1CW5A

Solution structure of carnobacteriocin b2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
b'VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IIA BACTERIOCIN CARNOBACTERIOCIN B2
publication title Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 1999-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01721 Bacteriocin_II Class II bacteriocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1cw5A00
1CW5A 1RY3A
chains in the Genus database with same CATH superfamily
4Y99C 2FBWC 3OJAB 1M56D 1URQD 2JP3A 4KHXA 2KLVA 1S9KD 2VRSA 1KB9I 2QG4A 2NPSA 2WT7B 2YIUB 1KD1Q 1QL1A 1P84I 2WITA 1LTSC 1GK4A 3VMYA 1EZVG 1JO5A 4D6TG 2N1TC 5CJ0A 3H1HD 3WU2E 3L71D 3L75G 4L74A 4GT1A 1EDJA 1J1EC 1SQXG 1NOHA 3L70D 2I1KA 4GDOA 1ZR2A 4DOJA 1VDFA 3FWLA 4N78D 3IR9A 1BDCA 3PJSK 2YKOA 2WZ7A 3AE4C 3RL0C 3B71A 2PFXA 4D6TJ 3VMZA 3RK2C 1FZAA 4WY4B 2NZ2A 1JY2O 4AUWA 1AVOA 3T97A 2HFED 2FYNC 2OYOA 3B5NC 4WY4A 4HYTB 3L75J 3TNUB 1SQXJ 2ZT9B 3GLMA 1N7LA 3TGUG 1KN7A 1S1CX 1N2DC 1DX7A 4GOFA 1IFDA 2KOGA 1SFCC 1VQOP 1SQVG 1RQVA 2POHA 2BEQD 3G9RA 2WPRA 2WSCJ 3CXHH 2Z5HA 1UIXA 2W90A 3G6EP 3D71A 2P7JA 2E5TA 5KLVD 1K9MQ 1RF0C 1PGPA 1Q7YQ 2KZIA 3TGUJ 1RF1A 2K3RA 3WUUA 4EYYQ 1HJ0A 5L8RJ 5KAFH 4PJ0H 1FU1A 2NPSD 5C39A 1L0ND 1SQVJ 1SQBG 1NU1G 1VQLP 1SQQD 1N7SA 3BCCD 4H44D 1Q2NA 2PAJA 2LXCB 5H2FE 1OWAA 2HPCB 2JJLA 2E74D 4RO0A 4RESB 3RK3B 1L4AB 1JY2N 1PP9E 1S4XA 1VQMP 3E7KA 5AW6B 1ZP0C 3S4RA 3M9QA 1OW8A 5AW7B 3D6ZA 1M57D 2ZXXA 1KB9D 1SQBJ 3U1AA 1AVYA 1NU1J 4H13D 3L4FA 5CCGC 2E75D 3CPWO 1Q81Q 4Y99B 2E43A 1VF5C 2YXRB 3CX5H 3HD7B 5KKZC 4XE5B 1EDIA 1BDDA 1FAVA 2QSIA 2Q7CA 1SQXK 3VTPC 2WWWA 2JWDA 4DCKA 3CD6P 4LGDE 1CI6A 4IFMA 1Q82Q 3A2AA 2WMMA 2N1TA 1GL2B 3L35A 3FWNA 1HH0A 1G2CA 2Y9YA 1T3UA 2W6BA 1VQ4P 2IPPA 2IZ1A 2W8ZA 3RL0B 3RK2B 1YQ4C 2AEMA 3CCRP 1KZUB 3H1JE 1SQVK 2NRGA 2IBZE 3M06A 1LWUC 3P7KA 4PD4I 2D2CB 3B5NA 2J5UA 2KIKA 3Q2YA 1OVUA 1SFCB 1PPJG 1JB0J 1DD3A 2RH0A 2ZFCA 2JDIH 1SFCA 3GMAA 1IFNA 1M7LA 2W27A 2W83C 1BE3G 4H0LD 2HYNA 2FXMA 1SQBK 1IO4A 2BCCJ 2M3BA 1JEKA 2B88A 1PIXA 1CW5A 2M0BA 1RF0A 3CC7P 3W68A 4C7RA 3MIWA 2BEZF 2J58A 1OW6A 4D6TE 1L2PA 1FBMA 1HUCA 2ZXEB 1FJKA 5KTBA 3L75E 4I7ZB 3CXHI 1L0LG 1YTZT 1BE3J 4UB6H 1KTMA 1SQXE 2I1JA 3M9HA 1CSBA 2CPSA 2N1TD 2SPZA 5AW9B 3H1LD 2E5YA 3KDPB 3CWBG 4WWIA 4WB4A 5B66H 3CMEP 3LIDA 3M0DC 3AE2C 3BRVB 2A45I 3R2PA 5GTHH 1FZCB 1PP9D 2KS1B 1JY3O 3QWOC 1W5CE 2KNCB 2KS1A 3O6QB 3TDKA 1JTHA 3NMDA 1L0LJ 1VF5B 4JYCA 4BRYB 5CCGA 5KKZB 4N3YB 2KNCA 3TGUE 2YIUC 4BWNA 5AVZB 2C9NY 3O6QA 4IFDK 3OW2O 4RKUJ 3H1IG 2R5DA 3CX5E 3CWBJ 1SQVE 3WU2H 3B5ND 3AE3C 2QJKC 1PGQA 3H6PA 1DEEG 1QEXA 1KILB 5KJ7D 4GIFA 5AVRB 3H1KE 5DJTB 2AEFA 1PFIA 1LTBC 1M90Q 1JM0A 4W80A 4ZNCA 1X22A 2WPQA 3Q5PA 1OX3A 4GOEA 3V5BA 3L73G 1BCCG 1WMKA 3H1IJ 2H88C 2JR8A 3V4WA 3SFDC 2PGDA 1YTZI 1GMJA 4GKGA 1SQBE 1NU1E 2WSEH 1AQ5A 1JOCA 1YBKA 5AW0B 1LWUB 5CBNA 1YIJP 4W7ZA 1FDIA 2GM4A 3HE5B 3H1JD 3G4SP 1JY3N 1LWUA 2IBZD 2OGUA 3I5CA 3L73J 1BCCJ 1OVVA 3HE5A 2O01J 3G3ZA 1KORA 1CZQA 4TLFA 1NWQA 2FYUG 3AEFC 2WQYC 1NAYA 1N8RQ 2XNXA 3AEEC 4UB8H 5APTA 2IX7C 3C8VA 2ZYGA 2RKLA 4NPFX 5CJ4A 3A0BE 2K9YA 1KFMA 4K3AA 1FDOA 1LGHB 1VQ6P 1SQPG 1EZVD 3OA7A 2XNDH 2FYUJ 4D6TD 1TU3F 2O01H 3VMXA 1NGMB 3RK3C 1T2KD 1L4AC 1ZOYC 1G1IA 1X79B 1JUNA 2K9JB 3L75D 3MP7B 3R4YA 4JYBA 1SQXD 3A3YB 3H32B 1NJIQ 2WPVB 1RY3A 3M0DA 2DW3A 5GTHE 1SQPJ 2Q9IA 1AA0A 3HD7C 1LJ2A 2FKWB 2BCCE 1Q90D 4M3LA 2I8DA 1NAFA 1Q86Q 1X0TA 1Y9BA 3AEGC 1HGVA 2B9BA 1LTJC 2WT7A 1PPJE 1YJWP 3TGUD 2QJKB 4JPZB 1HTLC 1YQ3C 3CX5D 2JEEA 1IFIA 4H44B 1SQVD 1ZV8A 2E42A 1BE3E 3C9IA 1GL2C 2Q3IA 2N9BA 1BGYG 2RN0A 2P58A 3FXDA 1LT9B 1VQNP 4ZKPA 2E76B 3CCLP 2BASA 3S9OA 1NH4A 3A0HH 3AE9C 2YO2A 2Y9ZA 2R3SA 1L0LE 1SQBD 4OGQC 1FZBA 1DH3A 3L72G 3CC2P 1S5LX 5TJHA 2D2CC 1FOSE 1BGYJ 5E79H 3TNUA 3RK3E 3CWBE 1PL5A 3F5HA 2OYIB 1EC5A 1NTKG 4OH8B 3H25A 1NTZE 4AYCA 2MKVA 2WVRA 3H1KG 2ITAA 1NYHA 1FZFA 2W6JH 2IFMA 1PGOA 1NVOA 2QVAA 1HGZA 1M1KQ 3B8EB 3L72J 4MN4C 1LTGC 3L70G 1YJ9P 1VQ9P 1SQPK 2Z4EA 3H1IE 3L36A 1M1JC 4UB8E 3F89A 1NTKJ 4RJTA 4O9BA 4R4MA 1M8OB 2XV5A 2O1JA 1LTAC 2Y0CA 4I7ZC 2RMZA 1IC2A 3H1HJ 1WT6A 3H1KJ 1ZN5A 3MUDC 1A02F 3L71J 3GW6A 4YPCA 2WSCH 3FX0A 1QL2A 2P67A 3L70J 2HPCA 3EFGA 3L73E 4LC1A 1BCCE 1L4AA 3B4SA 1FZCC 3M0AA 1GD2E 5KLIC 3JSVC 3KHUA 4EOTA 1RQUA 3RBZA 3KXDA 3HTKB 3NTNA 3V2NA 1YJNP 5AW4B 4HKZH 4WY4D 3HD7A 3MGNA 3AEDC 1LTJB 5CCHC 1FJPA 1GDTA 3P8CE 2ZT9D 3GF7A 3W67A 1KILC 3FGAD 1KFNA 1LTJA 1U7JA 2FYUE 3BCCG 1KC8Q 3GG2A 3SFEC 2PP6A 3TF5A 2HLOA 3PH0A 3ZDMA 5KLVJ 1GL2A 1ZRTE 1BE3D 1IJDB 1KQGB 2OYHB 2Q6QA 2OTJP 5CHXA 2L5GB 4GODA 4PD4E 2Q1KA 2XU6A 3VN0A 4C46A 2WSFJ 1SQPE 4PV1B 3AE8C 4OGQB 1NTKK 3BCCJ 1N7SD 1PV3A 3NFQA 2BCCG 3A0HE 4L76A 1FC2C 1KYOH 4TT3H 3ABVC 4R4LA 1MV8A 1LT1A 5AVYB 2M8RA 1J1DC 3BRTB 2OTLP 1JNMA 5E79E 2WSSH 3E1RA 2O3JA 3RK3D 1L4AD 3CWBD 3P32A 2IBZI 3JCUH 1JY3P 3A0BH 1NU1K 1KQSO 1HJBA 1H0TB 4HJGH 2IFNA 2YO3A 1HF9A 2YXQB 1M1JB 2P10A 2WSFH 3SWFA 3AE1C 3HD7D 2B87B 1M1JA 1JMMA 3LW5J 3S1KA 2ZJSE 1GW3A 1KILE 3EWKA 2B87A 5APVA 2FXPA 4U3FG 1U57A 4OVNF 1BGYE 2YKQA 1DD4A 2IZ0A 3MUDA 1N73B 5K5GB 4YXDC 1EZVI 3SWYA 1GL2D 3TK1A 1HVVA 4C7NB 1P84H 1NTZG 2R3CA 1H89A 1NKZB 4I6MC 5KLIB 3L73D 1S72P 3KYQA 1AV1A 1S5LH 1FZCA 2K88A 2Q5UA 1RH5B 1VQ7P 4N6JA 1IFPA 2YKPA 3L72E 5AVUB 4U3FJ 3CCQP 3RL0D 3RK2D 3KZIH 1VQ5P 3GHGB 1N86A 1OXZA 3LW5H 4BRYA 2J59M 1YI2P 1KQFB 1NTKE 1T3JA 1FZGA 1NTZJ 2OQQA 2D2CD 5CCHA 4YXWH 4H44C 1ZLLA 3H1HE 1EDLA 1RE3C 1KILA 1SFCD 3CCUP 1USEA 2JWAA 3L71E 3Q3DA 1X8YA 4EI2A 5KAIH 2A06G 2H8PD 3L70E 1LT9C 1BSNA 3CX5I 2L91A 3L74G 3H1LG 3V2RA 2E76C 2JKVA 3SSUA 5AVQB 4N78E 1ZRTD 3U1CA 4H13C 1AQTA 2R5BA 2G3AA 2P1JA 1URQB 2M3EA 1MUUA 1SQPD 3K5BA 5APXA 4WBAA 1BSHA 3L74J 3H1LJ 2OYIC 4K35A 3CC4P 1KYOE 2LR2A 1J1DB 1EXIA 4LLHA 1VQKP 2ZYDA 3CMAP 2XZRA 1QVGO 3HUSC 3WMM0 2ZVNB 1VPCA 2FFDB 1T8ZA 5KLVE 1OFCX 3JCUE 1L0LK 5CCGD 1SP4A 1LP1B 2QEXP 3NXSA 1VF5D 3ITKA 1DEBA 1L0NE 1IK9A 5APWA 2Z5IA 4QMAA 2YMYA 1K04A 3BCCE 1OW7A 2LKMA 2KZJA 1NTZK 5CCHD 1SLQA 5TISH 2CPBA 3LIEA 1OMIA 2B89A 1KILD 1R5SA 3MZWB 1H8AA 2CK3H 4OWFA 3CCSP 2K9JA 1K73Q 1BGYD 2K37A 2PRRA 1QVFO 2AEJA 3IAOA 3H32A 5AW1B 3D70A 3N7NA 1KB9E 2Y0EA 1JY2P 3AEBC 1P84E 4L75A 4H0LC 1S2EA 3A5TA 2KLUA 4EIJA 1S5LE 3PP5A 2UWJE 2NPSB 4ZKUA 3KZIE 1OIPA 3CCMP 5M1BA 2YMKA 1HWTC 2AXTE 3Q5RA 1NTKD 1U7MA 5AVSB 1E5WA 2E74B 5EFWB 3AE6C 2A45G 1RE3A 1XTCC 3EFFK 3VOPA 3H1KD 2ZVOB 1QGKB 1NTMG 4PD4H 2OYHC 3I55P 5KAIE 3MD0A 1LT9A 3MTUE 1PGJA 1LTTC 4H13B 1K8AQ 2E75B 4PV1C 4HH2A 1T6AA 1Z56A 1NU1D 4U3FE 3UIAA 3T97B 5APSA 1LNQA 2KI7B 2QE7H 3PRJA 2FYUK 5CMZA 5DJUB 1HBWA 2Y0DA 1NTMJ 4ASWA 5KJ7C 2OYIA 2HR3A 2GUSA 2ZAEB 2C9LY 3H1HG 1KYOD 3HUSB 3D6YA 2QA4P 3L71G 5GTIH 3L37A 4HB1A 3MHVA 3HUSA 3CCEP 1NKNA 3VYIA 4IL6H 3V2PA 4JF7A 3JC22 5AVTB 2H89C 2QJYC 3BASA 1RF1B 2Q3EA 5CBOA 3USSA 2W6AA 4KJMA 3VMAA 3HRNA 2A45H 1MKMA 1AJYA 1J2JB 1N7SB 1A02J 2A06E 1G1JA 1YYCA 4JQ0D 1N73C 5AW8B 3L74E 3H1LE 2QJPB 5TISE 1ZMEC 2KUBA 2GA1A 1EDKA 1GK6A 1VQ8P 3V2QA 2N9YB 3FXEA 4H0LB 2YNYA 1SS1A 2E76D 1S3JA 5B5EH 3M9BA 5KLVG 2K1AA 1PZQA 3GHGC 3HTKA 1KV4A 1P84D 4ASVA 1MFTA 1KMIZ 3KPEA 3V6IA 2BCCD 1D7MA 2HG5D 1L0NG 2KK7A 1JMBA 4AQRD 2KXPB 1NTMK 1PPJD 1SQQG 2MJZA 1CI6B 3CL3D 5APYA 4BXLA 3RGUA 2N1TB 1T2KC 2GUVA 2V4HA 1ZR4A 1GTWA 4L73A 1J1EB 1Y8AA 1G2CB 2KB7P 4EDFA 2OYHA 1YITP 5APQA 1YHQP 1L0NJ 3OAKA 3RL0g 2OTKE 1SQQJ 5APUA 1IZNB 1URQC 1W2EA 5BU8B 3I56P 2FXOA 1L0LD 1LTIC 4U7JA 4U3FD 2FYNB 3BVHA 3B5NB 1X9VA 2QIWA 3U59A 2KSEA 4B86A 4XA4A 3BATA 3VP8A 4Z1MH 3RBXA 1NTZD 5KJ7A 2LXBA 2FFDC 1UIIA 5BVZA 3VP9A 5AW2B 1NHLA 1MFZA 3GF3A 2C0WA 3CCVP 5AVVB 1H0TA 1RHZB 5GTIE 1IFJA 1R5LA 1FS0E 3CXHE 2QJYB 4IL6E 2V7QJ 3AECC 1RE4C 5AW3B 3H1ID 4IOIH 1EQ7A 1EZVE 2KSJA 3N4XA 2HODB 2XDJA 3C1LA 5KAFE 4PJ0E 3M91A 1NTME 1FZEA 2C0XA 1KB9H 3IN6A 2HODA 4YTPC 5KLVK 2A06D 2ZYAA 2IYOA 1N73A 4DT0A 1W2BO 3Q5SA 1ZXGA 3L74D 1BCCD 4C7NA 2QM7A 4DJGA 1NO4A 1KQLA 3KQGA 1FE6A 1H88A 1L0NK 1XTGB 4IFFA 2V7QH 1JTHB 1S9KE 3CI9A 1SQQK 2KP8A 2WPSA 5B5EE 2IYPA 4PV1D 4W7YA 4OGQD 2NPSC 3GHGA 2AXTH 3WUTA 1GU5A 4IL6X 4JBZA 2WSEJ 3AEAC 1FOSF 1R8EA 2OARA 4ZMDA 2H43A 3P8CD 4I2LC 3CLQA 2E74C 5BU5A 2FYUD 2H7HA 2O01N 4KT0J 1GZLA 1WRGA 3PTZA 1JCDA 3V4QA 2P2UA 2FYZA 3TSIA 1PP9G 3AE5C 3G71P 2E75C 2QM8A 2R32A 3EQ2A 4PD4D 3II6A 1FDMA 2R44A 4WY4C 3HE4B 3O8ZA 1URQA 1VQPP 1AFOA 3HE4A 3PHLA 2ZT9C 3AE7C 3CCJP 3A7OA 1SVFA 1DIPA 1PP9J 1K05A 3WUVA 2G8YA 5AW5B 2KYVA 2FFDA 3PLNA 4WVZA 4NPEA 1ZW0A 1IK7A 1KYOI 4I1LA 1OVRA 3IF4A 1RF1C 4XFJA 1LP1A 2QRXA 3Q1MA 1USDA 4NPDA 3SWKA 1JCCA 1GW4A 1SQQE 3IFMA 3CXHD 1RE4A 1N7SC 3QH9A 3TYYA 1E79H 4Y28J 4DZOA 5H2FH 2JO1A 2QJPC 1Y47A 3H1JG 2IBZG 1OZHA 2O1KA 1NTMD 1VL2A 2WTYA 2IDBA 4UB6E 5AVXB 2M5AB 1MZ9A 2AXCA 2XKMA 1EXJA 1QX8A 2FY8A 2M5AA 5AVWB 4A7PA 4CPGA 1GU4A 5B66E 1QLED 3P8MC 3L72D 1IFMA 3H1JJ 3E1IA
chains in the Genus database with same CATH topology
4Y99C 1A02J 1L4AD 1G1JA 3OJAB 3P32A 3V4WA 1URQD 4KHXA 1YYCA 2KLVA 1S9KD 1YTZI 2VRSA 4GKGA 1JY3P 1N73C 5AW8B 2NPSA 2WT7B 1NU1K 1QL1A 2WITA 2WSEH 1LTSC 1HJBA 1AQ5A 1GK4A 1JOCA 3VMYA 1GK6A 1JO5A 2IFNA 5AW0B 2YO3A 3V2QA 1M1JB 2N1TC 1LWUB 2WSFH 5CJ0A 3SWFA 4W7ZA 2YNYA 2GM4A 3HD7D 3HE5B 1M1JA 1JY3N 3M9BA 4GT1A 1LWUA 1J1EC 1JMMA 3I5CA 1GW3A 1NOHA 3GHGC 3HTKA 2I1KA 3HE5A 1ZR2A 3G3ZA 5APVA 4DOJA 3KPEA 1VDFA 1CZQA 2YKQA 1NWQA 4N78D 2HG5D 3IR9A 4AQRD 3MUDA 2YKOA 2WZ7A 1N73B 3RL0C 1NTMK 3VMZA 3RK2C 1FZAA 4WY4B 3SWYA 2MJZA 1GL2D 2XNXA 3TK1A 1JY2O 1HVVA 5APTA 4C7NB 4AUWA 1CI6B 3T97A 2R3CA 2IX7C 2HFED 1H89A 1NKZB 4I6MC 3CL3D 5APYA 5CJ4A 3B5NC 4WY4A 4HYTB 3KYQA 3TNUB 2N1TB 1T2KC 1FZCA 2GUVA 1N7LA 1KFMA 2Q5UA 4N6JA 1ZR4A 1N2DC 2YKPA 5AVUB 1LGHB 1GTWA 1DX7A 3RL0D 1J1EB 1IFDA 1G2CB 2KOGA 1SFCC 3RK2D 2KB7P 3GHGB 1N86A 2OYHA 3OA7A 1OXZA 2POHA 3LW5H 5APQA 2J59M 2WPRA 2Z5HA 3OAKA 2O01H 3VMXA 3RK3C 1T2KD 1T3JA 1L4AC 1G1IA 5APUA 1X79B 2P7JA 1JUNA 1FZGA 1URQC 1W2EA 4JYBA 5CCHA 3A3YB 1RF0C 3H32B 5BU8B 1ZLLA 1RE3C 1KILA 1SFCD 1LTIC 1RF1A 3BVHA 1X8YA 1RY3A 3B5NB 1X9VA 3M0DA 3U59A 2H8PD 1FU1A 2NPSD 1LT9C 4B86A 4XA4A 3BATA 2Q9IA 3VP8A 3V2RA 3HD7C 2FKWB 1N7SA 4M3LA 5AVQB 1NAFA 5KJ7A 2FFDC 5BVZA 4N78E 3U1CA 3VP9A 2PAJA 5AW2B 1NHLA 1MFZA 1OWAA 1HGVA 2JJLA 2HPCB 2C0WA 1LTJC 2WT7A 5AVVB 4RESB 2R5BA 3RK3B 1L4AB 1JY2N 2P1JA 1IFJA 1URQB 1HTLC 5AW6B 1MUUA 2JEEA 1IFIA 3M9QA 5AW7B 1ZV8A 1RE4C 2E42A 5AW3B 3C9IA 1GL2C 5APXA 4WBAA 2Q3IA 3U1AA 2OYIC 1EQ7A 1J1DB 2N9BA 3L4FA 5CCGC 4LLHA 1LT9B 4Y99B 2E43A 2KSJA 3N4XA 2HODB 2XZRA 4ZKPA 3HD7B 2XDJA 2BASA 1NH4A 3M91A 4XE5B 3HUSC 3WMM0 1FZEA 1VPCA 2C0XA 2FFDB 1FAVA 2HODA 1T8ZA 5KLVK 2Q7CA 1SQXK 1N73A 3VTPC 2WWWA 2YO2A 1L0LK 1FZBA 5CCGD 1SP4A 4LGDE 1DH3A 4C7NA 2QM7A 1CI6A 4IFMA 3A2AA 3NXSA 1FOSE 1NO4A 1KQLA 3KQGA 3TNUA 1DEBA 2N1TA 1H88A 1IK9A 5APWA 1L0NK 1GL2B 1XTGB 2Z5IA 2YMYA 3L35A 4IFFA 2OYIB 1JTHB 1S9KE 3CI9A 1SQQK 4OH8B 2LKMA 2KP8A 2WPSA 1HH0A 1NTZK 1G2CA 4AYCA 5CCHD 1SLQA 4W7YA 1T3UA 2CPBA 2NPSC 3GHGA 3LIEA 1GU5A 2W6BA 2IPPA 1KILD 1FOSF 3RL0B 1FZFA 1H8AA 2IFMA 3RK2B 1HGZA 2OARA 3B8EB 1LTGC 2H43A 3P8CD 4I2LC 1KZUB 3CLQA 3H32A 1SQVK 1SQPK 5AW1B 5BU5A 2Z4EA 3L36A 3N7NA 3M06A 1M1JC 1LWUC 3P7KA 1JY2P 2H7HA 3A5TA 3B5NA 4O9BA 2XV5A 2O1JA 1GZLA 1LTAC 1WRGA 4EIJA 1JCDA 1SFCB 3PP5A 3V4QA 2P2UA 2FYZA 3TSIA 1IC2A 1WT6A 2ZFCA 1ZN5A 1A02F 1SFCA 1IFNA 2QM8A 2NPSB 4ZKUA 1M7LA 2R32A 2W27A 2WSCH 1QL2A 2P67A 3EQ2A 2HPCA 3II6A 3EFGA 2HYNA 4LC1A 2FXMA 1FDMA 1SQBK 1IO4A 1HWTC 4WY4C 1L4AA 3HE4B 5AVSB 2M3BA 3O8ZA 1URQA 1FZCC 1E5WA 1CW5A 3M0AA 1GD2E 1RF0A 1AFOA 3HE4A 2A45G 4C7RA 4EOTA 1RE3A 1XTCC 3MIWA 3VOPA 2J58A 3HTKB 2OYHC 3A7OA 1SVFA 1FBMA 3NTNA 1HUCA 3V2NA 3MD0A 1LT9A 5AW4B 2ZXEB 4WY4D 3MTUE 1FJKA 5KTBA 1LTTC 3HD7A 5AW5B 1YTZT 2I1JA 3MGNA 3M9HA 1LTJB 1CSBA 5CCHC 2KYVA 2FFDA 1FJPA 2CPSA 1GDTA 2N1TD 4HH2A 1Z56A 5AW9B 3KDPB 3P8CE 1KILC 3UIAA 1KFNA 4I1LA 1LTJA 4WB4A 5APSA 1RF1C 3LIDA 2FYUK 5CMZA 3M0DC 1HBWA 3BRVB 2A45I 3R2PA 1FZCB 2PP6A 1JCCA 1GW4A 2HLOA 3IFMA 1RE4A 1JY3O 1N7SC 1GL2A 1IJDB 5KJ7C 3TYYA 2OYIA 1JTHA 3NMDA 2OYHB 2GUSA 4DZOA 5CHXA 2C9LY 4JYCA 5CCGA 4N3YB 3HUSB 2L5GB 5AVZB 2C9NY 4IFDK 3L37A 2R5DA 2XU6A 3VN0A 4C46A 3HUSA 1NKNA 3VYIA 3B5ND 2O1KA 1NTKK 1N7SD 3V2PA 4JF7A 3H6PA 3NFQA 2WTYA 1KILB 5KJ7D 5AVTB 5AVXB 4GIFA 3BASA 1RF1B 1MZ9A 2XKMA 5AVRB 2W6AA 1MV8A 3HRNA 1PFIA 1LTBC 5AVWB 2A45H 5AVYB 2M8RA 1GU4A 1J1DC 3BRTB 3P8MC 1JNMA 4W80A 1J2JB 1N7SB 1IFMA 2WPQA 3V5BA 3E1IA 3RK3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CW5 A;  1RY3 A; 
#chains in the Genus database with same CATH topology
 4Y99 C;  2FBW C;  3OJA B;  1M56 D;  1URQ D;  2JP3 A;  4KHX A;  2KLV A;  1S9K D;  2VRS A;  1KB9 I;  2QG4 A;  2NPS A;  2WT7 B;  2YIU B;  1KD1 Q;  1QL1 A;  1P84 I;  2WIT A;  1LTS C;  1GK4 A;  3VMY A;  1EZV G;  1JO5 A;  4D6T G;  2N1T C;  5CJ0 A;  3H1H D;  3WU2 E;  3L71 D;  3L75 G;  4L74 A;  4GT1 A;  1EDJ A;  1J1E C;  1SQX G;  1NOH A;  3L70 D;  2I1K A;  4GDO A;  1ZR2 A;  4DOJ A;  1VDF A;  3FWL A;  4N78 D;  3IR9 A;  1BDC A;  3PJS K;  2YKO A;  2WZ7 A;  3AE4 C;  3RL0 C;  3B71 A;  2PFX A;  4D6T J;  3VMZ A;  3RK2 C;  1FZA A;  4WY4 B;  2NZ2 A;  1JY2 O;  4AUW A;  1AVO A;  3T97 A;  2HFE D;  2FYN C;  2OYO A;  3B5N C;  4WY4 A;  4HYT B;  3L75 J;  3TNU B;  1SQX J;  2ZT9 B;  3GLM A;  1N7L A;  3TGU G;  1KN7 A;  1S1C X;  1N2D C;  1DX7 A;  4GOF A;  1IFD A;  2KOG A;  1SFC C;  1VQO P;  1SQV G;  1RQV A;  2POH A;  2BEQ D;  3G9R A;  2WPR A;  2WSC J;  3CXH H;  2Z5H A;  1UIX A;  2W90 A;  3G6E P;  3D71 A;  2P7J A;  2E5T A;  5KLV D;  1K9M Q;  1RF0 C;  1PGP A;  1Q7Y Q;  2KZI A;  3TGU J;  1RF1 A;  2K3R A;  3WUU A;  4EYY Q;  1HJ0 A;  5L8R J;  5KAF H;  4PJ0 H;  1FU1 A;  2NPS D;  5C39 A;  1L0N D;  1SQV J;  1SQB G;  1NU1 G;  1VQL P;  1SQQ D;  1N7S A;  3BCC D;  4H44 D;  1Q2N A;  2PAJ A;  2LXC B;  5H2F E;  1OWA A;  2HPC B;  2JJL A;  2E74 D;  4RO0 A;  4RES B;  3RK3 B;  1L4A B;  1JY2 N;  1PP9 E;  1S4X A;  1VQM P;  3E7K A;  5AW6 B;  1ZP0 C;  3S4R A;  3M9Q A;  1OW8 A;  5AW7 B;  3D6Z A;  1M57 D;  2ZXX A;  1KB9 D;  1SQB J;  3U1A A;  1AVY A;  1NU1 J;  4H13 D;  3L4F A;  5CCG C;  2E75 D;  3CPW O;  1Q81 Q;  4Y99 B;  2E43 A;  1VF5 C;  2YXR B;  3CX5 H;  3HD7 B;  5KKZ C;  4XE5 B;  1EDI A;  1BDD A;  1FAV A;  2QSI A;  2Q7C A;  1SQX K;  3VTP C;  2WWW A;  2JWD A;  4DCK A;  3CD6 P;  4LGD E;  1CI6 A;  4IFM A;  1Q82 Q;  3A2A A;  2WMM A;  2N1T A;  1GL2 B;  3L35 A;  3FWN A;  1HH0 A;  1G2C A;  2Y9Y A;  1T3U A;  2W6B A;  1VQ4 P;  2IPP A;  2IZ1 A;  2W8Z A;  3RL0 B;  3RK2 B;  1YQ4 C;  2AEM A;  3CCR P;  1KZU B;  3H1J E;  1SQV K;  2NRG A;  2IBZ E;  3M06 A;  1LWU C;  3P7K A;  4PD4 I;  2D2C B;  3B5N A;  2J5U A;  2KIK A;  3Q2Y A;  1OVU A;  1SFC B;  1PPJ G;  1JB0 J;  1DD3 A;  2RH0 A;  2ZFC A;  2JDI H;  1SFC A;  3GMA A;  1IFN A;  1M7L A;  2W27 A;  2W83 C;  1BE3 G;  4H0L D;  2HYN A;  2FXM A;  1SQB K;  1IO4 A;  2BCC J;  2M3B A;  1JEK A;  2B88 A;  1PIX A;  1CW5 A;  2M0B A;  1RF0 A;  3CC7 P;  3W68 A;  4C7R A;  3MIW A;  2BEZ F;  2J58 A;  1OW6 A;  4D6T E;  1L2P A;  1FBM A;  1HUC A;  2ZXE B;  1FJK A;  5KTB A;  3L75 E;  4I7Z B;  3CXH I;  1L0L G;  1YTZ T;  1BE3 J;  4UB6 H;  1KTM A;  1SQX E;  2I1J A;  3M9H A;  1CSB A;  2CPS A;  2N1T D;  2SPZ A;  5AW9 B;  3H1L D;  2E5Y A;  3KDP B;  3CWB G;  4WWI A;  4WB4 A;  5B66 H;  3CME P;  3LID A;  3M0D C;  3AE2 C;  3BRV B;  2A45 I;  3R2P A;  5GTH H;  1FZC B;  1PP9 D;  2KS1 B;  1JY3 O;  3QWO C;  1W5C E;  2KNC B;  2KS1 A;  3O6Q B;  3TDK A;  1JTH A;  3NMD A;  1L0L J;  1VF5 B;  4JYC A;  4BRY B;  5CCG A;  5KKZ B;  4N3Y B;  2KNC A;  3TGU E;  2YIU C;  4BWN A;  5AVZ B;  2C9N Y;  3O6Q A;  4IFD K;  3OW2 O;  4RKU J;  3H1I G;  2R5D A;  3CX5 E;  3CWB J;  1SQV E;  3WU2 H;  3B5N D;  3AE3 C;  2QJK C;  1PGQ A;  3H6P A;  1DEE G;  1QEX A;  1KIL B;  5KJ7 D;  4GIF A;  5AVR B;  3H1K E;  5DJT B;  2AEF A;  1PFI A;  1LTB C;  1M90 Q;  1JM0 A;  4W80 A;  4ZNC A;  1X22 A;  2WPQ A;  3Q5P A;  1OX3 A;  4GOE A;  3V5B A;  3L73 G;  1BCC G;  1WMK A;  3H1I J;  2H88 C;  2JR8 A;  3V4W A;  3SFD C;  2PGD A;  1YTZ I;  1GMJ A;  4GKG A;  1SQB E;  1NU1 E;  2WSE H;  1AQ5 A;  1JOC A;  1YBK A;  5AW0 B;  1LWU B;  5CBN A;  1YIJ P;  4W7Z A;  1FDI A;  2GM4 A;  3HE5 B;  3H1J D;  3G4S P;  1JY3 N;  1LWU A;  2IBZ D;  2OGU A;  3I5C A;  3L73 J;  1BCC J;  1OVV A;  3HE5 A;  2O01 J;  3G3Z A;  1KOR A;  1CZQ A;  4TLF A;  1NWQ A;  2FYU G;  3AEF C;  2WQY C;  1NAY A;  1N8R Q;  2XNX A;  3AEE C;  4UB8 H;  5APT A;  2IX7 C;  3C8V A;  2ZYG A;  2RKL A;  4NPF X;  5CJ4 A;  3A0B E;  2K9Y A;  1KFM A;  4K3A A;  1FDO A;  1LGH B;  1VQ6 P;  1SQP G;  1EZV D;  3OA7 A;  2XND H;  2FYU J;  4D6T D;  1TU3 F;  2O01 H;  3VMX A;  1NGM B;  3RK3 C;  1T2K D;  1L4A C;  1ZOY C;  1G1I A;  1X79 B;  1JUN A;  2K9J B;  3L75 D;  3MP7 B;  3R4Y A;  4JYB A;  1SQX D;  3A3Y B;  3H32 B;  1NJI Q;  2WPV B;  1RY3 A;  3M0D A;  2DW3 A;  5GTH E;  1SQP J;  2Q9I A;  1AA0 A;  3HD7 C;  1LJ2 A;  2FKW B;  2BCC E;  1Q90 D;  4M3L A;  2I8D A;  1NAF A;  1Q86 Q;  1X0T A;  1Y9B A;  3AEG C;  1HGV A;  2B9B A;  1LTJ C;  2WT7 A;  1PPJ E;  1YJW P;  3TGU D;  2QJK B;  4JPZ B;  1HTL C;  1YQ3 C;  3CX5 D;  2JEE A;  1IFI A;  4H44 B;  1SQV D;  1ZV8 A;  2E42 A;  1BE3 E;  3C9I A;  1GL2 C;  2Q3I A;  2N9B A;  1BGY G;  2RN0 A;  2P58 A;  3FXD A;  1LT9 B;  1VQN P;  4ZKP A;  2E76 B;  3CCL P;  2BAS A;  3S9O A;  1NH4 A;  3A0H H;  3AE9 C;  2YO2 A;  2Y9Z A;  2R3S A;  1L0L E;  1SQB D;  4OGQ C;  1FZB A;  1DH3 A;  3L72 G;  3CC2 P;  1S5L X;  5TJH A;  2D2C C;  1FOS E;  1BGY J;  5E79 H;  3TNU A;  3RK3 E;  3CWB E;  1PL5 A;  3F5H A;  2OYI B;  1EC5 A;  1NTK G;  4OH8 B;  3H25 A;  1NTZ E;  4AYC A;  2MKV A;  2WVR A;  3H1K G;  2ITA A;  1NYH A;  1FZF A;  2W6J H;  2IFM A;  1PGO A;  1NVO A;  2QVA A;  1HGZ A;  1M1K Q;  3B8E B;  3L72 J;  4MN4 C;  1LTG C;  3L70 G;  1YJ9 P;  1VQ9 P;  1SQP K;  2Z4E A;  3H1I E;  3L36 A;  1M1J C;  4UB8 E;  3F89 A;  1NTK J;  4RJT A;  4O9B A;  4R4M A;  1M8O B;  2XV5 A;  2O1J A;  1LTA C;  2Y0C A;  4I7Z C;  2RMZ A;  1IC2 A;  3H1H J;  1WT6 A;  3H1K J;  1ZN5 A;  3MUD C;  1A02 F;  3L71 J;  3GW6 A;  4YPC A;  2WSC H;  3FX0 A;  1QL2 A;  2P67 A;  3L70 J;  2HPC A;  3EFG A;  3L73 E;  4LC1 A;  1BCC E;  1L4A A;  3B4S A;  1FZC C;  3M0A A;  1GD2 E;  5KLI C;  3JSV C;  3KHU A;  4EOT A;  1RQU A;  3RBZ A;  3KXD A;  3HTK B;  3NTN A;  3V2N A;  1YJN P;  5AW4 B;  4HKZ H;  4WY4 D;  3HD7 A;  3MGN A;  3AED C;  1LTJ B;  5CCH C;  1FJP A;  1GDT A;  3P8C E;  2ZT9 D;  3GF7 A;  3W67 A;  1KIL C;  3FGA D;  1KFN A;  1LTJ A;  1U7J A;  2FYU E;  3BCC G;  1KC8 Q;  3GG2 A;  3SFE C;  2PP6 A;  3TF5 A;  2HLO A;  3PH0 A;  3ZDM A;  5KLV J;  1GL2 A;  1ZRT E;  1BE3 D;  1IJD B;  1KQG B;  2OYH B;  2Q6Q A;  2OTJ P;  5CHX A;  2L5G B;  4GOD A;  4PD4 E;  2Q1K A;  2XU6 A;  3VN0 A;  4C46 A;  2WSF J;  1SQP E;  4PV1 B;  3AE8 C;  4OGQ B;  1NTK K;  3BCC J;  1N7S D;  1PV3 A;  3NFQ A;  2BCC G;  3A0H E;  4L76 A;  1FC2 C;  1KYO H;  4TT3 H;  3ABV C;  4R4L A;  1MV8 A;  1LT1 A;  5AVY B;  2M8R A;  1J1D C;  3BRT B;  2OTL P;  1JNM A;  5E79 E;  2WSS H;  3E1R A;  2O3J A;  3RK3 D;  1L4A D;  3CWB D;  3P32 A;  2IBZ I;  3JCU H;  1JY3 P;  3A0B H;  1NU1 K;  1KQS O;  1HJB A;  1H0T B;  4HJG H;  2IFN A;  2YO3 A;  1HF9 A;  2YXQ B;  1M1J B;  2P10 A;  2WSF H;  3SWF A;  3AE1 C;  3HD7 D;  2B87 B;  1M1J A;  1JMM A;  3LW5 J;  3S1K A;  2ZJS E;  1GW3 A;  1KIL E;  3EWK A;  2B87 A;  5APV A;  2FXP A;  4U3F G;  1U57 A;  4OVN F;  1BGY E;  2YKQ A;  1DD4 A;  2IZ0 A;  3MUD A;  1N73 B;  5K5G B;  4YXD C;  1EZV I;  3SWY A;  1GL2 D;  3TK1 A;  1HVV A;  4C7N B;  1P84 H;  1NTZ G;  2R3C A;  1H89 A;  1NKZ B;  4I6M C;  5KLI B;  3L73 D;  1S72 P;  3KYQ A;  1AV1 A;  1S5L H;  1FZC A;  2K88 A;  2Q5U A;  1RH5 B;  1VQ7 P;  4N6J A;  1IFP A;  2YKP A;  3L72 E;  5AVU B;  4U3F J;  3CCQ P;  3RL0 D;  3RK2 D;  3KZI H;  1VQ5 P;  3GHG B;  1N86 A;  1OXZ A;  3LW5 H;  4BRY A;  2J59 M;  1YI2 P;  1KQF B;  1NTK E;  1T3J A;  1FZG A;  1NTZ J;  2OQQ A;  2D2C D;  5CCH A;  4YXW H;  4H44 C;  1ZLL A;  3H1H E;  1EDL A;  1RE3 C;  1KIL A;  1SFC D;  3CCU P;  1USE A;  2JWA A;  3L71 E;  3Q3D A;  1X8Y A;  4EI2 A;  5KAI H;  2A06 G;  2H8P D;  3L70 E;  1LT9 C;  1BSN A;  3CX5 I;  2L91 A;  3L74 G;  3H1L G;  3V2R A;  2E76 C;  2JKV A;  3SSU A;  5AVQ B;  4N78 E;  1ZRT D;  3U1C A;  4H13 C;  1AQT A;  2R5B A;  2G3A A;  2P1J A;  1URQ B;  2M3E A;  1MUU A;  1SQP D;  3K5B A;  5APX A;  4WBA A;  1BSH A;  3L74 J;  3H1L J;  2OYI C;  4K35 A;  3CC4 P;  1KYO E;  2LR2 A;  1J1D B;  1EXI A;  4LLH A;  1VQK P;  2ZYD A;  3CMA P;  2XZR A;  1QVG O;  3HUS C;  3WMM 0;  2ZVN B;  1VPC A;  2FFD B;  1T8Z A;  5KLV E;  1OFC X;  3JCU E;  1L0L K;  5CCG D;  1SP4 A;  1LP1 B;  2QEX P;  3NXS A;  1VF5 D;  3ITK A;  1DEB A;  1L0N E;  1IK9 A;  5APW A;  2Z5I A;  4QMA A;  2YMY A;  1K04 A;  3BCC E;  1OW7 A;  2LKM A;  2KZJ A;  1NTZ K;  5CCH D;  1SLQ A;  5TIS H;  2CPB A;  3LIE A;  1OMI A;  2B89 A;  1KIL D;  1R5S A;  3MZW B;  1H8A A;  2CK3 H;  4OWF A;  3CCS P;  2K9J A;  1K73 Q;  1BGY D;  2K37 A;  2PRR A;  1QVF O;  2AEJ A;  3IAO A;  3H32 A;  5AW1 B;  3D70 A;  3N7N A;  1KB9 E;  2Y0E A;  1JY2 P;  3AEB C;  1P84 E;  4L75 A;  4H0L C;  1S2E A;  3A5T A;  2KLU A;  4EIJ A;  1S5L E;  3PP5 A;  2UWJ E;  2NPS B;  4ZKU A;  3KZI E;  1OIP A;  3CCM P;  5M1B A;  2YMK A;  1HWT C;  2AXT E;  3Q5R A;  1NTK D;  1U7M A;  5AVS B;  1E5W A;  2E74 B;  5EFW B;  3AE6 C;  2A45 G;  1RE3 A;  1XTC C;  3EFF K;  3VOP A;  3H1K D;  2ZVO B;  1QGK B;  1NTM G;  4PD4 H;  2OYH C;  3I55 P;  5KAI E;  3MD0 A;  1LT9 A;  3MTU E;  1PGJ A;  1LTT C;  4H13 B;  1K8A Q;  2E75 B;  4PV1 C;  4HH2 A;  1T6A A;  1Z56 A;  1NU1 D;  4U3F E;  3UIA A;  3T97 B;  5APS A;  1LNQ A;  2KI7 B;  2QE7 H;  3PRJ A;  2FYU K;  5CMZ A;  5DJU B;  1HBW A;  2Y0D A;  1NTM J;  4ASW A;  5KJ7 C;  2OYI A;  2HR3 A;  2GUS A;  2ZAE B;  2C9L Y;  3H1H G;  1KYO D;  3HUS B;  3D6Y A;  2QA4 P;  3L71 G;  5GTI H;  3L37 A;  4HB1 A;  3MHV A;  3HUS A;  3CCE P;  1NKN A;  3VYI A;  4IL6 H;  3V2P A;  4JF7 A;  3JC2 2;  5AVT B;  2H89 C;  2QJY C;  3BAS A;  1RF1 B;  2Q3E A;  5CBO A;  3USS A;  2W6A A;  4KJM A;  3VMA A;  3HRN A;  2A45 H;  1MKM A;  1AJY A;  1J2J B;  1N7S B;  1A02 J;  2A06 E;  1G1J A;  1YYC A;  4JQ0 D;  1N73 C;  5AW8 B;  3L74 E;  3H1L E;  2QJP B;  5TIS E;  1ZME C;  2KUB A;  2GA1 A;  1EDK A;  1GK6 A;  1VQ8 P;  3V2Q A;  2N9Y B;  3FXE A;  4H0L B;  2YNY A;  1SS1 A;  2E76 D;  1S3J A;  5B5E H;  3M9B A;  5KLV G;  2K1A A;  1PZQ A;  3GHG C;  3HTK A;  1KV4 A;  1P84 D;  4ASV A;  1MFT A;  1KMI Z;  3KPE A;  3V6I A;  2BCC D;  1D7M A;  2HG5 D;  1L0N G;  2KK7 A;  1JMB A;  4AQR D;  2KXP B;  1NTM K;  1PPJ D;  1SQQ G;  2MJZ A;  1CI6 B;  3CL3 D;  5APY A;  4BXL A;  3RGU A;  2N1T B;  1T2K C;  2GUV A;  2V4H A;  1ZR4 A;  1GTW A;  4L73 A;  1J1E B;  1Y8A A;  1G2C B;  2KB7 P;  4EDF A;  2OYH A;  1YIT P;  5APQ A;  1YHQ P;  1L0N J;  3OAK A;  3RL0 g;  2OTK E;  1SQQ J;  5APU A;  1IZN B;  1URQ C;  1W2E A;  5BU8 B;  3I56 P;  2FXO A;  1L0L D;  1LTI C;  4U7J A;  4U3F D;  2FYN B;  3BVH A;  3B5N B;  1X9V A;  2QIW A;  3U59 A;  2KSE A;  4B86 A;  4XA4 A;  3BAT A;  3VP8 A;  4Z1M H;  3RBX A;  1NTZ D;  5KJ7 A;  2LXB A;  2FFD C;  1UII A;  5BVZ A;  3VP9 A;  5AW2 B;  1NHL A;  1MFZ A;  3GF3 A;  2C0W A;  3CCV P;  5AVV B;  1H0T A;  1RHZ B;  5GTI E;  1IFJ A;  1R5L A;  1FS0 E;  3CXH E;  2QJY B;  4IL6 E;  2V7Q J;  3AEC C;  1RE4 C;  5AW3 B;  3H1I D;  4IOI H;  1EQ7 A;  1EZV E;  2KSJ A;  3N4X A;  2HOD B;  2XDJ A;  3C1L A;  5KAF E;  4PJ0 E;  3M91 A;  1NTM E;  1FZE A;  2C0X A;  1KB9 H;  3IN6 A;  2HOD A;  4YTP C;  5KLV K;  2A06 D;  2ZYA A;  2IYO A;  1N73 A;  4DT0 A;  1W2B O;  3Q5S A;  1ZXG A;  3L74 D;  1BCC D;  4C7N A;  2QM7 A;  4DJG A;  1NO4 A;  1KQL A;  3KQG A;  1FE6 A;  1H88 A;  1L0N K;  1XTG B;  4IFF A;  2V7Q H;  1JTH B;  1S9K E;  3CI9 A;  1SQQ K;  2KP8 A;  2WPS A;  5B5E E;  2IYP A;  4PV1 D;  4W7Y A;  4OGQ D;  2NPS C;  3GHG A;  2AXT H;  3WUT A;  1GU5 A;  4IL6 X;  4JBZ A;  2WSE J;  3AEA C;  1FOS F;  1R8E A;  2OAR A;  4ZMD A;  2H43 A;  3P8C D;  4I2L C;  3CLQ A;  2E74 C;  5BU5 A;  2FYU D;  2H7H A;  2O01 N;  4KT0 J;  1GZL A;  1WRG A;  3PTZ A;  1JCD A;  3V4Q A;  2P2U A;  2FYZ A;  3TSI A;  1PP9 G;  3AE5 C;  3G71 P;  2E75 C;  2QM8 A;  2R32 A;  3EQ2 A;  4PD4 D;  3II6 A;  1FDM A;  2R44 A;  4WY4 C;  3HE4 B;  3O8Z A;  1URQ A;  1VQP P;  1AFO A;  3HE4 A;  3PHL A;  2ZT9 C;  3AE7 C;  3CCJ P;  3A7O A;  1SVF A;  1DIP A;  1PP9 J;  1K05 A;  3WUV A;  2G8Y A;  5AW5 B;  2KYV A;  2FFD A;  3PLN A;  4WVZ A;  4NPE A;  1ZW0 A;  1IK7 A;  1KYO I;  4I1L A;  1OVR A;  3IF4 A;  1RF1 C;  4XFJ A;  1LP1 A;  2QRX A;  3Q1M A;  1USD A;  4NPD A;  3SWK A;  1JCC A;  1GW4 A;  1SQQ E;  3IFM A;  3CXH D;  1RE4 A;  1N7S C;  3QH9 A;  3TYY A;  1E79 H;  4Y28 J;  4DZO A;  5H2F H;  2JO1 A;  2QJP C;  1Y47 A;  3H1J G;  2IBZ G;  1OZH A;  2O1K A;  1NTM D;  1VL2 A;  2WTY A;  2IDB A;  4UB6 E;  5AVX B;  2M5A B;  1MZ9 A;  2AXC A;  2XKM A;  1EXJ A;  1QX8 A;  2FY8 A;  2M5A A;  5AVW B;  4A7P A;  4CPG A;  1GU4 A;  5B66 E;  1QLE D;  3P8M C;  3L72 D;  1IFM A;  3H1J J;  3E1I A; 
#chains in the Genus database with same CATH homology
 4Y99 C;  1A02 J;  1L4A D;  1G1J A;  3OJA B;  3P32 A;  3V4W A;  1URQ D;  4KHX A;  1YYC A;  2KLV A;  1S9K D;  1YTZ I;  2VRS A;  4GKG A;  1JY3 P;  1N73 C;  5AW8 B;  2NPS A;  2WT7 B;  1NU1 K;  1QL1 A;  2WIT A;  2WSE H;  1LTS C;  1HJB A;  1AQ5 A;  1GK4 A;  1JOC A;  3VMY A;  1GK6 A;  1JO5 A;  2IFN A;  5AW0 B;  2YO3 A;  3V2Q A;  1M1J B;  2N1T C;  1LWU B;  2WSF H;  5CJ0 A;  3SWF A;  4W7Z A;  2YNY A;  2GM4 A;  3HD7 D;  3HE5 B;  1M1J A;  1JY3 N;  3M9B A;  4GT1 A;  1LWU A;  1J1E C;  1JMM A;  3I5C A;  1GW3 A;  1NOH A;  3GHG C;  3HTK A;  2I1K A;  3HE5 A;  1ZR2 A;  3G3Z A;  5APV A;  4DOJ A;  3KPE A;  1VDF A;  1CZQ A;  2YKQ A;  1NWQ A;  4N78 D;  2HG5 D;  3IR9 A;  4AQR D;  3MUD A;  2YKO A;  2WZ7 A;  1N73 B;  3RL0 C;  1NTM K;  3VMZ A;  3RK2 C;  1FZA A;  4WY4 B;  3SWY A;  2MJZ A;  1GL2 D;  2XNX A;  3TK1 A;  1JY2 O;  1HVV A;  5APT A;  4C7N B;  4AUW A;  1CI6 B;  3T97 A;  2R3C A;  2IX7 C;  2HFE D;  1H89 A;  1NKZ B;  4I6M C;  3CL3 D;  5APY A;  5CJ4 A;  3B5N C;  4WY4 A;  4HYT B;  3KYQ A;  3TNU B;  2N1T B;  1T2K C;  1FZC A;  2GUV A;  1N7L A;  1KFM A;  2Q5U A;  4N6J A;  1ZR4 A;  1N2D C;  2YKP A;  5AVU B;  1LGH B;  1GTW A;  1DX7 A;  3RL0 D;  1J1E B;  1IFD A;  1G2C B;  2KOG A;  1SFC C;  3RK2 D;  2KB7 P;  3GHG B;  1N86 A;  2OYH A;  3OA7 A;  1OXZ A;  2POH A;  3LW5 H;  5APQ A;  2J59 M;  2WPR A;  2Z5H A;  3OAK A;  2O01 H;  3VMX A;  3RK3 C;  1T2K D;  1T3J A;  1L4A C;  1G1I A;  5APU A;  1X79 B;  2P7J A;  1JUN A;  1FZG A;  1URQ C;  1W2E A;  4JYB A;  5CCH A;  3A3Y B;  1RF0 C;  3H32 B;  5BU8 B;  1ZLL A;  1RE3 C;  1KIL A;  1SFC D;  1LTI C;  1RF1 A;  3BVH A;  1X8Y A;  1RY3 A;  3B5N B;  1X9V A;  3M0D A;  3U59 A;  2H8P D;  1FU1 A;  2NPS D;  1LT9 C;  4B86 A;  4XA4 A;  3BAT A;  2Q9I A;  3VP8 A;  3V2R A;  3HD7 C;  2FKW B;  1N7S A;  4M3L A;  5AVQ B;  1NAF A;  5KJ7 A;  2FFD C;  5BVZ A;  4N78 E;  3U1C A;  3VP9 A;  2PAJ A;  5AW2 B;  1NHL A;  1MFZ A;  1OWA A;  1HGV A;  2JJL A;  2HPC B;  2C0W A;  1LTJ C;  2WT7 A;  5AVV B;  4RES B;  2R5B A;  3RK3 B;  1L4A B;  1JY2 N;  2P1J A;  1IFJ A;  1URQ B;  1HTL C;  5AW6 B;  1MUU A;  2JEE A;  1IFI A;  3M9Q A;  5AW7 B;  1ZV8 A;  1RE4 C;  2E42 A;  5AW3 B;  3C9I A;  1GL2 C;  5APX A;  4WBA A;  2Q3I A;  3U1A A;  2OYI C;  1EQ7 A;  1J1D B;  2N9B A;  3L4F A;  5CCG C;  4LLH A;  1LT9 B;  4Y99 B;  2E43 A;  2KSJ A;  3N4X A;  2HOD B;  2XZR A;  4ZKP A;  3HD7 B;  2XDJ A;  2BAS A;  1NH4 A;  3M91 A;  4XE5 B;  3HUS C;  3WMM 0;  1FZE A;  1VPC A;  2C0X A;  2FFD B;  1FAV A;  2HOD A;  1T8Z A;  5KLV K;  2Q7C A;  1SQX K;  1N73 A;  3VTP C;  2WWW A;  2YO2 A;  1L0L K;  1FZB A;  5CCG D;  1SP4 A;  4LGD E;  1DH3 A;  4C7N A;  2QM7 A;  1CI6 A;  4IFM A;  3A2A A;  3NXS A;  1FOS E;  1NO4 A;  1KQL A;  3KQG A;  3TNU A;  1DEB A;  2N1T A;  1H88 A;  1IK9 A;  5APW A;  1L0N K;  1GL2 B;  1XTG B;  2Z5I A;  2YMY A;  3L35 A;  4IFF A;  2OYI B;  1JTH B;  1S9K E;  3CI9 A;  1SQQ K;  4OH8 B;  2LKM A;  2KP8 A;  2WPS A;  1HH0 A;  1NTZ K;  1G2C A;  4AYC A;  5CCH D;  1SLQ A;  4W7Y A;  1T3U A;  2CPB A;  2NPS C;  3GHG A;  3LIE A;  1GU5 A;  2W6B A;  2IPP A;  1KIL D;  1FOS F;  3RL0 B;  1FZF A;  1H8A A;  2IFM A;  3RK2 B;  1HGZ A;  2OAR A;  3B8E B;  1LTG C;  2H43 A;  3P8C D;  4I2L C;  1KZU B;  3CLQ A;  3H32 A;  1SQV K;  1SQP K;  5AW1 B;  5BU5 A;  2Z4E A;  3L36 A;  3N7N A;  3M06 A;  1M1J C;  1LWU C;  3P7K A;  1JY2 P;  2H7H A;  3A5T A;  3B5N A;  4O9B A;  2XV5 A;  2O1J A;  1GZL A;  1LTA C;  1WRG A;  4EIJ A;  1JCD A;  1SFC B;  3PP5 A;  3V4Q A;  2P2U A;  2FYZ A;  3TSI A;  1IC2 A;  1WT6 A;  2ZFC A;  1ZN5 A;  1A02 F;  1SFC A;  1IFN A;  2QM8 A;  2NPS B;  4ZKU A;  1M7L A;  2R32 A;  2W27 A;  2WSC H;  1QL2 A;  2P67 A;  3EQ2 A;  2HPC A;  3II6 A;  3EFG A;  2HYN A;  4LC1 A;  2FXM A;  1FDM A;  1SQB K;  1IO4 A;  1HWT C;  4WY4 C;  1L4A A;  3HE4 B;  5AVS B;  2M3B A;  3O8Z A;  1URQ A;  1FZC C;  1E5W A;  1CW5 A;  3M0A A;  1GD2 E;  1RF0 A;  1AFO A;  3HE4 A;  2A45 G;  4C7R A;  4EOT A;  1RE3 A;  1XTC C;  3MIW A;  3VOP A;  2J58 A;  3HTK B;  2OYH C;  3A7O A;  1SVF A;  1FBM A;  3NTN A;  1HUC A;  3V2N A;  3MD0 A;  1LT9 A;  5AW4 B;  2ZXE B;  4WY4 D;  3MTU E;  1FJK A;  5KTB A;  1LTT C;  3HD7 A;  5AW5 B;  1YTZ T;  2I1J A;  3MGN A;  3M9H A;  1LTJ B;  1CSB A;  5CCH C;  2KYV A;  2FFD A;  1FJP A;  2CPS A;  1GDT A;  2N1T D;  4HH2 A;  1Z56 A;  5AW9 B;  3KDP B;  3P8C E;  1KIL C;  3UIA A;  1KFN A;  4I1L A;  1LTJ A;  4WB4 A;  5APS A;  1RF1 C;  3LID A;  2FYU K;  5CMZ A;  3M0D C;  1HBW A;  3BRV B;  2A45 I;  3R2P A;  1FZC B;  2PP6 A;  1JCC A;  1GW4 A;  2HLO A;  3IFM A;  1RE4 A;  1JY3 O;  1N7S C;  1GL2 A;  1IJD B;  5KJ7 C;  3TYY A;  2OYI A;  1JTH A;  3NMD A;  2OYH B;  2GUS A;  4DZO A;  5CHX A;  2C9L Y;  4JYC A;  5CCG A;  4N3Y B;  3HUS B;  2L5G B;  5AVZ B;  2C9N Y;  4IFD K;  3L37 A;  2R5D A;  2XU6 A;  3VN0 A;  4C46 A;  3HUS A;  1NKN A;  3VYI A;  3B5N D;  2O1K A;  1NTK K;  1N7S D;  3V2P A;  4JF7 A;  3H6P A;  3NFQ A;  2WTY A;  1KIL B;  5KJ7 D;  5AVT B;  5AVX B;  4GIF A;  3BAS A;  1RF1 B;  1MZ9 A;  2XKM A;  5AVR B;  2W6A A;  1MV8 A;  3HRN A;  1PFI A;  1LTB C;  5AVW B;  2A45 H;  5AVY B;  2M8R A;  1GU4 A;  1J1D C;  3BRT B;  3P8M C;  1JNM A;  4W80 A;  1J2J B;  1N7S B;  1IFM A;  2WPQ A;  3V5B A;  3E1I A;  3RK3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...