4NG9 L;  1IQJ L;  2PUQ L;  4ZHA B;  2XC0 L;  3SOQ A;  4AQT A;  3KQC L;  1OB1 C;  4D90 A;  2P94 L;  1F0S B;  4JZE L;  2P95 L;  3NT1 A;  1XKA L;  4ZXX L;  1O5D L;  2FD6 A;  1NFW B;  4JZF L;  2VVV L;  1JV2 B;  2AYL A;  2Y7Z B;  1F7M A;  2XBY L;  2Y7X B;  2P3T A;  2WPJ E;  4ZAE B;  4Z6A L;  2YGP A;  1B9W A;  3DEM A;  4O1Z A;  5F19 A;  2BO2 A;  1U67 A;  3F6U L;  5CKQ A;  4A7I A;  1G2M B;  1U8C B;  4E1G A;  3HO3 A;  5JB8 E;  1G2L B;  2EI6 B;  3Q7D A;  2Y82 B;  4Y79 B;  1NQL B;  3U73 A;  5L2Z L;  4BXW A;  2XC5 L;  5JBB E;  2NPR A;  3LC3 B;  2BOU A;  4X8S L;  3CEN L;  4M10 A;  4RRW A;  4RUT A;  3N8V A;  3ZYI B;  2VVU L;  3NTB A;  1ATD A;  3MDL A;  5IKT A;  3LN1 A;  2OYU P;  2VWN L;  3F1S B;  1IQE L;  1XFE A;  4D0E A;  3OLU A;  1EPH A;  4G1M B;  1IQM L;  3K9X A;  1UZQ A;  3POY A;  2WPH E;  1FAK L;  1UZP A;  2VWO L;  3ENS A;  2XBX L;  3N8Z A;  3OLT A;  2WYJ B;  4YT7 L;  4NA9 L;  1IQN L;  3M36 L;  1CEJ A;  4CUF A;  2W2Q E;  2BQW A;  2J2U B;  3N8W A;  1PXX A;  2J34 B;  5KN5 C;  3V64 C;  1ATB A;  4Y71 B;  2P16 L;  4PH9 A;  3QCW A;  1IGZ A;  1X7A L;  3NJP C;  2XBV L;  1IOX A;  2UWL B;  1YUF A;  1LMJ A;  3ELA L;  1HZ8 A;  1TLE A;  2JKH L;  1HRF A;  4RRZ A;  4RRX A;  3TBD A;  3LTG D;  4M11 A;  5JBA E;  1M1X B;  3IIT B;  1FJS L;  3C9A C;  3KRK A;  1ATA A;  2PHB B;  3TH3 L;  5JW1 A;  3MQE A;  2P28 B;  1EZQ B;  3GCW E;  5L2Y L;  1EBV A;  1EMN A;  4BXS A;  5KIR A;  1EPG A;  1HX2 A;  3RR3 A;  1YGC L;  1G1S A;  3ASI A;  1IVO C;  4O02 B;  1CVW L;  1WHF A;  1IJQ A;  1EMO A;  2FZZ L;  2DDU A;  2CJI B;  2MHP A;  4X8U L;  1EQH A;  1IQH L;  1N1I A;  3HS7 A;  4ISI L;  1IQL L;  5FDQ A;  1P9J A;  2I9B A;  4RRY A;  4FM5 A;  3M37 L;  2PR3 B;  1V3X B;  4XBM A;  4XL1 A;  2KB9 A;  1HAE A;  3CS7 L;  1IOE L;  2W3K B;  1EQG A;  1IQG L;  1SZB A;  1Z6E L;  5JBC E;  3HS6 A;  4JZD L;  1TOZ A;  2J94 B;  4BTT A;  1ATE A;  1IQF L;  3V65 B;  1FSB A;  2I9A A;  1G1T A;  3KK6 A;  5CKM A;  3ZYG A;  2BOH A;  2VJ3 A;  1EPJ A;  2P26 A;  2VH6 B;  1K37 A;  2W3I B;  1J9C L;  3KQE L;  1NFX B;  2BOX A;  1IGX A;  2WPL E;  1KLO A;  1URK A;  1XDT R;  2J95 B;  3QMO A;  3GIS X;  1CCV A;  2P3F L;  3LAQ A;  1YUG A;  1ZAQ A;  2K2T A;  5IKV A;  3SW2 A;  1EGF A;  3N8X A;  1COU A;  1L3Y A;  2TGF A;  3U7U G;  1W8B L;  1PFX L;  1EAI C;  2W86 A;  1PGE A;  1XKB A; 
#chains in the Genus database with same CATH topology
 1MOX C;  2YGO A;  5E8D A;  2MGP A;  5L30 L;  2XBW L;  2M74 A;  1LPZ A;  3KCG L;  4YZU B;  1BF9 A;  4GU3 A;  2P3U A;  5JVZ A;  1PTH A;  1K36 A;  4D0F A;  1DX5 I;  5EGM B;  3TK5 B;  1JBU L;  1W7X L;  4JYU L;  2W2N E;  1APO A;  3N8W B;  2P3F N;  2WYG B;  3N8Y A;  3PGH A;  5IKQ A;  1RFN B;  3GCX E;  3P5B L;  2P93 L;  2UWP B;  1UZJ A;  4ISH L;  3KL6 B;  4Z0L A;  3BPS E;  3HPT A;  2VWL L;  1KKE A;  1LPK A;  1CX2 A;  1WU1 B;  4X8V L;  2WFT A;  4COX A;  2G00 L;  2HOR A;  2KL7 A;  2B7D L;  4CSY A;  5JVY A;  3TGF A;  2Q1J B;  2WFX B;  2VH0 B;  2WG3 C;  4OTY A;  4ZH8 B;  1GK5 A;  3SOV A;  2BZ6 L;  2RNL A;  1MQ6 L;  3LIW B;  4BTU A;  4C16 A;  3BT1 A;  1P0S L;  1APQ A;  3LTF B;  5CIS A;  3TK6 B;  3H5C B;  1Q4G A;  3EGF A;  1YUK B;  2W2O E;  2EI8 B;  1DVA L;  3HO5 A;  4CUD A;  3Q3K B;  3IJE B;  2W26 B;  5CKN A;  1EPI A;  2EI7 B;  1NPE B;  4BTI A;  1ADX A;  4Y7A B;  2FLB L;  1KSN B;  3FFG L;  1TPG A;  2BQ7 A;  2UWO B;  1UZK A;  2WPM E;  2BOK L;  2Y5G L;  1PRH A;  4BDW A;  1FFM A;  2J4I B;  4RS0 A;  1MQ5 L;  1HAF A;  1YO8 A;  4LMF A;  1IQK L;  1QFK L;  1NFY B;  1JL9 A;  4XLW A;  1V1I A;  1HRE A;  1CQE A;  2Y5H L;  4CUE A;  4BDX A;  2RA0 L;  1KLJ L;  4JYV L;  1FF7 A;  3HO4 A;  2ADX A;  1NFU B;  1HCG B;  2Y5F L;  4X8T L;  2VWM K;  3FCS B;  1CCF A;  2OYE P;  3R05 A;  1HJ7 A;  3LC5 B;  2FLG A;  4ZXY L;  1IQI L;  4NGA L;  4Z0K B;  4Y76 B;  1G1Q A;  2F9B L;  1LQD A;  1NT0 A;  3S6X A;  1I0U A;  2GD4 A;  4Y6D B;  1FAX L;  2KV4 A;  6COX A;  4MMX B;  1WHE A;  3NTG A;  1A3P A;  5I46 L;  3KQD L;  5F1A A;  2KNI A;  3BT2 A;  2J38 B;  2W2P E;  3QH0 A;  5COX A;  3FBY A;  2BSF A;  4LOR A;  3CA7 A;  5JB9 E;  2WG4 B;  2K2S B;  1Z6C A;  2Y38 A;  2W2M E;  4TGF A;  2WPK E;  1NZI A;  2MGR A;  2WPI E;  3SOB B;  1HT8 A;  1CVU A;  2Y80 B;  1HT5 A;  2RHP A;  2XC4 L;  4MMY B;  1IP0 A;  3LN0 A;  3KQB L;  1KIG L;  1KLI L;  1FE2 A;  3HS5 A;  5IKR A;  3ZYJ B;  2D1J B;  1DQB A;  1L5G B;  3N8Y B;  4Y7B B;  1N7D A;  1DIY A;  1F7E A;  4MMZ B;  2H9E L;  2BQ6 A;  2VVC K;  2BMG A;  4OTJ A;  1F0R B;  3CFW A;  4YT6 L;  3TZI A;  5K0H B;  1LPG A;  2FLR L;  1G1R A;  2Y81 B;  1AUT L;  1DDX A;  1C5M F;  4NG9 L;  1IQJ L;  2PUQ L;  4ZHA B;  2XC0 L;  3SOQ A;  4AQT A;  3KQC L;  1OB1 C;  4D90 A;  2P94 L;  1F0S B;  4JZE L;  2P95 L;  3NT1 A;  1XKA L;  4ZXX L;  1O5D L;  2FD6 A;  1NFW B;  4JZF L;  2VVV L;  1JV2 B;  2AYL A;  2Y7Z B;  1F7M A;  2XBY L;  2Y7X B;  2P3T A;  2WZP P;  2WPJ E;  4ZAE B;  4Z6A L;  2YGP A;  1B9W A;  3DEM A;  4O1Z A;  5F19 A;  2BO2 A;  1U67 A;  3F6U L;  5CKQ A;  4A7I A;  1G2M B;  1U8C B;  4E1G A;  3HO3 A;  5JB8 E;  1G2L B;  2EI6 B;  3Q7D A;  1LK9 A;  2Y82 B;  4Y79 B;  1NQL B;  3U73 A;  5L2Z L;  4BXW A;  2XC5 L;  5JBB E;  2NPR A;  3LC3 B;  2BOU A;  4X8S L;  3CEN L;  4M10 A;  4RRW A;  4RUT A;  2BT8 A;  2H9E C;  3N8V A;  3ZYI B;  2VVU L;  3NTB A;  1ATD A;  3MDL A;  5IKT A;  3LN1 A;  2OYU P;  2VWN L;  3F1S B;  1IQE L;  1XFE A;  4D0E A;  3OLU A;  1EPH A;  4G1M B;  1IQM L;  3K9X A;  1UZQ A;  3POY A;  2WPH E;  1FAK L;  1UZP A;  2VWO L;  3ENS A;  2XBX L;  3N8Z A;  3OLT A;  2WYJ B;  4YT7 L;  4NA9 L;  1IQN L;  3M36 L;  1CEJ A;  4CUF A;  2HOX A;  2W2Q E;  2BQW A;  2J2U B;  3N8W A;  1PXX A;  2BT7 A;  2J34 B;  5KN5 C;  3V64 C;  1ATB A;  4Y71 B;  2P16 L;  4PH9 A;  3QCW A;  1IGZ A;  1X7A L;  3NJP C;  2XBV L;  1IOX A;  2UWL B;  1YUF A;  1LMJ A;  3ELA L;  1HZ8 A;  1TLE A;  2JKH L;  1HRF A;  4RRZ A;  4RRX A;  3TBD A;  3LTG D;  4M11 A;  5JBA E;  1M1X B;  3IIT B;  1QIU A;  1FJS L;  3C9A C;  3KRK A;  1ATA A;  2PHB B;  3TH3 L;  5JW1 A;  3MQE A;  2P28 B;  1EZQ B;  3GCW E;  5L2Y L;  1EBV A;  1EMN A;  2JJL A;  4A94 C;  4BXS A;  5KIR A;  1EPG A;  1HX2 A;  3RR3 A;  1YGC L;  1G1S A;  3ASI A;  1IVO C;  4O02 B;  1CVW L;  1WHF A;  1IJQ A;  1EMO A;  2FZZ L;  2DDU A;  2CJI B;  2MHP A;  4X8U L;  1EQH A;  1IQH L;  1N1I A;  3HS7 A;  4ISI L;  1IQL L;  5FDQ A;  1P9J A;  2I9B A;  4RRY A;  4FM5 A;  3M37 L;  2PR3 B;  1V3X B;  4XBM A;  4XL1 A;  2KB9 A;  1HAE A;  3CS7 L;  1IOE L;  2W3K B;  1EQG A;  1IQG L;  1SZB A;  1Z6E L;  5JBC E;  3HS6 A;  4JZD L;  2YGQ A;  1TOZ A;  2J94 B;  4BTT A;  1ATE A;  1IQF L;  3V65 B;  1FSB A;  2I9A A;  1G1T A;  3KK6 A;  5CKM A;  3ZYG A;  2BOH A;  2VJ3 A;  1LMM A;  1EPJ A;  2P26 A;  2VH6 B;  1K37 A;  2W3I B;  1V1H A;  1J9C L;  3KQE L;  1NFX B;  2BOX A;  1IGX A;  2WPL E;  1KLO A;  1URK A;  1XDT R;  2J95 B;  3QMO A;  3GIS X;  1CCV A;  2P3F L;  3LAQ A;  1YUG A;  1ZAQ A;  2K2T A;  2VRS A;  5IKV A;  3SW2 A;  1EGF A;  3N8X A;  1COU A;  1L3Y A;  2TGF A;  3U7U G;  1W8B L;  1PFX L;  1EAI C;  2W86 A;  1PGE A;  4GU4 A;  1XKB A; 
#chains in the Genus database with same CATH homology
 1MOX C;  2YGO A;  5E8D A;  2MGP A;  5L30 L;  2XBW L;  2M74 A;  1LPZ A;  3KCG L;  4YZU B;  1BF9 A;  2P3U A;  5JVZ A;  1PTH A;  1K36 A;  4D0F A;  1DX5 I;  5EGM B;  3TK5 B;  1JBU L;  1W7X L;  4JYU L;  2W2N E;  1APO A;  3N8W B;  2P3F N;  2WYG B;  3N8Y A;  3PGH A;  5IKQ A;  1RFN B;  3GCX E;  3P5B L;  2P93 L;  2UWP B;  1UZJ A;  4ISH L;  3KL6 B;  4Z0L A;  3BPS E;  3HPT A;  2VWL L;  1LPK A;  1CX2 A;  1WU1 B;  4X8V L;  2WFT A;  4COX A;  2G00 L;  2KL7 A;  2B7D L;  4CSY A;  5JVY A;  3TGF A;  2Q1J B;  2WFX B;  2VH0 B;  2WG3 C;  4OTY A;  4ZH8 B;  1GK5 A;  3SOV A;  2BZ6 L;  2RNL A;  1MQ6 L;  3LIW B;  4BTU A;  4C16 A;  3BT1 A;  1P0S L;  1APQ A;  3LTF B;  5CIS A;  3TK6 B;  3H5C B;  1Q4G A;  3EGF A;  1YUK B;  2W2O E;  2EI8 B;  1DVA L;  3HO5 A;  4CUD A;  3Q3K B;  3IJE B;  2W26 B;  5CKN A;  1EPI A;  2EI7 B;  1NPE B;  4BTI A;  1ADX A;  4Y7A B;  2FLB L;  1KSN B;  3FFG L;  1TPG A;  2BQ7 A;  2UWO B;  1UZK A;  2WPM E;  2BOK L;  2Y5G L;  1PRH A;  4BDW A;  1FFM A;  2J4I B;  4RS0 A;  1MQ5 L;  1HAF A;  1YO8 A;  4LMF A;  1IQK L;  1QFK L;  1NFY B;  1JL9 A;  4XLW A;  1HRE A;  1CQE A;  2Y5H L;  4CUE A;  4BDX A;  2RA0 L;  1KLJ L;  4JYV L;  1FF7 A;  3HO4 A;  2ADX A;  1NFU B;  1HCG B;  2Y5F L;  4X8T L;  2VWM K;  3FCS B;  1CCF A;  2OYE P;  3R05 A;  1HJ7 A;  3LC5 B;  2FLG A;  4ZXY L;  1IQI L;  4NGA L;  4Z0K B;  4Y76 B;  1G1Q A;  2F9B L;  1LQD A;  1NT0 A;  3S6X A;  1I0U A;  2GD4 A;  4Y6D B;  1FAX L;  2KV4 A;  6COX A;  4MMX B;  1WHE A;  3NTG A;  1A3P A;  5I46 L;  3KQD L;  5F1A A;  2KNI A;  3BT2 A;  2J38 B;  2W2P E;  3QH0 A;  5COX A;  3FBY A;  4LOR A;  3CA7 A;  5JB9 E;  2WG4 B;  2K2S B;  1Z6C A;  2Y38 A;  2W2M E;  4TGF A;  2WPK E;  1NZI A;  2MGR A;  2WPI E;  3SOB B;  1HT8 A;  1CVU A;  2Y80 B;  1HT5 A;  2RHP A;  2XC4 L;  4MMY B;  1IP0 A;  3LN0 A;  3KQB L;  1KIG L;  1KLI L;  1FE2 A;  3HS5 A;  5IKR A;  3ZYJ B;  2D1J B;  1DQB A;  1L5G B;  3N8Y B;  4Y7B B;  1N7D A;  1DIY A;  1F7E A;  4MMZ B;  2H9E L;  2BQ6 A;  2VVC K;  2BMG A;  4OTJ A;  1F0R B;  3CFW A;  4YT6 L;  3TZI A;  5K0H B;  1LPG A;  2FLR L;  1G1R A;  2Y81 B;  1AUT L;  1DDX A;  1C5M F;  4NG9 L;  1IQJ L;  2PUQ L;  4ZHA B;  2XC0 L;  3SOQ A;  4AQT A;  3KQC L;  1OB1 C;  4D90 A;  2P94 L;  1F0S B;  4JZE L;  2P95 L;  3NT1 A;  1XKA L;  4ZXX L;  1O5D L;  2FD6 A;  1NFW B;  4JZF L;  2VVV L;  1JV2 B;  2AYL A;  2Y7Z B;  1F7M A;  2XBY L;  2Y7X B;  2P3T A;  2WZP P;  2WPJ E;  4ZAE B;  4Z6A L;  2YGP A;  1B9W A;  3DEM A;  4O1Z A;  5F19 A;  2BO2 A;  1U67 A;  3F6U L;  5CKQ A;  4A7I A;  1G2M B;  1U8C B;  4E1G A;  3HO3 A;  5JB8 E;  1G2L B;  2EI6 B;  3Q7D A;  2Y82 B;  4Y79 B;  1NQL B;  3U73 A;  5L2Z L;  4BXW A;  2XC5 L;  5JBB E;  2NPR A;  3LC3 B;  2BOU A;  4X8S L;  3CEN L;  4M10 A;  4RRW A;  4RUT A;  2H9E C;  3N8V A;  3ZYI B;  2VVU L;  3NTB A;  1ATD A;  3MDL A;  5IKT A;  3LN1 A;  2OYU P;  2VWN L;  3F1S B;  1IQE L;  1XFE A;  4D0E A;  3OLU A;  1EPH A;  4G1M B;  1IQM L;  3K9X A;  1UZQ A;  3POY A;  2WPH E;  1FAK L;  1UZP A;  2VWO L;  3ENS A;  2XBX L;  3N8Z A;  3OLT A;  2WYJ B;  4YT7 L;  4NA9 L;  1IQN L;  3M36 L;  1CEJ A;  4CUF A;  2W2Q E;  2BQW A;  2J2U B;  3N8W A;  1PXX A;  2J34 B;  5KN5 C;  3V64 C;  1ATB A;  4Y71 B;  2P16 L;  4PH9 A;  3QCW A;  1IGZ A;  1X7A L;  3NJP C;  2XBV L;  1IOX A;  2UWL B;  1YUF A;  1LMJ A;  3ELA L;  1HZ8 A;  1TLE A;  2JKH L;  1HRF A;  4RRZ A;  4RRX A;  3TBD A;  3LTG D;  4M11 A;  5JBA E;  1M1X B;  3IIT B;  1FJS L;  3C9A C;  3KRK A;  1ATA A;  2PHB B;  3TH3 L;  5JW1 A;  3MQE A;  2P28 B;  1EZQ B;  3GCW E;  5L2Y L;  1EBV A;  1EMN A;  4A94 C;  4BXS A;  5KIR A;  1EPG A;  1HX2 A;  3RR3 A;  1YGC L;  1G1S A;  3ASI A;  1IVO C;  4O02 B;  1CVW L;  1WHF A;  1IJQ A;  1EMO A;  2FZZ L;  2DDU A;  2CJI B;  2MHP A;  4X8U L;  1EQH A;  1IQH L;  1N1I A;  3HS7 A;  4ISI L;  1IQL L;  5FDQ A;  1P9J A;  2I9B A;  4RRY A;  4FM5 A;  3M37 L;  2PR3 B;  1V3X B;  4XBM A;  4XL1 A;  2KB9 A;  1HAE A;  3CS7 L;  1IOE L;  2W3K B;  1EQG A;  1IQG L;  1SZB A;  1Z6E L;  5JBC E;  3HS6 A;  4JZD L;  2YGQ A;  1TOZ A;  2J94 B;  4BTT A;  1ATE A;  1IQF L;  3V65 B;  1FSB A;  2I9A A;  1G1T A;  3KK6 A;  5CKM A;  3ZYG A;  2BOH A;  2VJ3 A;  1LMM A;  1EPJ A;  2P26 A;  2VH6 B;  1K37 A;  2W3I B;  1J9C L;  3KQE L;  1NFX B;  2BOX A;  1IGX A;  2WPL E;  1KLO A;  1URK A;  1XDT R;  2J95 B;  3QMO A;  3GIS X;  1CCV A;  2P3F L;  3LAQ A;  1YUG A;  1ZAQ A;  2K2T A;  5IKV A;  3SW2 A;  1EGF A;  3N8X A;  1COU A;  1L3Y A;  2TGF A;  3U7U G;  1W8B L;  1PFX L;  1EAI C;  2W86 A;  1PGE A;  1XKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...