1CX1A

Second n-terminal cellulose-binding domain from cellulomonas fimi beta-1,4-glucanase c, nmr, 22 structures
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
b'ASLDSEVELLPHTSFAESLGPWSLYGTSEPVFADGRMCVDLPGGQGNPWDAGLVYNGVPVGEGESYVLSFTASATPDMPVRVLVGEGGGAYRTAFEQGSAPLTGEPATREYAFTSNLTFPPDGDAPGQVAFHLGKAGAYEFCISQVSLTTSAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE C
publication title Structure and binding specificity of the second N-terminal cellulose-binding domain from Cellulomonas fimi endoglucanase C.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 16
structure length 153
sequence length 153
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1999-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1cx1A00
4MOAA 5JUVA 2VQTA 5DQ0A 4QX2A 4DXTA 5B4NA 4YPJA 2EIEA 3T0BA 5EJZB 2W92A 2V5DA 1GOHA 3ETPA 3OGRA 5CYYA 5IHRA 3K75B 1US3A 3BGAA 2VJXA 2JD9A 1UY3A 2VZUA 4OYUA 4P02B 3OEBA 3GM8A 2YFUA 3MUY1 3VD7A 3WNKA 2VCBA 2JDAA 3MV11 4QX0A 4P5YA 1UXXX 2EICA 3K4DA 4QDSA 4CU7A 4DUVA 4W50A 4DUWA 2XQXA 3WF1A 2VZ3A 5EJ1B 4LQRA 5A1AA 2QQOA 1JZ7A 4E8CA 5LA2A 4CUBA 5C7GA 4HG6B 2WABA 4D0QA 3GDBA 2J1SA 3D3AA 1CZSA 4E8DA 5HXMA 2ZEYA 4GWJA 1W9WA 3CDZB 1XC6A 4A42A 3T0AA 1W8OA 4KI5M 3WQBA 2VZ1A 3SEEA 2VZRA 1T2XA 4ARXA 1JYWA 2DDUA 3T09A 2W46A 3OGSA 3CMGA 1PMJX 1NKGA 2V4VA 1PX4A 4OMDA 3ACIA 4RYDA 3T2OA 2VCCA 2JKXA 3I2KA 1W99A 2RVAA 1K12A 4A6OA 5JXGA 1WCQA 1GMMA 3FL7A 2J1EA 2VCAA 1DLCA 1PMHX 4L0PA 3EB7A 3P1IA 2XOMA 3I3BA 3FHQA 2EIBA 4ET7A 1KEXA 1W0NA 3NJVA 2WO3A 4ZY9A 2L9LA 2ORZA 1P8JA 3WF4A 3WF2A 3HOBA 2ZEWA 3ACHA 1CIYA 3DECA 2QQIA 1J83A 1ULPA 4TXWA 2LS6A 2QBXA 3CQOA 3THCA 2W87A 4PT6A 1UMIA 3LE0A 4UOJA 4XUNA 3IB3A 2W47A 1GU3A 3NNGA 3WSOA 1UWWA 1SHWB 3OEAA 3UESA 2VQUA 1W9SA 3HPNA 4Z2AA 2W1QA 3A21A 5J1XA 1MPXA 4DXRA 1UXZA 1SDDB 2W1WA 5FUIA 2Y6LA 4CVUA 2CDOA 4AAXA 4QX1A 4GWIA 4OMCA 4QX3A 5JMOA 3GGLA 4DXSA 3K4AA 1CZVA 2V72A 2E32A 4CUAA 2VZOA 1KGYA 2WAOA 2W91A 1GNYA 4A3ZA 2OKXA 3NRUA 3VD9A 2J1VA 4TTGA 2XHNA 2WBKA 2WN3A 4KWUA 3C7OA 4QAWA 3OB8A 3IAQA 4XVHA 2W1UA 2ORXA 2QQNA 2W9XA 2WO2A 3P6BA 5JXIA 3T2QA 3SEPA 4MGQA 4CU6A 1JZ5A 1I5PA 1GQPA 3JXSA 4CU8A 1EUTA 4LKSA 1UX7A 3GXUA 3MO4A 2QQLA 2VMEA 3U37A 1JZ2A 4AG4A 1F4HA 3FN9A 5EIYB 3UNPA 3LEGA 2ID4A 3HNMA 3C7HA 1OF3A 2WYSA 2R7EB 4CUCA 3DYPA 3MBWA 3WEZA 5IYYA 2BERA 5LA0A 2W3JA 4XUQA 3OGVA 2YG0A 2BGOA 2YFZA 4PF1A 2XONA 1W8NA 2Y64A 3WNOA 3HEIA 1RYYA 2VOTA 1LNSA 5B4XA 3CKHA 2RJ2A 3A7QA 2VZTA 4P08A 1ULOA 5C70A 3WNLA 2W5FA 1EUUA 2HLEA 4JKLA 2W1SA 4XUPA 5IJRA 1UY0A 4XURA 3IAPA 3VD5A 2WZEA 3EYPA 4DUXA 1XPWA 1K42A 5DN2A 3I2IA 1L7RA 1UY1A 2C26A 1JHJA 2VMFA 1OD3A 2VR4A 2Y6GA 2J22A 4BK5A 4OZOA 4W4ZA 5LCWL 2DCKA 3C7GA 3HN3A 1JYNA 1OH4A 4A41A 2W94A 3LPGA 2J1AA 3NJXA 1GUIA 4UI9L 2YC4A 5F7UA 2WAAA 4JKKA 3AC0A 3DYOA 1CZTA 5I0DA 2BZDA 1D7PM 2VC9A 2CDPA 4QB2A 3VD4A 2WDBA 2Y6HA 4ZZ8A 1J84A 4JHZA 1SG3A 1H6YA 4JKMA 3W5MA 3VDCA 4QB6A 4XUTA 2E31A 3ZM8A 3ACGA 3T0DA 2Z4FA 5JXHA 2VL4A 2WN2A 1H6XA 4D8MA 2E33A 2Y6JA 1JYXA 4ZXEA 3HJRA 4FI9A 1L7QA 3VDAA 1UYYA 2VM9A 2VZPA 2BBAA 1JU4A 1K3IA 1JZ4A 2QQJA 1JU3A 1OF4A 3A22A 3CZJA 3WNPA 2RV9A 2QQMA 3C7EA 1JZ6A 4ZZ5A 1O8PA 3I3EA 1F4AA 3OG2A 3LPFA 4KMQA 1UZ0A 5IFTA 5DPNA 1UMHA 3NQHA 4JX0A 1UYXA 4PQQA 2WZ8A 3I2HA 3OBAA 3ACFA 3MUZ1 3K4ZA 2X09A 3IDAA 1JYVA 3WF3A 2B9VA 4MO3M 4BDVB 2E26A 2KD7A 2VMDA 4P00B 2W95A 2J1RA 4ARYA 2J1UA 5HPOA 3VD3A 2PQSA 3LEKA 4LPLA 2X05A 1UYZA 1CX1A 1UY2A 3PUHA 4IUGA 1O59A 3K46A 5IFPA 1R64A 2ZXQA 2X10A 1YQ2A 1OT5A 1NUKA 3A23A 3F2ZA 3C7FA 4BXSV 3I97A 1US2A 3E1F1 2WUHA 2J7MA 3I2JA 4QDQA 4UAPA 2C4XA 4W8JA 3VDBA 3DYMA 3ECQA 2LW8A 4LHSA 3LQCA 2YB7A 4A44A 1JI6A 3CZUA 4QB1A 5JXJA 3LEIA 4GZ9A 2DCJA 4DEVA 3I2FA 2B4KA 4MGSA 4A4AA 2Y6KA 2C9KA 2VO5A 3SKJE 3MV01 1WKYA 3WNNA 4BK4A 1GOFA 3T08A 4DEQA 4OUEA 1W9TA 5JR2A 5G05L 3C8XA 2VMCA 3HNYM 1NAEA 4XUOA 1IQDC 2WQ8A 2VZSA 1K45A 2QQKA 1HN1A 4M4PA 3SKVA 1PX3A 3BN6A 3WF0A 2JE8A 1DYOA 3UETA 1GOGA 1XNTA 1JZ3A 2VZQA 3WNMA 2HYXA 2ZEXA 2VZVA 1UY4A 3PUIA 2YC2A 1NX9A 4RN5A 3I2GA 2BGPA 5DMYA 1JZ8A 3W5NA 4M4RA 3THDA 4A45A 2Y8KA 4CU9A 3I3DA 2J1TA 3FHAA 4MADA 5G04L 3CIHA 4QDRA 3K77A 3HNBM 1TVGA 2ZEZA 5LA1A 3ABZA 2EIDA 5CZKA 1XNAA 3T2PA 4XZUG 3IIIA 1O8SA 4BJ0A 4QPWA 1TG7A 1BHGA 2WO1A 2VTFA 1DP0A 5C71A 3J7HA
chains in the Genus database with same CATH superfamily
3RGBA 4RSUA 1ENXA 1JUIA 4HLTA 4MOAA 1W2OA 2ATFA 1S0JA 2WWUA 2A70A 1HQLA 1WW4A 3EMRA 3EQEA 3L9JT 1A34A 5DQ0A 1LU1A 2IXLA 1IQAA 4Q0VA 4QX2A 3ZN6B 2Q8EA 4DXTA 4K8FA 3T4VA 5CFDA 1ZZBA 3T0BA 1JXNA 4WVWA 1AJOA 1WLWA 1GOHA 3ETPA 3R4DB 4AVBA 2W52A 1CQ9A 3S7IA 1US3A 1UQXA 5FY4A 1TZOA 1C4RA 1TME3 4XCBA 1OOPB 5LK7B 1PHMA 2XJUA 4P02B 4TYSA 3H7YA 3OEBA 3U11A 4YW7A 4OHWA 1C1LA 3SCGA 3WNKA 1KQRA 3WDUA 4CCOA 2VULA 5FO8B 5H9PA 4NR1A 1G9BA 3JB4C 5CG9A 5JPMB 2P34A 1WMFA 2RR12 4DUVA 1XRUA 3DUIA 2WJSA 1AYM2 3VZKA 4AQ2A 2R073 5L36A 1LOCA 1LODA 4Q0QA 3ZXKA 1DLLA 5A7PA 5FWJA 2GU9A 2WLPA 1ODNA 4K3UA 1W90A 4Y5Z0 3V64A 4P9LA 5L9BA 2WABA 5FYBA 5FZOA 3H3ZA 5T5JA 4D0QA 2KA3A 2J1SA 4CCLA 5I91A 3B94A 2C6SA 4IV1B 1M06G 1AR63 2JICA 4Q4W2 3ROUA 2K0GA 4ASLA 1W9WA 1BJQA 4Y1YA 2YGLA 2PAKA 3WP6A 3KF3A 3GALA 4U36A 1W8HA 4Q2FA 1BBT2 1WW6A 2UY9A 1RUG3 2VXJA 3RMXA 3SEEA 3U75A 1T2XA 2VVDA 1K5MA 4LE3A 4ARXA 2DDUA 2BU9A 2W46A 3PUAA 2YZ4A 3UV9A 4CDWC 1CVNA 4AVVA 3CMGA 1PMJX 1Q8OA 1HB2A 2A6XA 1HXS2 1MVEA 4DPNA 2PELA 3VBSC 3MI8A 4D6SA 1PX4A 1DQ6A 5ISLA 3OPZA 4HMZA 4WZFA 1YI9A 2NLRA 2R071 4QQPA 1ST8A 2ET7A 4WM7A 4GMP0 4M3CF 5DZFA 3ZSLA 1I1EA 3MIHA 4OZXA 3RYKA 4CDWB 4J1WA 2CNAA 1HQNA 4NO4A 4P5HA 4UF0B 3RPQA 5JDBA 2R16A 3S6PA 1GWLA 3EXUA 1WCQA 5F2WA 2AGSA 1IS4A 3FL7A 1YRZA 4L9BA 4LO4B 5FY5A 3NVCA 3O0WA 3SQOA 3M3QA 1SBEA 4TWTA 5BNOB 1AR61 1LB2A 2VCAA 3OPTA 3VBUA 5KC5A 1GKBA 3WP4A 1VMHA 1Q8SA 2DU1A 4L0PA 4F7ZA 2XOMA 3ASIA 4D94A 3CU7A 3FUQA 1RL3A 3ZR5A 2I07B 1RUG1 1AR83 3PU8A 2JDKA 1UF2C 2Y0OA 4K20A 2X5IA 4LBQD 4OI1A 3NJVA 1TE1B 2WO3A 2B42B 1DQ0A 2L9LA 1OLMA 1FOD2 1SLAA 1G9AA 4LORA 5FMDA 5A7WB 1CAXA 1CIYA 1UAIA 1W06A 2GZWA 1SACA 5ANNA 3LSEA 4RGGA 1DGWA 3AJZA 1VMJA 2WINB 1J83A 1PZ8A 3NAPA 4K6BA 2BDRA 1PNGA 2CGOA 2LS6A 4EZHA 1V00A 1AL22 3ILNA 4YM1A 3THCA 4I3PA 4NHXA 5C9AC 2YV8A 4XUNA 3WUCA 4AI8A 3DKWA 3FMGA 3ZN6A 3ILFA 2R043 1YFWA 3WQ1A 2XPJA 4LKEA 1GU3A 2UY8A 1ENSA 2A3WA 4HVOA 4QX8A 5CADA 1VAKA 2R32A 1MS3A 1XNBA 2FCUA 1VAVA 5C9AB 1QIQA 5FYTA 1AR81 2OX0A 1UZZA 1W9SA 2VQUA 5IWFA 3VHRA 4NJ4A 2JWPA 1MPXA 1I3HA 1NCRC 2ZX4A 5FZBA 4YM3A 1OOPA 1IS3A 2ZHNA 3AJYA 4GWMA 4FP3A 4JDNA 1X50A 2RS52 1VLNA 3JBG3 2PHRA 4Q29A 2PHUA 5FUIA 4PQ9A 2DF7A 2GNDA 4QX1A 4GWIA 4QX3A 4DXSA 4QU1A 5HXVA 2V72A 4D69A 1FATA 1VBC1 3GBGA 4CCMA 4YM0A 3N9OA 1ZYBA 4YNIA 1WA4A 3ZXFA 1SFNA 2G4IA 2OKXA 3SNMA 3EJKA 4NOTA 4URTA 2D6LX 2RS32 2J1VA 1YJLA 2R041 2YC0A 3ME2A 4OI4A 4TTGA 2XHNA 1S2BA 4IV1A 4Q26A 5F3GA 1C57A 2WBKA 4FPYA 4XFFA 2YGMA 2YPJA 3IAQA 1HN0A 3VKLA 3GBWA 1A3KA 3MIBA 1RUH3 2WO2A 2QQNA 1YUDA 4G3YC 2ZGQA 4FT8A 1UIKA 4HN1A 4MGQA 4XACA 5BNQA 1FV3A 4C1WA 1JZ5A 1JS9A 4GQ7A 1EUTA 3CJIB 4HZFA 4BQXA 1FPN3 1VRH1 5HCBA 3UGFA 1YYNA 2ADDA 4IGPA 5A80A 3AYDA 2UWBA 2VQAA 2TEPA 4AG4A 1JZ2A 1E5IA 5IVJA 1UZVA 4GKXA 4LMFA 4MGZE 4QD2A 3ETQA 1OBNA 1CPNA 4QPIB 2JB4A 2XVLA 4FPGA 2NPIA 2A1XA 2R7EB 4UF0A 4CUCA 5FQ0A 4AL9A 2CAUA 4FBFA 3MBWA 3N35A 4CDUC 3TN92 5IK4A 1LHWA 1W6NB 1ND2C 5BNOA 3ZIWA 1YLLA 4I0WB 5JSRA 2OPWA 3VD9A 2YG0A 2BEOA 1HRV2 2BGOA 3CHXA 4HBNA 1RUH1 4LO6B 3K3OA 1Z7S2 5ACA3 3AYAA 3WHUA 4ZHNA 4COUA 3RZZA 2OYZA 2BBVA 1EY2A 1GBGA 2EXIA 1VBB3 2Y64A 3I54A 4IEYA 2ZAAA 4S2DA 5CU1A 5LBBA 4E9KA 3ZX7A 2EVXA 4A3XA 1OXCA 2OS2A 4YZ2A 3A7QA 3JUUA 1ULOA 5I0RA 1HB3A 4XETA 1QMJA 5C70A 1L3JA 4MYEA 1IS5A 5A7WA 4AE2A 1FPN1 3ZYJB 4QQOA 1OPOA 2W1SA 3MEPA 1LGBA 1KJLA 4YFWA 3SCFA 4CCDA 1SZBA 1YO8A 4S2HA 3IAPA 4LHKA 1OLRA 3EYPA 5T52A 3TEXA 1BVVA 4L8QA 4YGCA 2W0XA 2HYKA 3H3UA 2AH2A 5LWBA 1GNHA 3D6EA 4META 4M3CB 3ZIXA 2VR4A 2Y6GA 3HD8B 1XYPA 1RB8G 5CFCB 1WWYA 4UFLA 4W4ZA 1QJZA 5ACA1 2DCKA 2HWB2 3C7GA 1GFF2 2OZ6A 1NCQB 1D0HA 1VBB1 3N7LA 1Q8QA 3AMQA 4W65A 1JYNA 2I74A 1D0GA 5A7SA 1S0CA 4N43C 1DGRA 1J3RA 4UI9L 4LBJA 4NE9A 4NIDA 4C0BA 4KU7A 4YM2A 1PK6C 1PGW1 4ES9A 3DYOA 4LOSA 4EWDA 1GR3A 1PO23 4HSJA 4QGMA 3AK0A 3TB0A 1DIWA 4EN8B 5A6ZA 4LJHA 2WDBA 1UX6A 4JDOA 2WNUC 1QEXA 1RMU2 2B46X 3EHKA 4N43B 4Z8BA 3BU0A 3LDRA 2XVKA 4JKMA 3WV6A 3W5MA 2CU5A 3T0DA 2D6NA 4XCAA 2XWBB 2WN2A 2DCTA 1XQNA 5F39A 2BGCA 1RUE3 4X8NA 2PLV1 1H6XA 2Y6FA 4LBMA 3VZLA 4RR3A 1G9CA 3ZFGC 3E97A 3ZPOA 1OFNA 5IVEA 4ISQA 1ZRRA 4NPRA 4SLIA 2XL9A 2D5FA 2JJ6A 1F8VA 2HWE3 5F5AA 1UYYA 4PDWC 4XQWA 4CXYA 4XFHA 1N3PA 4IW3A 2VM9A 1Q56A 1MZ5A 3MLLA 2QJVA 3WY6A 4EYUA 4M0NA 5FPUA 2BBAA 1K3IA 1H8TC 4DS0A 4C0HA 1EPWA 3ST7A 3CJIA 4IESA 5FPZA 2DTYA 5JIUA 3IPVA 2QQMA 1UU4A 5BNPC 2WZR2 2HWC3 4PDWB 3ZN5A 1QDOA 2XR4A 3KT4A 3GF6A 3OG2A 5EZWA 2D6PA 4AQSA 3OUJA 1UZ0A 5HCHA 5DG2A 5DPNA 4QPIA 4QKDA 4FPLA 2E7TA 2K46A 4PIYA 5DAVA 5E8AA 3KGZA 5FBJA 1RUOA 4PQQA 2WZ8A 3RZKA 3I2HA 3OBAA 1RUE1 2WO7A 3MUZ1 4W6XA 1YI7A 5BNPB 2IXCA 1W6NA 4NAOA 4BDVB 1MZFA 3BPSA 1LOFA 4LBKA 1YQ5A 2RS11 3ZXGA 3TNPB 2KD7A 5C8CA 1YEWA 2HWE1 2JE7A 5LATA 4Q4V2 4UBGA 1W3XA 4KGQA 4ARYA 5T55A 1HX6A 2Y38A 3IDEA 3KD4A 2J1UA 2BOIA 2BUKA 2SLIA 3M3EA 5GLZA 4XHXA 2VW0A 3KWVA 5FYIA 4NWWA 5HPOA 1POQA 3IMNA 2J42A 4FOVA 3W20A 1RUJ3 4YGEA 2X05A 4DO0A 4CEWC 3N9QA 5SV5A 4YVSB 2YMZA 4LO7A 1CX1A 1RUD2 3PUHA 1DU3D 3SH4A 5GLTA 4AEMA 2HWC1 4XJUA 2FD8A 4M0HA 1UZWA 2XDVA 2FQPA 2YBSA 3HT1A 1YQ2A 1NLRA 3S0MA 1S55A 3IM0A 4LULA 1FNZA 2AEYA 4ZU4A 3BB6A 3TRSB 3RZLA 1KJRA 1RXFA 3AZYA 1F9KA 1EPZA 3DV8A 1US2A 2ARBA 3PLQA 4KH9A 1R1ZA 2WUHA 1DGRN 2PHWA 3I2JA 2H6CA 4YG0A 3VKNA 3VL9A 4H55A 4AI9A 5AFBA 2FDGA 1VIWB 4J6GA 3I2DA 3RJ2X 3LEMA 4QQLA 1FI2A 3LQCA 1AYN3 3SMHA 3BIWE 1O4YA 3MFAA 3SHRA 5L19A 2CAVA 2VNRA 4EV0A 2NZ9A 1QOOA 3O14A 3LEIA 3TYJA 5LZ6A 1SLIA 1VALA 4A4AA 1C28A 3KT1A 5HBAA 5FZ7A 4YW5A 4IL7A 5FZ9A 5FZ8A 3SCHA 4FFGA 3WNNA 2QQPA 3V56A 1DQ4A 4OUEA 4LUMA 5HV4A 2VCMA 4IEOA 4AR2A 1A6CA 5C3SA 5CAZA 2VMCA 1SPPB 4DIQA 1DQ1A 4BB3A 4XPVA 1DF0A 2G9GA 3D5OA 4S2FA 3N36A 2VZSA 1MVQA 1SEFA 4XAEA 5DAWA 2YYOA 3U4XA 5LEJA 1QNYA 2QQKA 1QJX3 4FVVA 1E57A 1COV3 1ZA4A 2JE8A 4NHMA 3VBFA 4R9CA 3DCQA 3ON7A 1JZ3A 2XJPA 1AYN1 1LRHA 2VZQA 1LENA 1Q5OA 2ZEXA 2VZVA 4Q4Y2 1NQDA 1PVXA 1OVSA 2F4PA 2NQYA 4JDMA 2BGPA 2VUCA 4XF1A 2BJSA 5A3PA 4A45A 1ONAA 4XQ4A 4NAMA 1OI6A 5DG1A 1ND3C 5L73A 5JZGB 1CD3G 4BPZA 4FAGA 1BCXA 3IDBB 4HONA 3CIHA 4QDRA 2DVGA 2XUMA 3LD8A 1MQTC 5FY9A 3POIA 2HWD2 3PIGA 1GZ9A 3ZXDA 2WKKA 4JZRA 4CDQC 4H7LA 2FBEA 1RVF2 2ZEZA 3ABZA 5D1IA 3UJOA 4AVTA 2Q1FA 3IN9A 5HI0A 5CZKA 1ASJ2 2P3KA 5GZGA 1ND3B 1XNAA 2CL2A 4N53A 4CDXA 5LY1A 1RUC2 1DYPA 5GLWA 4XZUG 3NKGA 3O1SA 4BJ0A 1QJX1 4ZKTB 1TG7A 3BALA 4CDQB 5T54A 2ETEA 3ZSMA 3OY8A 3FZ3A 1COV1 4KU8A 1Q8PA 5JI7A 2FDJA 2ZMLA 1QU0A 2VY0A 4NMIA 4RHV2 4AF9A 4HN0A 1OD5A 2WSVA 5K4LA 1ZBE2 3PTYA 1GP6A 3J4UH 3U0ZA 2O8QA 5KHHA 2IXIA 1R1A2 4AI0A 2B5HA 4HPKA 4QPGC 2PHDA 3B9IA 4B1LA 3NW4A 4XF3A 2PFWA 2LALA 1JTZX 3A0KA 1D4M1 5ABJC 4QHBA 2O0OA 1RHI2 2VE1A 4CA9A 1UY3A 4KL1A 3DN7A 2AACA 3F95A 4XMIA 2Q8OA 3R0RA 4I30A 1XB9A 2ZGKA 4OYUA 2LTNA 4RS5A 2V09A 5FMOL 3PJQA 5FMBA 2P3YA 3GM8A 2YFUA 3VD7A 3ZFEB 4BH9A 2RMU2 3GZUC 1W05A 4I0AA 2JDAA 3RWKX 2A5ZA 1G6NA 1YFXA 3RFRA 2EICA 3NJZA 5C3PA 3N9MA 2Q30A 3RVHA 4BLJA 3ZR6A 3K4DA 3BCWA 1RUF1 5CFDB 2AUYA 5JPNB 1WUVA 2XQXA 2MEV3 2D93A 1EAH2 5EJ1B 4LQRA 4E2SA 5IVFA 1UOFA 5FPLA 2VOWA 1JZ7A 4E8CA 4CUBA 4UFIA 3GNEA 2ZHKA 3PDQA 3RZMA 1VBD3 2BTVC 1RUI3 1ZVFA 4QM9A 1CZSA 1CPMA 2IZWA 3MF6A 5HXMA 3HN1A 2QE3A 2WA3A 5F6LB 2ZEYA 4QXBA 2HBTA 2VQ0A 2PHLA 4NRMA 2P17A 3VKFC 4EN0A 4FPEA 2FZ2A 1U5IA 1XSRA 3WW1A 2VZ1A 3NSTA 2WNEA 2BWAA 3I8TA 1X9TA 2ARCA 1OH3A 1UW8A 4YSFA 1DG6A 3OGSA 4I3GA 3T30A 3DPRB 4NWVA 5DUUA 1STMA 5KWRA 3O12A 5FREA 2BPA2 3AP4A 1NKGA 4LA2A 4UBHA 5J98B 4CPBA 4OULA 4OMDA 3ACIA 3WG3A 2I45A 4DFSA 4RYDA 3J7NA 1AXKA 1TME2 5KXBA 2MEV1 5DUWA 1X36A 5DDJ3 5FZ4A 3MIEA 4CTEA 2RVAA 2Z79A 3LOIA 3C2UA 1K12A 1K5MB 1W9YA 1YHFA 4Y3OA 4A6OA 4WM8B 1GMMA 1J3QA 4D7YA 5CKNA 4FOWA 4JGYA 1J1TA 1VBD1 1RUI1 3LIHA 1N1VA 2VG9A 3R4SA 2XHKA 4V1PA 5FYMA 3VZOA 4E27A 1PMHX 3FLRA 1V70A 2ZX2A 4LR4A 3UGHA 5JIAA 4BE3A 1FXZA 4YYOA 1AX1A 4BQ4A 4CE8A 5JSOA 4WVVA 5LBCA 2C5DA 4XW3A 4WM7B 5F5QA 3RRDA 1DZRA 4JRLA 3WLUA 2JX9A 1ZZ9A 3KHBA 4F83A 2RDRA 4P9JA 2ORZA 5IVYA 4M01A 5CKMA 2VU9A 3BTAA 3PURA 3WF4A 3KHCA 1AUYA 2X5IC 2ZEWA 4AI2A 2JDMA 3WZ1A 3SISA 2F17A 3ES1A 1FMD2 2OUHA 3AMPA 3H1YA 4NN0A 1RUNA 3VBUB 1PZ7A 5LW9A 3OF1A 1XNCA 5DDJ1 4IETA 5K0UA 1GYKA 1MS4A 5T5PA 4FQZA 5FOJB 2JIJA 4KBBA 1SDWA 2CHHA 2XVGA 1QWRA 3CQOA 4X8PA 4Y1UA 2W87A 3NV3A 1AR93 2BVVA 2ZMKA 3NAPC 1UMIA 2YPDA 4K1ZA 2X5IB 1PO12 3AZWA 1O5UA 4YVWB 1VB4A 1H9PA 3MIGA 3UT0A 1POV1 1U5ZA 4ZS3A 2D40A 5F3EA 2A6YA 2EXKA 1CAXB 3H42B 1BYHA 4YWAA 1HJGA 1MEC2 4AGGA 1SHWB 4XFGA 2P1BA 3W58A 4IDZA 4TLGA 1OKOA 2BOJA 2CTVA 2HEVF 5LBEA 1MS1A 4PF5A 1NA1A 1C8NA 3J9SA 4DXRA 3WW2A 5KHIA 2ZJCA 3JCIA 4QT6A 2LM3A 1KITA 1YJKA 2WNVB 1NZCA 1CAUA 3KV4A 3ZFEA 2DCYA 5J48A 3ZXAC 2Y6LA 1T6GC 1OOPC 2OVUA 2CDOA 4AAXA 4OHYA 1AZDA 2XBO3 1J59A 2WFPA 4LIUA 2E51A 3WD5A 3WP5A 1C8M3 3G7DA 4CUAA 5L9RA 4MH0E 5A70A 3OD0A 1KGYA 4BM8A 3B02A 2ZKLA 2WWJA 1AR91 1GNYA 1UNBA 2HWF3 4PIXA 4QPYA 4FXKB 3KF5A 3GYDA 1QQP2 3NJYA 3E5XA 1D4VB 1R093 4IEXA 2D97A 2OA2A 1G9DA 3FWEA 2ZGMA 1PGL1 1N1TA 2UURA 3MIDA 4UXAA 1AR73 1F5JA 4KWUA 4UW6A 3BTZA 2VMIA 3OB8A 3BYWA 2G1MA 4XVHA 1S0DA 2W1UA 5EXOA 4IV1C 4YW6A 2ZX1A 4XMAA 5FO9B 5JXIA 3AXDA 3SEPA 1PMIA 3KV5A 3WNXA 2XJTA 3O1UA 5T50A 4GH4A 2V73A 5I0SA 3DPRA 3J8F2 4JAAA 1GQPA 3JXSA 3KQ4B 5FYVA 2ZOEB 4CU8A 3KQRA 4Y22A 1GLHA 1ZBA2 3BU7A 4BQ2A 5FR3A 4QWNA 2XBO1 4AFCA 3N7MA 1CONA 1WMXA 1C8M1 1KFUL 2GMPA 3B3QE 2DFBA 5CNAA 4E2QA 1WBLA 4MG2A 3FN9A 1CAWB 5EIYB 1FNYA 4V2WA 3HNMA 2JG9B 3WQ0A 4FTSA 3W21A 1SCRA 2HWF1 1OMIA 1EV11 3AFGA 3JBG2 4XHBA 4XJZA 1XE8A 1R091 3DYPA 4WM8A 3B7MA 2VXRA 4MXWB 4NHLA 3WEZA 1LHVA 1W6MA 4YW1A 3ZFFA 1ZRFA 1AR71 4PIZA 5LA0A 4XUQA 3ZXEA 1BEV2 4ZU5A 4QHOA 4QKFA 5BNOC 1R083 4P14A 1V0AA 4Q4X3 2WZPP 4AEKA 3TBDA 5DZGA 2HEWF 3HEIA 2WNOA 2IVIB 5FOBB 2BNNA 4EROA 1LNSA 2RM22 3CKHA 2RJ2A 1H1MA 5F32A 5FQ0B 1IHMA 2VMGA 4U2AA 3I59A 3N4MA 3LFIA 5C8WA 1HV0A 4NROA 3TEZA 1EUUA 1FT9A 2HLEA 3BTXA 5FYZA 2IVJA 5FLHA 3U4SA 5AC92 2CV6A 3NNFA 1XPWA 1LEMA 4CCEA 5IVCA 1OHFA 4RD7A 1V6OA 5A6XA 1LECA 4YVWA 5IATA 3I2IA 1L7RA 4A6SA 1PZ9A 4QMAA 1AXZA 1QGLA 1UY1A 2Q8CA 4HKOA 1JHJA 2ET1A 2ZGSA 4NUBA 3GZEA 1DHKB 2XUEA 4AWDA 3P5BA 4Q27A 2LUWA 2F4LA 4BK5A 5J96B 4CCKA 2IC1A 5IAXA 3I4IA 3B9CA 1R081 3HN3A 4ZXKA 2JEMA 1POV0 4Q4X1 2C9AA 1OH4A 2W94A 1CIWA 3E6DA 3LPGA 1VBC3 4BISA 2GNMA 1H0BA 1V6IA 3WXPA 2WNVA 2VGDA 2BFUS 1CZTA 2CSGA 5I0DA 3AVRA 1XYOA 1OURA 3MW3A 4AEDA 2QZ3A 2P5BA 4QGLA 3TEWA 3LDBA 4Y20B 2VNVA 2VC9A 1EYBA 5A1LA 2CDPA 4A7ZA 5J36A 5LASA 3HMYA 1DQ2A 4L2NA 4L92A 3MFCA 5F5CA 3RI9A 3MLJA 1J84A 4ZZ8A 1SG3A 5I8SA 4I2OA 2FDHA 4QB6A 1XBFA 1A78A 3LWCA 2XLGA 3AL6A 2ZGUA 3FFZA 4ORFA 5C3RA 4MGKE 1FAYA 1IPSA 1RTVA 3HVDA 3DEMA 2XKOA 4XABA 1XNKA 1WCKA 2RR13 4D8MA 5BV6A 5FP7A 1DYKA 4JRAA 1AYM3 2GN7A 2GMMA 2Y6JA 5H9SA 3AZZA 3FLPA 3OGJA 3HJRA 1QJU2 5F5IA 1VRH3 3VDDA 1L7QA 1JOPA 1GWMA 1UU5A 1J58A 2DUOA 2Q1ZB 1MZEA 2MHFA 1NY72 2H6BA 5D8AB 1JYCA 1C1FA 2WQ4A 3H9AA 2O8OA 4OCTA 1H2MA 4HETA 3GJBA 4MXVA 4BHPA 3AYCA 2OUJA 1JU3A 4FFHA 4LLFA 1OF4A 3A22A 5FZLA 3WNPA 1S0FA 4PCRA 3GHNA 4RR3B 1BBT3 1SCSA 3SXWA 1G9FA 2EAKA 2Y34A 4NIAA 3I3EA 1F4AA 1QJY2 2R30A 3CJIC 1PM7A 3LPFA 1CAWA 2O1QA 2MNGA 4JVAA 4WZCA 4FO9A 2JG9A 2OXBA 3GZAA 4XJ8A 3NQHA 4JX0A 5GKAC 4R9AA 3VBRB 1S2EA 2BWCA 4OVEA 1HXS3 2KR2A 3WW4A 1PO22 2BNMA 4I02A 2JDNA 2Q0AA 3OUIA 4MXWA 4QPIC 2RR11 3IDAA 5FAXA 1JYVA 2JB8A 1AYM1 1ULCA 2QQVA 2E26A 4Q1PA 1RGSA 3IPVB 2KXLA 2D3RA 3TAYA 1XE0A 4H7MA 2VMDA 3U07A 1X9PA 1E5RA 4ZONA 3WT3A 4P00B 5BYNA 3VHPA 1LOFC 4DOUA 2W95A 5A33A 2C0ZA 5EP9A 3ZFFB 3RWNA 1WMEA 2ZGOA 1OC1A 1VPHA 2Q5TA 4HK9A 4P9YA 4Q4W1 4MV2A 1O7FA 5FTTC 3VD3A 3LEKA 4LPLA 1N1YA 5FY1A 1W8ZA 4IGOA 1SLBA 1I9RA 1UYZA 2NMNA 4IERA 1N3OA 1BBT1 2R1BA 4IUGA 2AEZA 4QHZA 5CVRA 3VBOA 2JDUA 2ZXQA 5IFPA 3MLKA 4WBBA 3BPZA 4NHKA 5C8CB 4EN9B 3FE5A 1OT5A 3ZLIA 5A3UA 2Q8DA 3H1WA 1IKPA 4BXSV 5T5LA 3I97A 2DV9A 4Z82A 1HXS1 1ZZCA 1GNZA 5M0TA 4QDQA 5KXEA 4UAPA 2C4XA 1ZZ6A 3NWKA 3ZYFA 3KV9A 4R9BA 1BMV2 1JUHA 3VBSA 3ZDVA 1IOAA 1GQHA 1AL23 1ULEA 2WFF2 3CZUA 1VBE2 4GULA 1W0OA 4JQTA 5CFCC 1G86A 4MGSA 4CZSA 2OZJA 4W6YA 4D6RA 4E4DX 3MV01 2VPVA 1WKYA 5FZ1A 1YC61 1NCQC 4BYYA 4DMIA 2DVFA 4DEQA 4LNVA 3T08A 4GJZA 4CXWA 2B8MA 2OPKA 1JW6A 2CGNA 2PLV3 1OFSA 4TN7A 4Y20A 5DUXA 5JR7B 3VUOA 4ZPIA 2BW8A 3C8XA 3URFA 1WA6X 3OTFA 1NAEA 3HAGA 4TLFA 1H2NA 2UWCA 1BVP1 1FOD1 2WC2A 1RUJ2 1SLLA 3M4FA 4KQ7A 1Q43A 2RS53 3P3PA 5SV8A 2PAEA 1S1AA 1HN1A 3SKVA 1PX3A 3HBZA 4H2AA 1DYOA 1S0EA 3ZYPA 4CCCA 2R0HA 1GOGA 4TSVA 1AL21 2QFEA 4LXLA 4N9HA 3M70A 5F8PA 3PUIA 2YC2A 1NX9A 2XJQA 5LY2A 1JZ8A 5EQUA 1H4HA 3LA2A 2RS33 4M4RA 2ENRA 1NG0A 3THDA 4CU9A 1N3QA 3I3DA 1LGNA 5D8AA 5FYHA 2E53A 3ZN4A 5A3LA 2X29A 2AZ5A 3EO6A 4Q8KA 1BK0A 3MIFA 3AKSA 3K77A 1UIJA 2VD7A 5A3NA 1RINA 4XDQA 3VBFB 2QZ2A 2RJLA 2VW1A 2GAUA 4COYA 1H9WA 2RS13 1AHSA 3TOJA 2A3YA 2P4EA 4R4XA 5FPVA 1H2KA 4AVAA 2ARAA 4UFKA 2YBPA 1WLTA 3ES4A 2RS51 3H50A 3VBRA 1UKGA 1OPMA 4AHWA 1NCRA 1O8SA 5KR7A 1VJ2A 4QPWA 1DDLA 3KS7A 4UYBA 2VW2A 2WO1A 4N53C 5ANQA 5I8YA 3O1PA 4LA3A 2VECA 1W2AX 5FXWA 3HIFA 2R062 4LE4A 3GZTB 1JHNA 2E7QA 4QQ2A 2GNBA 3O1TA 2UYAA 2VUJA 2PTMA 1AX2A 5B4NA 5KHGA 2RS31 3ZMOA 4OHXA 4R8HA 3TN93 4N53B 4Y1ZA 4CDXB 3AFKA 2W92A 5EJZB 2R0FA 5FDBA 4QKBA 4D7SA 4EN6B 3OGRA 1IPKA 2WLQA 5IHRA 1D2SA 1SLTA 1HRV3 3GBFA 1JODA 3U10A 3BGAA 3OY8B 2JD9A 1Z7S3 2QQUA 5LK5A 1LOEA 2A71A 1VB2A 2VZUA 1BXHA 2EIGA 2YY1A 3POFA 3SH3A 1WCDJ 4YVSC 1C5IA 5CKQA 1EP0A 5L7OA 4IE6A 2VCBA 3KCXA 3AB0A 1S4CA 3MV11 4M00A 3APBA 3H1MA 5T5OA 5F9TA 4RS5C 3ZYGA 1XJAA 2FCVA 1V9U2 1WZXA 1UKRA 3BOWA 3IKWA 4QDSA 4HPKB 1UPSA 5IAVA 3MW4A 4DRVA 2AENA 5APAA 2EF6A 3WF1A 2VH9A 1HJFA 3GCWA 4RQPB 5IT6A 2VZ3A 1W28A 1S2KA 4Q8LA 5FXVA 2N7GA 2QQOA 3U1XA 5FZKA 3RYPA 3WQ7A 2PQQA 1WGPA 1GWKA 4V2VA 5C7GA 4XOGA 1IG3A 4RS5B 4KNCA 3Q8EA 3VB9A 5FZ6A 3AKRA 3D3AA 1F15A 3LA7A 4IEZA 3TN91 4E8DA 1VP6A 4GWJA 3CDZB 3AP5A 1XC6A 1B09A 1CX4A 1HRV1 1W8OA 2WS92 4MHUA 4PLOA 1OA4A 3V65A 4UW4A 3WQBA 4CDUA 1Z7S1 2ZZJA 3AZVA 3D0JA 1ND2A 2HWB3 3MICA 3T09A 5GZCA 2Q1MA 3BI3A 4GA9A 2D5HA 4LBQA 5FZDA 2V4VA 4KG8A 3TWIA 2E6VA 5JOYA 1H1AA 2FMDA 4RFT0 3O1MA 2NYYA 1W6PB 2F6BA 3T2OA 3VBHA 2VCCA 4XFIA 4QKNA 4BIFA 4QXKA 3JU9A 3CJXA 3D4KA 1W6QA 2JKXA 4Y5SA 4YARA 1LGCA 1KD7A 1RMU3 3FBMA 3LOBA 4OUMA 1W2UA 1Y7BA 4FQ4A 1UOGA 1X8EA 4MUVA 2K9ZA 1TMF2 3M3IA 4N7UA 5FZEA 1VBA2 3H8UA 3M7AA 3NNMA 4JGYC 5DAXA 3P1IA 4XBNA 1RJ8A 4Q0SA 3I3BA 1GICA 3FHQA 4UFMA 2EIBA 2HWB1 4ET7A 4F3JA 5JZGC 4K40A 1W0NA 3IZOA 3EBRA 4ZY9A 2VBDA 5FIXA 4MVTA 1YXWA 2DTWA 3LGRA 1P8JA 3PL0A 2QQWA 4JV4A 4L99A 3ACHA 1JMUB 4JGYB 2D6MA 4PI2A 1F35A 5FYYA 3JD72 4AK3A 1HV1A 2VVFA 2NM1A 1B35A 2XL7A 4B7EA 1HRI2 3QD6A 1I5ZA 2D3SA 3KB5A 3W9AA 5JI9A 2BRTA 1PK6A 2WZR3 4TXWA 1PIV2 1JYIA 2PN5A 1NOVA 3DGTA 1RMU1 2W08A 1D4M3 3JQXA 5C5TA 5BNNA 4PT6A 3QH7A 1WLDA 3LE0A 3J7MA 4ITCA 4UOJA 5FXZA 3IB3A 3MZHA 1AXYA 4IV3A 2W47A 3CO2A 4CP0A 4NHYA 1Y4WA 2YU1A 3BUCA 1TEIA 3B69A 2D7FA 3HQRA 4XQDA 2H0VA 5EV7A 2O14A 2HKXA 2OIIA 1JOJA 1MACA 1RUF3 2JENA 4FCAA 1HLCA 1RC6A 3OEAA 5K0UB 1ZZ7A 4Z2AA 4RGKA 4HSLA 4UW5A 3AP9A 4YZ3A 5J1XA 4Q4V3 5E88A 1GP4A 4ISRA 1TNFA 2MPFA 1UXZA 5A1FA 1OA3A 2JKBA 1SDDB 1LOAA 2W1WA 4GB32 1NA1C 3OGGA 4AOCA 4CVUA 1IS6A 2JXAA 4OLLA 3ZFEC 4A2UA 1PVC2 1RUD3 5H9RA 2WZR1 1UPIA 1CZVA 1H8TA 1RXGA 2E32A 2VZOA 1NT0A 1NZIA 2ZHLA 4RQPA 3USUA 2WAOA 5B2GB 2ZGPA 1D2QA 1V6KA 5CFDC 3U14A 1ODMA 4COWA 4HT1T 5JSPA 4B7KA 3PU3A 1NA1B 4IQPA 1HB1A 3NRUA 3RJRA 4LHNA 3VHOA 2Z2SB 4YZ5A 2QUOA 1CAUB 1H4GA 2C1FA 2WN3A 4HL0A 3C7OA 4QAWA 1XXNA 3NNJA 4IEPA 4BQ1A 3VHNA 1W8TA 3POWA 5FZHA 2ORXA 4XILA 1AL0G 4LIVA 2I2SA 3E6CC 4C1XA 3PVOA 4JGZA 3H8RA 3CL1A 4QQHA 2GC1A 4MGIE 4Q4V1 3FLTA 3HT2A 4AFBA 3MPBA 4CU6A 1I5PA 2VUDA 1MS8A 4LTAA 5IK5A 1Y3TA 5FLIA 4GD4A 5JCTA 5KXCA 4Y1VA 1UX7A 4GH4C 3DPRC 3GXUA 2W68A 4HKLA 2WT0A 3MO4A 2QQLA 4AQTA 1RUD1 1W6PA 3AKTA 2VVEA 1F4HA 2CWMA 4LO5B 2GNTA 3UNPA 3LEGA 4E2GA 2ID4A 3S5AA 3USSA 3FHIB 3IBMA 4BOWA 1UU6A 3Q8BA 2WYSA 5KC6A 1XSQA 4QU2A 4GH4B 4QX5A 4K21A 4LK7A 2QCSB 3Q8AA 5I0TA 5IYYA 1O91A 3ZYIB 2BERA 1K5MC 4Y22B 3IIAA 3BVCA 3OGVA 4WM8C 3O1VA 2YFZA 3ZFFC 1GQGA 3ACLA 2WT1A 4PF1A 1V6JA 2XONA 2YUEA 3P3NA 1W8FA 2ERFA 4UT5A 2ZS6B 4Q4Y3 2VMHA 2W2IA 4O65A 1DBNA 2EXJA 4X6RB 3KZ4C 1RYYA 3DF0A 3ZSJA 2VOTA 1HQWA 4OFGA 1LHUA 4MX3A 4NRQA 2VZTA 2YROA 4KWJA 4P08A 2WA4A 4PHZA 3AX4A 4WM7C 2VOVA 1QNWA 1UMZA 3ENRA 3B93A 1W6MB 1L7LA 3CLPA 1ACCA 1HKDA 3OYWA 3WNLA 1PM4A 1S0BA 2W5FA 1POV3 2RG4A 2XWJB 2R072 5EYYA 2JG8A 4EZ4A 5K7PA 2HWD3 2ZGNA 5IJRA 1UY0A 1WCSA 1XOYA 4XURA 4AHZA 5EFUA 3THPA 2WZEA 3VBUC 2XMLA 1ASJ3 3AYEA 1N47A 5FZ0A 3I3QA 5DN2A 2E9QA 3X29B 1Z0HA 2ZABA 3THTA 1AR62 4XYXA 2C26A 3PMSA 2WL1A 3I59B 1OD3A 4YVWC 3E5UA 3O7OA 4BIOA 2XJVA 4FSJA 4AAPA 2WR9A 3WDVA 4BZ4A 1QH6A 4MLOA 2D6KA 4N90A 1RUG2 4Q5OA 1QF3A 4RHV3 3D0SA 5F3CA 2WQZC 2DFCA 4NVPA 4Q4Y1 1JN2P 4S2GA 1SLCA 3LF7A 1ZBE3 2QKDA 4P9GA 4YRDA 3RQ0A 3RYRA 2J1AA 1GANA 1W6OA 3NJXA 1F5FA 1GUIA 4QXCA 1XYNA 1R1A3 2YC4A 5F7UA 2WAAA 1W9FA 5CEHA 4JKKA 4BA6A 2ZACA 2ZA9A 3AC0A 2RDSA 2W39A 1BZWA 3OUHA 4LHLA 2BZDA 2GALA 5EJ3A 1D7PM 3AVSA 2ILMA 1DGWX 2UWAA 3PMEA 5JOWA 3H8OA 4WV8A 2WNVC 2PHXA 2HWD1 2G9ZA 1OSGA 4QB2A 4AEDC 1RVF1 5FZIA 1GZWA 1CAVA 4EJRA 4PLNA 1MQTA 1ASJ1 3VDCA 2E31A 2RMU3 3ACGA 2B45X 1M4WA 1URXA 2JDPA 2Z4FA 1CJDA 2GDFA 1RUC1 3J7LA 2VL4A 5BUVA 2D43A 2NP0A 4QXHA 3MPPG 2VBPA 3K3NA 1JYXA 4AEDB 3HQXA 2GMEA 3VZJA 4DRRA 4X6QB 1EAH3 3H0OA 4RHV1 4FI9A 4XAAA 1AR82 1GV9A 1X7NA 3IMMA 2BVBA 5GALA 1AVBA 1NXMA 1ZBE1 5LA9A 1BKZA 5DAPA 1H30A 4ZS2A 4BMBA 3DL3A 5FBZA 4CCNA 1H8VA 2VAUA 1WW7A 3VDDC 1R1A1 1EV13 3T3YA 3I49A 1JU4A 1REFA 2EALA 2P3JA 4OHZA 1JZ4A 2G9FA 1OQEA 4OQ9A 3L2HA 4B8EA 2DVAA 5J09A 3CZJA 2RV9A 5I8TA 1RHI1 1U5XA 1W04A 2Y0IA 4QPGA 3OOXA 4LEJA 1BK1A 2IFWA 4CEYA 4ZZ5A 1JZ6A 1O8PA 1VBC2 4XF4A 2D6OX 2DYCA 4KMQA 3FJSA 3VDDB 5ABJA 1SBDA 2IXHA 2RMU1 2A6WA 1UYXA 1JOBA 2R042 4CP9A 3N9NA 4TZDA 4K1YA 5GZDA 3ACFA 2JG9C 3R4UA 2R49A 3PJYA 3WOGA 3WF3A 2B9VA 2XLFA 4B1MA 1REEA 5FCCA 1FV2A 1CN1A 3RI8A 1EAH1 2ZZQA 1LR5A 1VRBA 1W2TA 4OHVA 4LBOA 4DY5A 5FO7B 5J37A 3I3MA 3POBA 2J1RA 3I7DA 4RFRB 4AFMA 2RJKA 3PTRB 5A3TA 3OD4A 2PXJA 3ZYRA 3UGGA 5GLVA 5C4WA 2HEYF 4LOTA 1VRH2 1RITA 2PHFA 5F3IA 5JVVA 5BPXA 3RMYA 1VR3A 3WP3A 4N8MA 4AXOA 1O59A 1IPJA 3K46A 1R64A 2X10A 2WIIB 5E89A 1HDKA 5EPAA 3VKOA 1NUKA 1H2LA 3A23A 3E5QA 4MSVA 1JBCA 2HJIA 5F2SA 5A33B 3VBOC 3Q8CA 1LTEA 2Z5WA 3E1F1 3UL2A 5A32A 1FMD3 4W8JA 4YW3A 3JZVA 5E6HA 5FMCA 3V0AB 4BLIA 1TME1 2HH9A 3BIEA 3CNAA 1MS9A 4XC9A 1RUH2 4XBLA 3L2YA 4LHSA 5KHKA 1ULFA 2YB7A 2NN8A 5FK7A 4A44A 2XJRA 4XEZA 1JI6A 2A6ZA 4QB1A 1RIRA 1YQ8A 4GWNA 3VBOB 5L9VA 2PMWB 1PO13 5JXJA 2BFUL 4FPHA 1YIPA 4XIOA 5A6QA 3RZJA 4XF0A 3Q9OA 4GZ9A 4DEVA 3SH5A 4XXPA 2Y6KA 2VO5A 5E1RA 1GOFA 3CF6E 1FPN2 3KT7A 5CB7A 4MZUA 4BQ3A 5IK8A 1IKQA 4XTMA 3MYXA 2ADEA 1W9TA 1MEC3 1O5LA 1VAMA 4JQRA 4AGRA 1REDA 1TQ5A 1XU1A 3VBSB 3MHZA 3B00A 4R52A 1OLQA 1UO9A 2XH6A 2DU0A 2LRPA 3LCPA 4KG0A 4LO8A 5A6YA 1IQDC 4P9WA 4AW7A 2VTXA 4L97A 4Z2WA 2QTWB 1FMD1 2Y60A 2GC2A 3BOPA 3CEWA 4FP2A 5JWPA 3UETA 4PJYA 4MHRA 5LRRA 2X53S 4LLOA 1XNTA 3ZKYA 5ACA2 1LAJA 4MGTA 4KBZA 3UK9A 3WNMA 5H9QA 1VBB2 1UY4A 5KBFA 1W2NA 4RN5A 2ZPXA 1PO11 2TUNA 4UW3A 4H3WA 3KVBA 1QQP3 5J7MA 3W5NA 1W03A 2Y8KA 2ZX0A 3AMHA 3N3HA 4J1XA 4Q0PA 4WVMA 2DUPA 2J1TA 1PGW2 4MADA 4XBQA 3NO8A 3S7EA 4E4SA 2A73B 2C24A 1LCLA 1WMDA 5D21A 4LKDA 2GP5A 4CRQA 1Q8VA 5ERLA 1K5JA 2XG3A 5D8AC 1MEC1 5CA6A 1O3TA 1ZRCA 1TVGA 1PGSA 3WINE 2QDRA 4FFIA 4FPKA 4YFZA 2VNGA 5EHDA 4IEQA 3UKTA 3U78A 1NLQA 4YZ1A 4RR3C 3OBTA 3J8F3 5F6KA 3T2PA 2BP6A 5IK7A 3IIIA 1ZBA3 4FAHA 3VKMA 5GZEA 2PLV2 1W39A 1HB4A 4NIIA 4Q4W3 5C71A 3VBRC 3FX3A 3J7HA 2IWGB 5JUVA 5FKCA 2VQTA 5DXDA 5KXDA 1YFYA 2FZ1A 2H0BA 4IEUA 4LK6A 4IEVA 5FY7A 5A3MA 1QQP1 3HBKA 3SC7X 4YPJA 3KMHA 4GKYA 1QXPA 2EIEA 5FYSA 3K48A 2V5DA 1YQCA 1NCRB 2UU8A 4AEJA 3DKQA 3LKJA 2JDZA 4Y4YA 5CYYA 4DINB 1BEV3 3K75B 2V4AA 1RJ7A 2TBVA 3K51A 1KDKA 4GJYA 2VJXA 3RG0A 2A3XA 2PHTA 1OVPA 1QXRA 1UZYA 5I0UA 1U5YA 5IVVA 1WD4A 3H8XA 3MUY1 4RGAA 4CCJA 5LRSA 2RM23 4UWDA 1ZNPA 3J8F1 4QX0A 4P5YA 1UXXX 1GZCA 1ZBA1 4HK8A 4KWLA 1UL9A 3POGA 1LHOA 1RUE2 3I2OA 1F2NA 5C8CC 4CU7A 5L7OC 4W50A 1V6MA 4LBLA 4DUWA 2D44A 4HVQA 3V0AA 1LOBA 3WDXA 4FFFA 4BXFA 2RS12 2E63A 3OJBA 5A1AA 4KGGA 5AC93 2TNFA 4Q1RA 1OQ1A 2HWE2 5LA2A 3ZXJA 1ZREA 4HG6B 3JBG1 3T1LA 3GDBA 2GN3A 4CP1A 4R4ZA 1KFXL 1N1SA 1MZ6A 1XNDA 2GP3A 2XJSA 2VOXA 3N7JA 1QDCA 4P9IA 3UYJA 5L7OB 1KDMA 3KV6A 1O3RA 1FOD3 4PBPA 2NMOA 1HW5A 3WG1A 5FP4A 1BEV1 3NV1A 4Y24A 3T0AA 4A42A 4KI5M 1UOJA 2ZHMA 4CDWA 4EWAA 2HWC2 1OA2A 2WSUA 5IUQA 2ES3A 2VZRA 4FTBA 2YHJA 1ALYA 3JQWA 3LSDA 1JYWA 1QJEA 3PHMA 1IZ3A 2RM21 1NE4A 3AMNA 4LITA 4FPJA 4NIGA 4G9SB 4RA0A 5FZMA 4ZU7A 1CWPA 5LB6A 2XB6C 3BKZA 1IG0A 1IGOA 1ZM1A 2GC3A 4FXGB 3ZXLA 4K8RB 2OW4A 1OUSA 4I09A 5A7OA 3I2KA 4CDUB 1W99A 5AC91 4AVSA 4C8DA 3MGUA 5FKBA 2DBNA 1W8WA 4SBVA 1ND2B 3VBHC 4E4ZA 4LT5A 1KXGA 5JXGA 4URAA 1I6XA 4EQVA 1KS4A 3S57A 2VUAA 4BMEA 2J1EA 2FCTA 4N7IA 1ZRIA 1DLCA 4LBQB 3WDTA 3VLBB 2XKPA 1QY4A 3EB7A 3ELNA 3FBYA 1YNAA 2EXHA 4I0BA 3FC0A 4A7KA 1ZZ8A 1QJU3 2FHRA 3FFQA 3VBHB 5FPXA 3MW2A 1W6QB 4FPFA 3PNAA 1QJFA 1SFPA 1KEXA 4CPBD 2A75A 4XJWA 2Z42A 1X33A 5GZFA 3VV1A 1QHDA 3WHTA 1JH5A 2IFRA 3WF2A 3HOBA 3VBFC 2XGXA 3ITQA 2CY6A 2GH2A 4P9XA 4AYUA 5LBFA 4B3NA 3DECA 5DUVA 2QQIA 5FP3A 3N9PA 1CJPA 4IXLA 4EN7B 5C9AA 1ULPA 5FUPA 3KLSA 2HBUA 4FPOB 2QBXA 2JECA 5FWEA 1AYN2 1B35C 1QJY3 2EA7A 3GJAA 1SQ4A 1X82A 3HR9A 2R1DA 2JDHA 3KSCA 3N7KA 2ZGLA 5BNNC 2BYVE 2KM2A 2JIGA 3H7JA 2CWSA 3NNLA 2X8KA 2ZTNA 2OQ6A 3HQUA 3NNGA 3TNQA 3WSOA 3T4HB 4ATEA 3LFMA 1UWWA 4EWEA 4IV3C 1B35B 3WX5A 4DB5A 1QJU1 4QX7A 4XE9A 2AYHA 2DVDA 1PK6B 2Q4SA 2XXZA 3UESA 4CDXC 3GCXA 3HPNA 3TEYA 2W1QA 3A21A 4CYDA 4K9SA 5BNNB 3HWJA 1NY71 3PVEA 1X8MA 4Y5TA 2WNUB 4IV3B 3POEA 4HFSA 5C3QA 5D2AA 1OLME 1QJX2 2FDFA 1Y9QA 4LBNA 2PYTA 4OMCA 2Y33A 5JMOA 2ZGRA 1COV2 3GGLA 1CESA 5FPAA 3K4AA 1Y9GA 4GALA 3QACA 3UKVA 4CUGA 5FV3A 5DABA 3CBNA 3T1MA 3VZMA 1QJY1 2W91A 5JOXA 4IGQA 5F37A 2P37A 4AQ6A 1LESA 3OSDA 1AF9A 3R05A 4IEWA 4K7JA 4O7XA 4A3ZA 3ZFGB 4RQPC 4DNYA 1PO21 3DXUA 3ZDSA 3SITA 5FJHA 4Z1VA 3RDIA 5FLJA 1O3QA 2B9UA 3LZZA 4BCUA 5CBLA 3A4UA 1MR5A 1ENRA 1D4M2 2ARXA 2ZGTA 2W9XA 2ZX3A 3BODA 4IE0A 3UKNA 4XFCA 3P6BA 3KGLA 4L11A 2WFF3 1NLSA 1H8TB 3T2QA 1VBE3 3USUB 1DCSA 1ZA7A 5CG8A 5BY5A 1WLCA 2RDQA 4JGZC 1ENQA 3VN4A 4HOOA 4ASKA 1AX0A 2P6HA 2D98A 1T6BX 4LKSA 3POYA 1RUF2 4B29A 3C3VA 2DWRA 1E5SA 5FYCA 4AI3A 2VNOA 2VMEA 4IE5A 4XTPA 3U37A 5FZAA 5K8SA 1O4TA 3MF9A 3WDWA 2CYFA 1ULGA 3LB9A 4BWOA 1OKQA 3C7HA 4WVZA 1AJKA 4JGZB 4CSWA 1OF3A 1W0PA 1DGLA 2AREA 3GHMA 4QGNA 4XZPA 4XDOA 3RNSA 3QCWA 3ZVXA 5HCAA 5TSWA 4JCKA 5C6CA 1NXD1 2IUWA 2W3JA 1JYTA 3ZOIA 2WWSA 1GZTA 4Y1XA 1BMV1 3ATGA 2PAMA 3KCCA 3POJA 5I93A 5A3OA 1SMVA 2WFF1 1H1IA 1LKNA 1VBE1 1W8NA 2Y26A 3ALQA 4XFBA 4AHYA 1OQDA 3WNOA 4CEWB 3PIJA 4JTOA 1U12A 5B4XA 3VL8A 5GLUA 1OUXA 4M3CA 1O6UA 5LEKA 2QNKA 4PLMA 3ZO0B 2WYFA 2EAAA 3ZYBA 5CFCA 3INAA 2BNOA 1ZX5A 2MEV2 4JKLA 1BQPA 4LUKA 4LKFA 4B4PA 4AFDA 4AI1A 4XUPA 1MS5A 1QXJA 1NCQA 4O9EA 1CGPA 1Z78A 2G19A 1A8DA 2YBKA 3A0NA 1S0GA 3VD5A 2JG8C 1UYPA 4D3WA 4DUXA 3PVNA 4I01A 5BXXA 2FDIA 5C33A 2VOKA 1LHNA 2OQ7A 5FY8A 5AFEA 1VE0A 1RUJ1 4COZA 1K42A 1VBD2 1KS5A 1NYWA 2A6VA 1RUI2 2Z69A 3OCPA 4FPCA 1ZRDA 3KCYA 5KHJA 4XFAA 1UN1A 1Y43B 1W8UA 4RL7A 2VMFA 3NL1A 4J25A 3AP6A 2J22A 3LAGA 3OYWB 4DZGA 2OT7A 1XE7A 1LOGA 4N43A 2JG8B 4INDA 4OZOA 2R063 5LCWL 1O3SA 4IE4A 5JOZA 2RDNA 3WUDA 3ZMNA 3IWZA 4A41A 3WG2A 3POSA 5JLVA 3RSJA 4NPLA 2DVBA 5K0UC 1WW5A 3WDYA 3AKPA 3VGIA 4ASMB 2WNUA 5AVPA 1GP5A 3RZGA 3QBQA 4OUSA 2YDEA 1LEDA 5DDJ2 3VD4A 3PUSA 3M8LA 3E6BA 2Y6HA 4JC1A 4OI0A 4XJAA 3AM2A 4JHTA 5HV0A 3O1RA 4JHZA 3Q8FA 4Y33A 5FP9A 4UFHA 4DY3A 1H6YA 1LJ7A 2P3IA 3AZXA 4XUTA 3ZM8A 4FOQA 1W6OB 4Y4RA 3ZFGA 1S0IA 5JXHA 1J3PA 3RZHA 1V9U3 2ZKNA 2DURA 1V6LA 2GC0A 5FUNA 2E33A 5FRAA 2RE9A 4PDWA 1VMFA 4ZXEA 4Z92B 3DXTA 2K2SA 4YGBA 2SBAA 2IXKA 3AP7A 1TNRA 2R061 4PI0A 5K9YA 3VDAA 2JDYA 3QLQA 5CIRA 2ZBJA 4YGDA 1GZWB 2P2KA 5FZFA 3ZYHA 4YZ4A 1CAVB 3K2OA 3RS6A 1MQTB 5J3UA 4BQWA 1QH7A 4HVRA 5FZCA 2VZPA 3WCRA 5BNPA 5JAXA 1KRIA 4UFJA 1DZTA 2IXJA 2QQJA 4DQAA 4E4HA 3M3OA 4ES8A 4AVCA 3ILRA 3V0BB 2P6CA 3N9LA 3OPWA 2WS93 2D3PA 2CGPA 1YQ6A 2BQPA 5CISA 5C5UA 4D7TA 3KVAA 3C7EA 4FTEA 3M1HA 1UCXA 1YWKA 3AXEA 2QVSB 1AR92 2XQRA 1YIFA 4XXAA 3D8CA 2FMYA 4BQ5A 4DXZA 5IFTA 3G6JB 1UMHA 4H14A 4CEYC 4QM8A 1W3VA 4HKWA 4CXXA 2YU2A 5GJ6A 2ZAHA 3M3CA 2YXSA 5AVAA 4YW4A 1V9U1 1PGL2 4YVSA 3K4ZA 2X09A 5FZGA 4W6WA 4ONUA 1WD3A 4MO3M 4MGYE 5C3OA 5FPBA 2UYBA 5EYXA 4NPMA 4KWKA 2XLAA 1CR7A 4QPGB 4CEYB 2A7AA 5F1RA 4O61A 1FYUA 4AFAA 3B5LB 1E5HA 2LROA 2E7AA 4CEWA 5ABJB 4D6QA 5GM0A 3O0XA 1TMF3 4AHXA 1VBA3 4CP9B 1J1LA 2PQSA 4R9DA 4C91A 2XBO2 4YG6A 1C5HA 3O0VA 2ZMNA 2WS91 1UY2A 1C8M2 2RHPA 3WR0A 4COVA 3OBZA 5C4WC 3O5SA 1U0AA 1QKQA 5A7QA 4EE2A 1A8MA 5FJKA 4HXCA 2AC1A 4ATFA 2R6QA 2HWF2 3IT8A 3LDKA 5DZEA 1EV12 3AL5A 3F2ZA 2WT2A 4GMP3 3C7FA 5JMCA 1R092 3NKTA 3M2MA 3WCSA 1NE6A 4A7YA 5FMOS 3R6SA 1GSLA 5FXXA 2ZCWA 4N9IA 2J7MA 3JD73 3VDBA 5HCFA 4NIHA 1AR72 1V6NA 5FZ3A 5FY0A 5FK8A 5C4WB 1HRI3 3DYMA 1UD1A 3ECQA 3H3LA 2LW8A 1PIV3 5T3NA 1C3HA 1SPPA 2DUQA 4O9GA 5FZOB 4GIQA 5FYUA 4AZZA 1QOTA 1QOSA 1RVF3 2GH8A 3AMMA 4C90A 4F8AA 2DCJA 3WW3A 2B7YA 2B4KA 3I2FA 1YFUA 4CP2A 2WRAA 4YLZA 1XU2A 1TMF1 2C9KA 3OBRA 3SKJE 1WBFA 1F31A 1VBA1 1PNFA 2DCZA 4BK4A 3SLIA 1RUC3 3PUQA 5A32B 4OQ8A 1HIXA 1FX5A 3LIGA 1Y9MA 3MDPA 5JR2A 4NRPA 4OI2A 4BU2A 1G7YA 4GXLA 4JTNA 5G05L 1O4ZA 3HNYM 3BTYA 1DFQA 3WG4A 5FFOC 4XUOA 4XIKA 1DZQA 4GMP1 2WQ8A 5JZGA 2BV4A 4GB33 5E16A 1K45A 3QH6A 3J26N 3JD71 3NMBA 3NV4A 4M4PA 4GAZA 3ZPYA 4FOYA 4XJ9A 3BN6A 1APNA 3IDCB 3VZNA 1HRI1 1PVC3 3W59A 3WF0A 1PIV1 3UJQA 4AGVA 2VTXJ 1SBFA 1YCIA 1MS0A 1R082 3ZSEA 3ORJA 1UOBA 5IVBA 1Q3EA 2HYXA 1DQ5A 1RHI3 4Q4X2 3D82A 1ND3A 3B01A 4M3CE 4G4FA 3I2GA 5DMYA 3S30A 4YW2A 4XF9A 1NQJA 4HANA 4YG3A 4BQYA 2AR6A 2GSYA 1G8WA 4Q0UA 2FDKA 3FHAA 4XDPA 4CDQA 5G04L 3V0BA 5IW0A 5EWSA 2B39A 3HNBM 2V5YA 4B4QA 3ZKUA 2PA7A 5A7NA 2JE9A 2QDNA 5DAQA 1LULA 5LA1A 3LA3A 2EIDA 3FUOA 3NV2A 3JB8A 4Z07A 3PVBB 1LU2A 3QOPA 1WCUA 2JD4A 3ZSKA 3O1OA 3KM5A 1ULDA 1BLZA 4IE7A 3S5QA 3WVJA 4GB31 3AKQA 4PBOA 4WVMB 3T2TA 2DBIA 1BHGA 3NAPB 2VTFA 4B4RA 1DP0A 5FP8A 1PVC1 1SFYA 5A3WA 2VBBA 4Y26A
chains in the Genus database with same CATH topology
4MOAA 5JUVA 2VQTA 5DQ0A 4QX2A 4DXTA 5B4NA 4YPJA 2EIEA 3T0BA 5EJZB 2W92A 2V5DA 1GOHA 3ETPA 3OGRA 5CYYA 5IHRA 3K75B 1US3A 3BGAA 2VJXA 2JD9A 1UY3A 2VZUA 4OYUA 4P02B 3OEBA 3GM8A 2YFUA 3MUY1 3VD7A 3WNKA 2VCBA 2JDAA 3MV11 4QX0A 4P5YA 1UXXX 2EICA 3K4DA 4QDSA 4CU7A 4DUVA 4W50A 4DUWA 2XQXA 3WF1A 2VZ3A 5EJ1B 4LQRA 5A1AA 2QQOA 1JZ7A 4E8CA 5LA2A 4CUBA 5C7GA 4HG6B 2WABA 4D0QA 3GDBA 2J1SA 3D3AA 1CZSA 4E8DA 5HXMA 2ZEYA 4GWJA 1W9WA 3CDZB 1XC6A 4A42A 3T0AA 1W8OA 4KI5M 3WQBA 2VZ1A 3SEEA 2VZRA 1T2XA 4ARXA 1JYWA 2DDUA 3T09A 2W46A 3OGSA 3CMGA 1PMJX 1NKGA 2V4VA 1PX4A 4OMDA 3ACIA 4RYDA 3T2OA 2VCCA 2JKXA 3I2KA 1W99A 2RVAA 1K12A 4A6OA 5JXGA 1WCQA 1GMMA 3FL7A 2J1EA 2VCAA 1DLCA 1PMHX 4L0PA 3EB7A 3P1IA 2XOMA 3I3BA 3FHQA 2EIBA 4ET7A 1KEXA 1W0NA 3NJVA 2WO3A 4ZY9A 2L9LA 2ORZA 1P8JA 3WF4A 3WF2A 3HOBA 2ZEWA 3ACHA 1CIYA 3DECA 2QQIA 1J83A 1ULPA 4TXWA 2LS6A 2QBXA 3CQOA 3THCA 2W87A 4PT6A 1UMIA 3LE0A 4UOJA 4XUNA 3IB3A 2W47A 1GU3A 3NNGA 3WSOA 1UWWA 1SHWB 3OEAA 3UESA 2VQUA 1W9SA 3HPNA 4Z2AA 2W1QA 3A21A 5J1XA 1MPXA 4DXRA 1UXZA 1SDDB 2W1WA 5FUIA 2Y6LA 4CVUA 2CDOA 4AAXA 4QX1A 4GWIA 4OMCA 4QX3A 5JMOA 3GGLA 4DXSA 3K4AA 1CZVA 2V72A 2E32A 4CUAA 2VZOA 1KGYA 2WAOA 2W91A 1GNYA 4A3ZA 2OKXA 3NRUA 3VD9A 2J1VA 4TTGA 2XHNA 2WBKA 2WN3A 4KWUA 3C7OA 4QAWA 3OB8A 3IAQA 4XVHA 2W1UA 2ORXA 2QQNA 2W9XA 2WO2A 3P6BA 5JXIA 3T2QA 3SEPA 4MGQA 4CU6A 1JZ5A 1I5PA 1GQPA 3JXSA 4CU8A 1EUTA 4LKSA 1UX7A 3GXUA 3MO4A 2QQLA 2VMEA 3U37A 1JZ2A 4AG4A 1F4HA 3FN9A 5EIYB 3UNPA 3LEGA 2ID4A 3HNMA 3C7HA 1OF3A 2WYSA 2R7EB 4CUCA 3DYPA 3MBWA 3WEZA 5IYYA 2BERA 5LA0A 2W3JA 4XUQA 3OGVA 2YG0A 2BGOA 2YFZA 4PF1A 2XONA 1W8NA 2Y64A 3WNOA 3HEIA 1RYYA 2VOTA 1LNSA 5B4XA 3CKHA 2RJ2A 3A7QA 2VZTA 4P08A 1ULOA 5C70A 3WNLA 2W5FA 1EUUA 2HLEA 4JKLA 2W1SA 4XUPA 5IJRA 1UY0A 4XURA 3IAPA 3VD5A 2WZEA 3EYPA 4DUXA 1XPWA 1K42A 5DN2A 3I2IA 1L7RA 1UY1A 2C26A 1JHJA 2VMFA 1OD3A 2VR4A 2Y6GA 2J22A 4BK5A 4OZOA 4W4ZA 5LCWL 2DCKA 3C7GA 3HN3A 1JYNA 1OH4A 4A41A 2W94A 3LPGA 2J1AA 3NJXA 1GUIA 4UI9L 2YC4A 5F7UA 2WAAA 4JKKA 3AC0A 3DYOA 1CZTA 5I0DA 2BZDA 1D7PM 2VC9A 2CDPA 4QB2A 3VD4A 2WDBA 2Y6HA 4ZZ8A 1J84A 4JHZA 1SG3A 1H6YA 4JKMA 3W5MA 3VDCA 4QB6A 4XUTA 2E31A 3ZM8A 3ACGA 3T0DA 2Z4FA 5JXHA 2VL4A 2WN2A 1H6XA 4D8MA 2E33A 2Y6JA 1JYXA 4ZXEA 3HJRA 4FI9A 1L7QA 3VDAA 1UYYA 2VM9A 2VZPA 2BBAA 1JU4A 1K3IA 1JZ4A 2QQJA 1JU3A 1OF4A 3A22A 3CZJA 3WNPA 2RV9A 2QQMA 3C7EA 1JZ6A 4ZZ5A 1O8PA 3I3EA 1F4AA 3OG2A 3LPFA 4KMQA 1UZ0A 5IFTA 5DPNA 1UMHA 3NQHA 4JX0A 1UYXA 4PQQA 2WZ8A 3I2HA 3OBAA 3ACFA 3MUZ1 3K4ZA 2X09A 3IDAA 1JYVA 3WF3A 2B9VA 4MO3M 4BDVB 2E26A 2KD7A 2VMDA 4P00B 2W95A 2J1RA 4ARYA 2J1UA 5HPOA 3VD3A 2PQSA 3LEKA 4LPLA 2X05A 1UYZA 1CX1A 1UY2A 3PUHA 4IUGA 1O59A 3K46A 5IFPA 1R64A 2ZXQA 2X10A 1YQ2A 1OT5A 1NUKA 3A23A 3F2ZA 3C7FA 4BXSV 3I97A 1US2A 3E1F1 2WUHA 2J7MA 3I2JA 4QDQA 4UAPA 2C4XA 4W8JA 3VDBA 3DYMA 3ECQA 2LW8A 4LHSA 3LQCA 2YB7A 4A44A 1JI6A 3CZUA 4QB1A 5JXJA 3LEIA 4GZ9A 2DCJA 4DEVA 3I2FA 2B4KA 4MGSA 4A4AA 2Y6KA 2C9KA 2VO5A 3SKJE 3MV01 1WKYA 3WNNA 4BK4A 1GOFA 3T08A 4DEQA 4OUEA 1W9TA 5JR2A 5G05L 3C8XA 2VMCA 3HNYM 1NAEA 4XUOA 1IQDC 2WQ8A 2VZSA 1K45A 2QQKA 1HN1A 4M4PA 3SKVA 1PX3A 3BN6A 3WF0A 2JE8A 1DYOA 3UETA 1GOGA 1XNTA 1JZ3A 2VZQA 3WNMA 2HYXA 2ZEXA 2VZVA 1UY4A 3PUIA 2YC2A 1NX9A 4RN5A 3I2GA 2BGPA 5DMYA 1JZ8A 3W5NA 4M4RA 3THDA 4A45A 2Y8KA 4CU9A 3I3DA 2J1TA 3FHAA 4MADA 5G04L 3CIHA 4QDRA 3K77A 3HNBM 1TVGA 2ZEZA 5LA1A 3ABZA 2EIDA 5CZKA 1XNAA 3T2PA 4XZUG 3IIIA 1O8SA 4BJ0A 4QPWA 1TG7A 1BHGA 2WO1A 2VTFA 1DP0A 5C71A 3J7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MOA A;  5JUV A;  2VQT A;  5DQ0 A;  4QX2 A;  4DXT A;  5B4N A;  4YPJ A;  2EIE A;  3T0B A;  5EJZ B;  2W92 A;  2V5D A;  1GOH A;  3ETP A;  3OGR A;  5CYY A;  5IHR A;  3K75 B;  1US3 A;  3BGA A;  2VJX A;  2JD9 A;  1UY3 A;  2VZU A;  4OYU A;  4P02 B;  3OEB A;  3GM8 A;  2YFU A;  3MUY 1;  3VD7 A;  3WNK A;  2VCB A;  2JDA A;  3MV1 1;  4QX0 A;  4P5Y A;  1UXX X;  2EIC A;  3K4D A;  4QDS A;  4CU7 A;  4DUV A;  4W50 A;  4DUW A;  2XQX A;  3WF1 A;  2VZ3 A;  5EJ1 B;  4LQR A;  5A1A A;  2QQO A;  1JZ7 A;  4E8C A;  5LA2 A;  4CUB A;  5C7G A;  4HG6 B;  2WAB A;  4D0Q A;  3GDB A;  2J1S A;  3D3A A;  1CZS A;  4E8D A;  5HXM A;  2ZEY A;  4GWJ A;  1W9W A;  3CDZ B;  1XC6 A;  4A42 A;  3T0A A;  1W8O A;  4KI5 M;  3WQB A;  2VZ1 A;  3SEE A;  2VZR A;  1T2X A;  4ARX A;  1JYW A;  2DDU A;  3T09 A;  2W46 A;  3OGS A;  3CMG A;  1PMJ X;  1NKG A;  2V4V A;  1PX4 A;  4OMD A;  3ACI A;  4RYD A;  3T2O A;  2VCC A;  2JKX A;  3I2K A;  1W99 A;  2RVA A;  1K12 A;  4A6O A;  5JXG A;  1WCQ A;  1GMM A;  3FL7 A;  2J1E A;  2VCA A;  1DLC A;  1PMH X;  4L0P A;  3EB7 A;  3P1I A;  2XOM A;  3I3B A;  3FHQ A;  2EIB A;  4ET7 A;  1KEX A;  1W0N A;  3NJV A;  2WO3 A;  4ZY9 A;  2L9L A;  2ORZ A;  1P8J A;  3WF4 A;  3WF2 A;  3HOB A;  2ZEW A;  3ACH A;  1CIY A;  3DEC A;  2QQI A;  1J83 A;  1ULP A;  4TXW A;  2LS6 A;  2QBX A;  3CQO A;  3THC A;  2W87 A;  4PT6 A;  1UMI A;  3LE0 A;  4UOJ A;  4XUN A;  3IB3 A;  2W47 A;  1GU3 A;  3NNG A;  3WSO A;  1UWW A;  1SHW B;  3OEA A;  3UES A;  2VQU A;  1W9S A;  3HPN A;  4Z2A A;  2W1Q A;  3A21 A;  5J1X A;  1MPX A;  4DXR A;  1UXZ A;  1SDD B;  2W1W A;  5FUI A;  2Y6L A;  4CVU A;  2CDO A;  4AAX A;  4QX1 A;  4GWI A;  4OMC A;  4QX3 A;  5JMO A;  3GGL A;  4DXS A;  3K4A A;  1CZV A;  2V72 A;  2E32 A;  4CUA A;  2VZO A;  1KGY A;  2WAO A;  2W91 A;  1GNY A;  4A3Z A;  2OKX A;  3NRU A;  3VD9 A;  2J1V A;  4TTG A;  2XHN A;  2WBK A;  2WN3 A;  4KWU A;  3C7O A;  4QAW A;  3OB8 A;  3IAQ A;  4XVH A;  2W1U A;  2ORX A;  2QQN A;  2W9X A;  2WO2 A;  3P6B A;  5JXI A;  3T2Q A;  3SEP A;  4MGQ A;  4CU6 A;  1JZ5 A;  1I5P A;  1GQP A;  3JXS A;  4CU8 A;  1EUT A;  4LKS A;  1UX7 A;  3GXU A;  3MO4 A;  2QQL A;  2VME A;  3U37 A;  1JZ2 A;  4AG4 A;  1F4H A;  3FN9 A;  5EIY B;  3UNP A;  3LEG A;  2ID4 A;  3HNM A;  3C7H A;  1OF3 A;  2WYS A;  2R7E B;  4CUC A;  3DYP A;  3MBW A;  3WEZ A;  5IYY A;  2BER A;  5LA0 A;  2W3J A;  4XUQ A;  3OGV A;  2YG0 A;  2BGO A;  2YFZ A;  4PF1 A;  2XON A;  1W8N A;  2Y64 A;  3WNO A;  3HEI A;  1RYY A;  2VOT A;  1LNS A;  5B4X A;  3CKH A;  2RJ2 A;  3A7Q A;  2VZT A;  4P08 A;  1ULO A;  5C70 A;  3WNL A;  2W5F A;  1EUU A;  2HLE A;  4JKL A;  2W1S A;  4XUP A;  5IJR A;  1UY0 A;  4XUR A;  3IAP A;  3VD5 A;  2WZE A;  3EYP A;  4DUX A;  1XPW A;  1K42 A;  5DN2 A;  3I2I A;  1L7R A;  1UY1 A;  2C26 A;  1JHJ A;  2VMF A;  1OD3 A;  2VR4 A;  2Y6G A;  2J22 A;  4BK5 A;  4OZO A;  4W4Z A;  5LCW L;  2DCK A;  3C7G A;  3HN3 A;  1JYN A;  1OH4 A;  4A41 A;  2W94 A;  3LPG A;  2J1A A;  3NJX A;  1GUI A;  4UI9 L;  2YC4 A;  5F7U A;  2WAA A;  4JKK A;  3AC0 A;  3DYO A;  1CZT A;  5I0D A;  2BZD A;  1D7P M;  2VC9 A;  2CDP A;  4QB2 A;  3VD4 A;  2WDB A;  2Y6H A;  4ZZ8 A;  1J84 A;  4JHZ A;  1SG3 A;  1H6Y A;  4JKM A;  3W5M A;  3VDC A;  4QB6 A;  4XUT A;  2E31 A;  3ZM8 A;  3ACG A;  3T0D A;  2Z4F A;  5JXH A;  2VL4 A;  2WN2 A;  1H6X A;  4D8M A;  2E33 A;  2Y6J A;  1JYX A;  4ZXE A;  3HJR A;  4FI9 A;  1L7Q A;  3VDA A;  1UYY A;  2VM9 A;  2VZP A;  2BBA A;  1JU4 A;  1K3I A;  1JZ4 A;  2QQJ A;  1JU3 A;  1OF4 A;  3A22 A;  3CZJ A;  3WNP A;  2RV9 A;  2QQM A;  3C7E A;  1JZ6 A;  4ZZ5 A;  1O8P A;  3I3E A;  1F4A A;  3OG2 A;  3LPF A;  4KMQ A;  1UZ0 A;  5IFT A;  5DPN A;  1UMH A;  3NQH A;  4JX0 A;  1UYX A;  4PQQ A;  2WZ8 A;  3I2H A;  3OBA A;  3ACF A;  3MUZ 1;  3K4Z A;  2X09 A;  3IDA A;  1JYV A;  3WF3 A;  2B9V A;  4MO3 M;  4BDV B;  2E26 A;  2KD7 A;  2VMD A;  4P00 B;  2W95 A;  2J1R A;  4ARY A;  2J1U A;  5HPO A;  3VD3 A;  2PQS A;  3LEK A;  4LPL A;  2X05 A;  1UYZ A;  1CX1 A;  1UY2 A;  3PUH A;  4IUG A;  1O59 A;  3K46 A;  5IFP A;  1R64 A;  2ZXQ A;  2X10 A;  1YQ2 A;  1OT5 A;  1NUK A;  3A23 A;  3F2Z A;  3C7F A;  4BXS V;  3I97 A;  1US2 A;  3E1F 1;  2WUH A;  2J7M A;  3I2J A;  4QDQ A;  4UAP A;  2C4X A;  4W8J A;  3VDB A;  3DYM A;  3ECQ A;  2LW8 A;  4LHS A;  3LQC A;  2YB7 A;  4A44 A;  1JI6 A;  3CZU A;  4QB1 A;  5JXJ A;  3LEI A;  4GZ9 A;  2DCJ A;  4DEV A;  3I2F A;  2B4K A;  4MGS A;  4A4A A;  2Y6K A;  2C9K A;  2VO5 A;  3SKJ E;  3MV0 1;  1WKY A;  3WNN A;  4BK4 A;  1GOF A;  3T08 A;  4DEQ A;  4OUE A;  1W9T A;  5JR2 A;  5G05 L;  3C8X A;  2VMC A;  3HNY M;  1NAE A;  4XUO A;  1IQD C;  2WQ8 A;  2VZS A;  1K45 A;  2QQK A;  1HN1 A;  4M4P A;  3SKV A;  1PX3 A;  3BN6 A;  3WF0 A;  2JE8 A;  1DYO A;  3UET A;  1GOG A;  1XNT A;  1JZ3 A;  2VZQ A;  3WNM A;  2HYX A;  2ZEX A;  2VZV A;  1UY4 A;  3PUI A;  2YC2 A;  1NX9 A;  4RN5 A;  3I2G A;  2BGP A;  5DMY A;  1JZ8 A;  3W5N A;  4M4R A;  3THD A;  4A45 A;  2Y8K A;  4CU9 A;  3I3D A;  2J1T A;  3FHA A;  4MAD A;  5G04 L;  3CIH A;  4QDR A;  3K77 A;  3HNB M;  1TVG A;  2ZEZ A;  5LA1 A;  3ABZ A;  2EID A;  5CZK A;  1XNA A;  3T2P A;  4XZU G;  3III A;  1O8S A;  4BJ0 A;  4QPW A;  1TG7 A;  1BHG A;  2WO1 A;  2VTF A;  1DP0 A;  5C71 A;  3J7H A; 
#chains in the Genus database with same CATH topology
 3RGB A;  4RSU A;  1ENX A;  1JUI A;  4HLT A;  4MOA A;  1W2O A;  2ATF A;  1S0J A;  2WWU A;  2A70 A;  1HQL A;  1WW4 A;  3EMR A;  3EQE A;  3L9J T;  1A34 A;  5DQ0 A;  1LU1 A;  2IXL A;  1IQA A;  4Q0V A;  4QX2 A;  3ZN6 B;  2Q8E A;  4DXT A;  4K8F A;  3T4V A;  5CFD A;  1ZZB A;  3T0B A;  1JXN A;  4WVW A;  1AJO A;  1WLW A;  1GOH A;  3ETP A;  3R4D B;  4AVB A;  2W52 A;  1CQ9 A;  3S7I A;  1US3 A;  1UQX A;  5FY4 A;  1TZO A;  1C4R A;  1TME 3;  4XCB A;  1OOP B;  5LK7 B;  1PHM A;  2XJU A;  4P02 B;  4TYS A;  3H7Y A;  3OEB A;  3U11 A;  4YW7 A;  4OHW A;  1C1L A;  3SCG A;  3WNK A;  1KQR A;  3WDU A;  4CCO A;  2VUL A;  5FO8 B;  5H9P A;  4NR1 A;  1G9B A;  3JB4 C;  5CG9 A;  5JPM B;  2P34 A;  1WMF A;  2RR1 2;  4DUV A;  1XRU A;  3DUI A;  2WJS A;  1AYM 2;  3VZK A;  4AQ2 A;  2R07 3;  5L36 A;  1LOC A;  1LOD A;  4Q0Q A;  3ZXK A;  1DLL A;  5A7P A;  5FWJ A;  2GU9 A;  2WLP A;  1ODN A;  4K3U A;  1W90 A;  4Y5Z 0;  3V64 A;  4P9L A;  5L9B A;  2WAB A;  5FYB A;  5FZO A;  3H3Z A;  5T5J A;  4D0Q A;  2KA3 A;  2J1S A;  4CCL A;  5I91 A;  3B94 A;  2C6S A;  4IV1 B;  1M06 G;  1AR6 3;  2JIC A;  4Q4W 2;  3ROU A;  2K0G A;  4ASL A;  1W9W A;  1BJQ A;  4Y1Y A;  2YGL A;  2PAK A;  3WP6 A;  3KF3 A;  3GAL A;  4U36 A;  1W8H A;  4Q2F A;  1BBT 2;  1WW6 A;  2UY9 A;  1RUG 3;  2VXJ A;  3RMX A;  3SEE A;  3U75 A;  1T2X A;  2VVD A;  1K5M A;  4LE3 A;  4ARX A;  2DDU A;  2BU9 A;  2W46 A;  3PUA A;  2YZ4 A;  3UV9 A;  4CDW C;  1CVN A;  4AVV A;  3CMG A;  1PMJ X;  1Q8O A;  1HB2 A;  2A6X A;  1HXS 2;  1MVE A;  4DPN A;  2PEL A;  3VBS C;  3MI8 A;  4D6S A;  1PX4 A;  1DQ6 A;  5ISL A;  3OPZ A;  4HMZ A;  4WZF A;  1YI9 A;  2NLR A;  2R07 1;  4QQP A;  1ST8 A;  2ET7 A;  4WM7 A;  4GMP 0;  4M3C F;  5DZF A;  3ZSL A;  1I1E A;  3MIH A;  4OZX A;  3RYK A;  4CDW B;  4J1W A;  2CNA A;  1HQN A;  4NO4 A;  4P5H A;  4UF0 B;  3RPQ A;  5JDB A;  2R16 A;  3S6P A;  1GWL A;  3EXU A;  1WCQ A;  5F2W A;  2AGS A;  1IS4 A;  3FL7 A;  1YRZ A;  4L9B A;  4LO4 B;  5FY5 A;  3NVC A;  3O0W A;  3SQO A;  3M3Q A;  1SBE A;  4TWT A;  5BNO B;  1AR6 1;  1LB2 A;  2VCA A;  3OPT A;  3VBU A;  5KC5 A;  1GKB A;  3WP4 A;  1VMH A;  1Q8S A;  2DU1 A;  4L0P A;  4F7Z A;  2XOM A;  3ASI A;  4D94 A;  3CU7 A;  3FUQ A;  1RL3 A;  3ZR5 A;  2I07 B;  1RUG 1;  1AR8 3;  3PU8 A;  2JDK A;  1UF2 C;  2Y0O A;  4K20 A;  2X5I A;  4LBQ D;  4OI1 A;  3NJV A;  1TE1 B;  2WO3 A;  2B42 B;  1DQ0 A;  2L9L A;  1OLM A;  1FOD 2;  1SLA A;  1G9A A;  4LOR A;  5FMD A;  5A7W B;  1CAX A;  1CIY A;  1UAI A;  1W06 A;  2GZW A;  1SAC A;  5ANN A;  3LSE A;  4RGG A;  1DGW A;  3AJZ A;  1VMJ A;  2WIN B;  1J83 A;  1PZ8 A;  3NAP A;  4K6B A;  2BDR A;  1PNG A;  2CGO A;  2LS6 A;  4EZH A;  1V00 A;  1AL2 2;  3ILN A;  4YM1 A;  3THC A;  4I3P A;  4NHX A;  5C9A C;  2YV8 A;  4XUN A;  3WUC A;  4AI8 A;  3DKW A;  3FMG A;  3ZN6 A;  3ILF A;  2R04 3;  1YFW A;  3WQ1 A;  2XPJ A;  4LKE A;  1GU3 A;  2UY8 A;  1ENS A;  2A3W A;  4HVO A;  4QX8 A;  5CAD A;  1VAK A;  2R32 A;  1MS3 A;  1XNB A;  2FCU A;  1VAV A;  5C9A B;  1QIQ A;  5FYT A;  1AR8 1;  2OX0 A;  1UZZ A;  1W9S A;  2VQU A;  5IWF A;  3VHR A;  4NJ4 A;  2JWP A;  1MPX A;  1I3H A;  1NCR C;  2ZX4 A;  5FZB A;  4YM3 A;  1OOP A;  1IS3 A;  2ZHN A;  3AJY A;  4GWM A;  4FP3 A;  4JDN A;  1X50 A;  2RS5 2;  1VLN A;  3JBG 3;  2PHR A;  4Q29 A;  2PHU A;  5FUI A;  4PQ9 A;  2DF7 A;  2GND A;  4QX1 A;  4GWI A;  4QX3 A;  4DXS A;  4QU1 A;  5HXV A;  2V72 A;  4D69 A;  1FAT A;  1VBC 1;  3GBG A;  4CCM A;  4YM0 A;  3N9O A;  1ZYB A;  4YNI A;  1WA4 A;  3ZXF A;  1SFN A;  2G4I A;  2OKX A;  3SNM A;  3EJK A;  4NOT A;  4URT A;  2D6L X;  2RS3 2;  2J1V A;  1YJL A;  2R04 1;  2YC0 A;  3ME2 A;  4OI4 A;  4TTG A;  2XHN A;  1S2B A;  4IV1 A;  4Q26 A;  5F3G A;  1C57 A;  2WBK A;  4FPY A;  4XFF A;  2YGM A;  2YPJ A;  3IAQ A;  1HN0 A;  3VKL A;  3GBW A;  1A3K A;  3MIB A;  1RUH 3;  2WO2 A;  2QQN A;  1YUD A;  4G3Y C;  2ZGQ A;  4FT8 A;  1UIK A;  4HN1 A;  4MGQ A;  4XAC A;  5BNQ A;  1FV3 A;  4C1W A;  1JZ5 A;  1JS9 A;  4GQ7 A;  1EUT A;  3CJI B;  4HZF A;  4BQX A;  1FPN 3;  1VRH 1;  5HCB A;  3UGF A;  1YYN A;  2ADD A;  4IGP A;  5A80 A;  3AYD A;  2UWB A;  2VQA A;  2TEP A;  4AG4 A;  1JZ2 A;  1E5I A;  5IVJ A;  1UZV A;  4GKX A;  4LMF A;  4MGZ E;  4QD2 A;  3ETQ A;  1OBN A;  1CPN A;  4QPI B;  2JB4 A;  2XVL A;  4FPG A;  2NPI A;  2A1X A;  2R7E B;  4UF0 A;  4CUC A;  5FQ0 A;  4AL9 A;  2CAU A;  4FBF A;  3MBW A;  3N35 A;  4CDU C;  3TN9 2;  5IK4 A;  1LHW A;  1W6N B;  1ND2 C;  5BNO A;  3ZIW A;  1YLL A;  4I0W B;  5JSR A;  2OPW A;  3VD9 A;  2YG0 A;  2BEO A;  1HRV 2;  2BGO A;  3CHX A;  4HBN A;  1RUH 1;  4LO6 B;  3K3O A;  1Z7S 2;  5ACA 3;  3AYA A;  3WHU A;  4ZHN A;  4COU A;  3RZZ A;  2OYZ A;  2BBV A;  1EY2 A;  1GBG A;  2EXI A;  1VBB 3;  2Y64 A;  3I54 A;  4IEY A;  2ZAA A;  4S2D A;  5CU1 A;  5LBB A;  4E9K A;  3ZX7 A;  2EVX A;  4A3X A;  1OXC A;  2OS2 A;  4YZ2 A;  3A7Q A;  3JUU A;  1ULO A;  5I0R A;  1HB3 A;  4XET A;  1QMJ A;  5C70 A;  1L3J A;  4MYE A;  1IS5 A;  5A7W A;  4AE2 A;  1FPN 1;  3ZYJ B;  4QQO A;  1OPO A;  2W1S A;  3MEP A;  1LGB A;  1KJL A;  4YFW A;  3SCF A;  4CCD A;  1SZB A;  1YO8 A;  4S2H A;  3IAP A;  4LHK A;  1OLR A;  3EYP A;  5T52 A;  3TEX A;  1BVV A;  4L8Q A;  4YGC A;  2W0X A;  2HYK A;  3H3U A;  2AH2 A;  5LWB A;  1GNH A;  3D6E A;  4MET A;  4M3C B;  3ZIX A;  2VR4 A;  2Y6G A;  3HD8 B;  1XYP A;  1RB8 G;  5CFC B;  1WWY A;  4UFL A;  4W4Z A;  1QJZ A;  5ACA 1;  2DCK A;  2HWB 2;  3C7G A;  1GFF 2;  2OZ6 A;  1NCQ B;  1D0H A;  1VBB 1;  3N7L A;  1Q8Q A;  3AMQ A;  4W65 A;  1JYN A;  2I74 A;  1D0G A;  5A7S A;  1S0C A;  4N43 C;  1DGR A;  1J3R A;  4UI9 L;  4LBJ A;  4NE9 A;  4NID A;  4C0B A;  4KU7 A;  4YM2 A;  1PK6 C;  1PGW 1;  4ES9 A;  3DYO A;  4LOS A;  4EWD A;  1GR3 A;  1PO2 3;  4HSJ A;  4QGM A;  3AK0 A;  3TB0 A;  1DIW A;  4EN8 B;  5A6Z A;  4LJH A;  2WDB A;  1UX6 A;  4JDO A;  2WNU C;  1QEX A;  1RMU 2;  2B46 X;  3EHK A;  4N43 B;  4Z8B A;  3BU0 A;  3LDR A;  2XVK A;  4JKM A;  3WV6 A;  3W5M A;  2CU5 A;  3T0D A;  2D6N A;  4XCA A;  2XWB B;  2WN2 A;  2DCT A;  1XQN A;  5F39 A;  2BGC A;  1RUE 3;  4X8N A;  2PLV 1;  1H6X A;  2Y6F A;  4LBM A;  3VZL A;  4RR3 A;  1G9C A;  3ZFG C;  3E97 A;  3ZPO A;  1OFN A;  5IVE A;  4ISQ A;  1ZRR A;  4NPR A;  4SLI A;  2XL9 A;  2D5F A;  2JJ6 A;  1F8V A;  2HWE 3;  5F5A A;  1UYY A;  4PDW C;  4XQW A;  4CXY A;  4XFH A;  1N3P A;  4IW3 A;  2VM9 A;  1Q56 A;  1MZ5 A;  3MLL A;  2QJV A;  3WY6 A;  4EYU A;  4M0N A;  5FPU A;  2BBA A;  1K3I A;  1H8T C;  4DS0 A;  4C0H A;  1EPW A;  3ST7 A;  3CJI A;  4IES A;  5FPZ A;  2DTY A;  5JIU A;  3IPV A;  2QQM A;  1UU4 A;  5BNP C;  2WZR 2;  2HWC 3;  4PDW B;  3ZN5 A;  1QDO A;  2XR4 A;  3KT4 A;  3GF6 A;  3OG2 A;  5EZW A;  2D6P A;  4AQS A;  3OUJ A;  1UZ0 A;  5HCH A;  5DG2 A;  5DPN A;  4QPI A;  4QKD A;  4FPL A;  2E7T A;  2K46 A;  4PIY A;  5DAV A;  5E8A A;  3KGZ A;  5FBJ A;  1RUO A;  4PQQ A;  2WZ8 A;  3RZK A;  3I2H A;  3OBA A;  1RUE 1;  2WO7 A;  3MUZ 1;  4W6X A;  1YI7 A;  5BNP B;  2IXC A;  1W6N A;  4NAO A;  4BDV B;  1MZF A;  3BPS A;  1LOF A;  4LBK A;  1YQ5 A;  2RS1 1;  3ZXG A;  3TNP B;  2KD7 A;  5C8C A;  1YEW A;  2HWE 1;  2JE7 A;  5LAT A;  4Q4V 2;  4UBG A;  1W3X A;  4KGQ A;  4ARY A;  5T55 A;  1HX6 A;  2Y38 A;  3IDE A;  3KD4 A;  2J1U A;  2BOI A;  2BUK A;  2SLI A;  3M3E A;  5GLZ A;  4XHX A;  2VW0 A;  3KWV A;  5FYI A;  4NWW A;  5HPO A;  1POQ A;  3IMN A;  2J42 A;  4FOV A;  3W20 A;  1RUJ 3;  4YGE A;  2X05 A;  4DO0 A;  4CEW C;  3N9Q A;  5SV5 A;  4YVS B;  2YMZ A;  4LO7 A;  1CX1 A;  1RUD 2;  3PUH A;  1DU3 D;  3SH4 A;  5GLT A;  4AEM A;  2HWC 1;  4XJU A;  2FD8 A;  4M0H A;  1UZW A;  2XDV A;  2FQP A;  2YBS A;  3HT1 A;  1YQ2 A;  1NLR A;  3S0M A;  1S55 A;  3IM0 A;  4LUL A;  1FNZ A;  2AEY A;  4ZU4 A;  3BB6 A;  3TRS B;  3RZL A;  1KJR A;  1RXF A;  3AZY A;  1F9K A;  1EPZ A;  3DV8 A;  1US2 A;  2ARB A;  3PLQ A;  4KH9 A;  1R1Z A;  2WUH A;  1DGR N;  2PHW A;  3I2J A;  2H6C A;  4YG0 A;  3VKN A;  3VL9 A;  4H55 A;  4AI9 A;  5AFB A;  2FDG A;  1VIW B;  4J6G A;  3I2D A;  3RJ2 X;  3LEM A;  4QQL A;  1FI2 A;  3LQC A;  1AYN 3;  3SMH A;  3BIW E;  1O4Y A;  3MFA A;  3SHR A;  5L19 A;  2CAV A;  2VNR A;  4EV0 A;  2NZ9 A;  1QOO A;  3O14 A;  3LEI A;  3TYJ A;  5LZ6 A;  1SLI A;  1VAL A;  4A4A A;  1C28 A;  3KT1 A;  5HBA A;  5FZ7 A;  4YW5 A;  4IL7 A;  5FZ9 A;  5FZ8 A;  3SCH A;  4FFG A;  3WNN A;  2QQP A;  3V56 A;  1DQ4 A;  4OUE A;  4LUM A;  5HV4 A;  2VCM A;  4IEO A;  4AR2 A;  1A6C A;  5C3S A;  5CAZ A;  2VMC A;  1SPP B;  4DIQ A;  1DQ1 A;  4BB3 A;  4XPV A;  1DF0 A;  2G9G A;  3D5O A;  4S2F A;  3N36 A;  2VZS A;  1MVQ A;  1SEF A;  4XAE A;  5DAW A;  2YYO A;  3U4X A;  5LEJ A;  1QNY A;  2QQK A;  1QJX 3;  4FVV A;  1E57 A;  1COV 3;  1ZA4 A;  2JE8 A;  4NHM A;  3VBF A;  4R9C A;  3DCQ A;  3ON7 A;  1JZ3 A;  2XJP A;  1AYN 1;  1LRH A;  2VZQ A;  1LEN A;  1Q5O A;  2ZEX A;  2VZV A;  4Q4Y 2;  1NQD A;  1PVX A;  1OVS A;  2F4P A;  2NQY A;  4JDM A;  2BGP A;  2VUC A;  4XF1 A;  2BJS A;  5A3P A;  4A45 A;  1ONA A;  4XQ4 A;  4NAM A;  1OI6 A;  5DG1 A;  1ND3 C;  5L73 A;  5JZG B;  1CD3 G;  4BPZ A;  4FAG A;  1BCX A;  3IDB B;  4HON A;  3CIH A;  4QDR A;  2DVG A;  2XUM A;  3LD8 A;  1MQT C;  5FY9 A;  3POI A;  2HWD 2;  3PIG A;  1GZ9 A;  3ZXD A;  2WKK A;  4JZR A;  4CDQ C;  4H7L A;  2FBE A;  1RVF 2;  2ZEZ A;  3ABZ A;  5D1I A;  3UJO A;  4AVT A;  2Q1F A;  3IN9 A;  5HI0 A;  5CZK A;  1ASJ 2;  2P3K A;  5GZG A;  1ND3 B;  1XNA A;  2CL2 A;  4N53 A;  4CDX A;  5LY1 A;  1RUC 2;  1DYP A;  5GLW A;  4XZU G;  3NKG A;  3O1S A;  4BJ0 A;  1QJX 1;  4ZKT B;  1TG7 A;  3BAL A;  4CDQ B;  5T54 A;  2ETE A;  3ZSM A;  3OY8 A;  3FZ3 A;  1COV 1;  4KU8 A;  1Q8P A;  5JI7 A;  2FDJ A;  2ZML A;  1QU0 A;  2VY0 A;  4NMI A;  4RHV 2;  4AF9 A;  4HN0 A;  1OD5 A;  2WSV A;  5K4L A;  1ZBE 2;  3PTY A;  1GP6 A;  3J4U H;  3U0Z A;  2O8Q A;  5KHH A;  2IXI A;  1R1A 2;  4AI0 A;  2B5H A;  4HPK A;  4QPG C;  2PHD A;  3B9I A;  4B1L A;  3NW4 A;  4XF3 A;  2PFW A;  2LAL A;  1JTZ X;  3A0K A;  1D4M 1;  5ABJ C;  4QHB A;  2O0O A;  1RHI 2;  2VE1 A;  4CA9 A;  1UY3 A;  4KL1 A;  3DN7 A;  2AAC A;  3F95 A;  4XMI A;  2Q8O A;  3R0R A;  4I30 A;  1XB9 A;  2ZGK A;  4OYU A;  2LTN A;  4RS5 A;  2V09 A;  5FMO L;  3PJQ A;  5FMB A;  2P3Y A;  3GM8 A;  2YFU A;  3VD7 A;  3ZFE B;  4BH9 A;  2RMU 2;  3GZU C;  1W05 A;  4I0A A;  2JDA A;  3RWK X;  2A5Z A;  1G6N A;  1YFX A;  3RFR A;  2EIC A;  3NJZ A;  5C3P A;  3N9M A;  2Q30 A;  3RVH A;  4BLJ A;  3ZR6 A;  3K4D A;  3BCW A;  1RUF 1;  5CFD B;  2AUY A;  5JPN B;  1WUV A;  2XQX A;  2MEV 3;  2D93 A;  1EAH 2;  5EJ1 B;  4LQR A;  4E2S A;  5IVF A;  1UOF A;  5FPL A;  2VOW A;  1JZ7 A;  4E8C A;  4CUB A;  4UFI A;  3GNE A;  2ZHK A;  3PDQ A;  3RZM A;  1VBD 3;  2BTV C;  1RUI 3;  1ZVF A;  4QM9 A;  1CZS A;  1CPM A;  2IZW A;  3MF6 A;  5HXM A;  3HN1 A;  2QE3 A;  2WA3 A;  5F6L B;  2ZEY A;  4QXB A;  2HBT A;  2VQ0 A;  2PHL A;  4NRM A;  2P17 A;  3VKF C;  4EN0 A;  4FPE A;  2FZ2 A;  1U5I A;  1XSR A;  3WW1 A;  2VZ1 A;  3NST A;  2WNE A;  2BWA A;  3I8T A;  1X9T A;  2ARC A;  1OH3 A;  1UW8 A;  4YSF A;  1DG6 A;  3OGS A;  4I3G A;  3T30 A;  3DPR B;  4NWV A;  5DUU A;  1STM A;  5KWR A;  3O12 A;  5FRE A;  2BPA 2;  3AP4 A;  1NKG A;  4LA2 A;  4UBH A;  5J98 B;  4CPB A;  4OUL A;  4OMD A;  3ACI A;  3WG3 A;  2I45 A;  4DFS A;  4RYD A;  3J7N A;  1AXK A;  1TME 2;  5KXB A;  2MEV 1;  5DUW A;  1X36 A;  5DDJ 3;  5FZ4 A;  3MIE A;  4CTE A;  2RVA A;  2Z79 A;  3LOI A;  3C2U A;  1K12 A;  1K5M B;  1W9Y A;  1YHF A;  4Y3O A;  4A6O A;  4WM8 B;  1GMM A;  1J3Q A;  4D7Y A;  5CKN A;  4FOW A;  4JGY A;  1J1T A;  1VBD 1;  1RUI 1;  3LIH A;  1N1V A;  2VG9 A;  3R4S A;  2XHK A;  4V1P A;  5FYM A;  3VZO A;  4E27 A;  1PMH X;  3FLR A;  1V70 A;  2ZX2 A;  4LR4 A;  3UGH A;  5JIA A;  4BE3 A;  1FXZ A;  4YYO A;  1AX1 A;  4BQ4 A;  4CE8 A;  5JSO A;  4WVV A;  5LBC A;  2C5D A;  4XW3 A;  4WM7 B;  5F5Q A;  3RRD A;  1DZR A;  4JRL A;  3WLU A;  2JX9 A;  1ZZ9 A;  3KHB A;  4F83 A;  2RDR A;  4P9J A;  2ORZ A;  5IVY A;  4M01 A;  5CKM A;  2VU9 A;  3BTA A;  3PUR A;  3WF4 A;  3KHC A;  1AUY A;  2X5I C;  2ZEW A;  4AI2 A;  2JDM A;  3WZ1 A;  3SIS A;  2F17 A;  3ES1 A;  1FMD 2;  2OUH A;  3AMP A;  3H1Y A;  4NN0 A;  1RUN A;  3VBU B;  1PZ7 A;  5LW9 A;  3OF1 A;  1XNC A;  5DDJ 1;  4IET A;  5K0U A;  1GYK A;  1MS4 A;  5T5P A;  4FQZ A;  5FOJ B;  2JIJ A;  4KBB A;  1SDW A;  2CHH A;  2XVG A;  1QWR A;  3CQO A;  4X8P A;  4Y1U A;  2W87 A;  3NV3 A;  1AR9 3;  2BVV A;  2ZMK A;  3NAP C;  1UMI A;  2YPD A;  4K1Z A;  2X5I B;  1PO1 2;  3AZW A;  1O5U A;  4YVW B;  1VB4 A;  1H9P A;  3MIG A;  3UT0 A;  1POV 1;  1U5Z A;  4ZS3 A;  2D40 A;  5F3E A;  2A6Y A;  2EXK A;  1CAX B;  3H42 B;  1BYH A;  4YWA A;  1HJG A;  1MEC 2;  4AGG A;  1SHW B;  4XFG A;  2P1B A;  3W58 A;  4IDZ A;  4TLG A;  1OKO A;  2BOJ A;  2CTV A;  2HEV F;  5LBE A;  1MS1 A;  4PF5 A;  1NA1 A;  1C8N A;  3J9S A;  4DXR A;  3WW2 A;  5KHI A;  2ZJC A;  3JCI A;  4QT6 A;  2LM3 A;  1KIT A;  1YJK A;  2WNV B;  1NZC A;  1CAU A;  3KV4 A;  3ZFE A;  2DCY A;  5J48 A;  3ZXA C;  2Y6L A;  1T6G C;  1OOP C;  2OVU A;  2CDO A;  4AAX A;  4OHY A;  1AZD A;  2XBO 3;  1J59 A;  2WFP A;  4LIU A;  2E51 A;  3WD5 A;  3WP5 A;  1C8M 3;  3G7D A;  4CUA A;  5L9R A;  4MH0 E;  5A70 A;  3OD0 A;  1KGY A;  4BM8 A;  3B02 A;  2ZKL A;  2WWJ A;  1AR9 1;  1GNY A;  1UNB A;  2HWF 3;  4PIX A;  4QPY A;  4FXK B;  3KF5 A;  3GYD A;  1QQP 2;  3NJY A;  3E5X A;  1D4V B;  1R09 3;  4IEX A;  2D97 A;  2OA2 A;  1G9D A;  3FWE A;  2ZGM A;  1PGL 1;  1N1T A;  2UUR A;  3MID A;  4UXA A;  1AR7 3;  1F5J A;  4KWU A;  4UW6 A;  3BTZ A;  2VMI A;  3OB8 A;  3BYW A;  2G1M A;  4XVH A;  1S0D A;  2W1U A;  5EXO A;  4IV1 C;  4YW6 A;  2ZX1 A;  4XMA A;  5FO9 B;  5JXI A;  3AXD A;  3SEP A;  1PMI A;  3KV5 A;  3WNX A;  2XJT A;  3O1U A;  5T50 A;  4GH4 A;  2V73 A;  5I0S A;  3DPR A;  3J8F 2;  4JAA A;  1GQP A;  3JXS A;  3KQ4 B;  5FYV A;  2ZOE B;  4CU8 A;  3KQR A;  4Y22 A;  1GLH A;  1ZBA 2;  3BU7 A;  4BQ2 A;  5FR3 A;  4QWN A;  2XBO 1;  4AFC A;  3N7M A;  1CON A;  1WMX A;  1C8M 1;  1KFU L;  2GMP A;  3B3Q E;  2DFB A;  5CNA A;  4E2Q A;  1WBL A;  4MG2 A;  3FN9 A;  1CAW B;  5EIY B;  1FNY A;  4V2W A;  3HNM A;  2JG9 B;  3WQ0 A;  4FTS A;  3W21 A;  1SCR A;  2HWF 1;  1OMI A;  1EV1 1;  3AFG A;  3JBG 2;  4XHB A;  4XJZ A;  1XE8 A;  1R09 1;  3DYP A;  4WM8 A;  3B7M A;  2VXR A;  4MXW B;  4NHL A;  3WEZ A;  1LHV A;  1W6M A;  4YW1 A;  3ZFF A;  1ZRF A;  1AR7 1;  4PIZ A;  5LA0 A;  4XUQ A;  3ZXE A;  1BEV 2;  4ZU5 A;  4QHO A;  4QKF A;  5BNO C;  1R08 3;  4P14 A;  1V0A A;  4Q4X 3;  2WZP P;  4AEK A;  3TBD A;  5DZG A;  2HEW F;  3HEI A;  2WNO A;  2IVI B;  5FOB B;  2BNN A;  4ERO A;  1LNS A;  2RM2 2;  3CKH A;  2RJ2 A;  1H1M A;  5F32 A;  5FQ0 B;  1IHM A;  2VMG A;  4U2A A;  3I59 A;  3N4M A;  3LFI A;  5C8W A;  1HV0 A;  4NRO A;  3TEZ A;  1EUU A;  1FT9 A;  2HLE A;  3BTX A;  5FYZ A;  2IVJ A;  5FLH A;  3U4S A;  5AC9 2;  2CV6 A;  3NNF A;  1XPW A;  1LEM A;  4CCE A;  5IVC A;  1OHF A;  4RD7 A;  1V6O A;  5A6X A;  1LEC A;  4YVW A;  5IAT A;  3I2I A;  1L7R A;  4A6S A;  1PZ9 A;  4QMA A;  1AXZ A;  1QGL A;  1UY1 A;  2Q8C A;  4HKO A;  1JHJ A;  2ET1 A;  2ZGS A;  4NUB A;  3GZE A;  1DHK B;  2XUE A;  4AWD A;  3P5B A;  4Q27 A;  2LUW A;  2F4L A;  4BK5 A;  5J96 B;  4CCK A;  2IC1 A;  5IAX A;  3I4I A;  3B9C A;  1R08 1;  3HN3 A;  4ZXK A;  2JEM A;  1POV 0;  4Q4X 1;  2C9A A;  1OH4 A;  2W94 A;  1CIW A;  3E6D A;  3LPG A;  1VBC 3;  4BIS A;  2GNM A;  1H0B A;  1V6I A;  3WXP A;  2WNV A;  2VGD A;  2BFU S;  1CZT A;  2CSG A;  5I0D A;  3AVR A;  1XYO A;  1OUR A;  3MW3 A;  4AED A;  2QZ3 A;  2P5B A;  4QGL A;  3TEW A;  3LDB A;  4Y20 B;  2VNV A;  2VC9 A;  1EYB A;  5A1L A;  2CDP A;  4A7Z A;  5J36 A;  5LAS A;  3HMY A;  1DQ2 A;  4L2N A;  4L92 A;  3MFC A;  5F5C A;  3RI9 A;  3MLJ A;  1J84 A;  4ZZ8 A;  1SG3 A;  5I8S A;  4I2O A;  2FDH A;  4QB6 A;  1XBF A;  1A78 A;  3LWC A;  2XLG A;  3AL6 A;  2ZGU A;  3FFZ A;  4ORF A;  5C3R A;  4MGK E;  1FAY A;  1IPS A;  1RTV A;  3HVD A;  3DEM A;  2XKO A;  4XAB A;  1XNK A;  1WCK A;  2RR1 3;  4D8M A;  5BV6 A;  5FP7 A;  1DYK A;  4JRA A;  1AYM 3;  2GN7 A;  2GMM A;  2Y6J A;  5H9S A;  3AZZ A;  3FLP A;  3OGJ A;  3HJR A;  1QJU 2;  5F5I A;  1VRH 3;  3VDD A;  1L7Q A;  1JOP A;  1GWM A;  1UU5 A;  1J58 A;  2DUO A;  2Q1Z B;  1MZE A;  2MHF A;  1NY7 2;  2H6B A;  5D8A B;  1JYC A;  1C1F A;  2WQ4 A;  3H9A A;  2O8O A;  4OCT A;  1H2M A;  4HET A;  3GJB A;  4MXV A;  4BHP A;  3AYC A;  2OUJ A;  1JU3 A;  4FFH A;  4LLF A;  1OF4 A;  3A22 A;  5FZL A;  3WNP A;  1S0F A;  4PCR A;  3GHN A;  4RR3 B;  1BBT 3;  1SCS A;  3SXW A;  1G9F A;  2EAK A;  2Y34 A;  4NIA A;  3I3E A;  1F4A A;  1QJY 2;  2R30 A;  3CJI C;  1PM7 A;  3LPF A;  1CAW A;  2O1Q A;  2MNG A;  4JVA A;  4WZC A;  4FO9 A;  2JG9 A;  2OXB A;  3GZA A;  4XJ8 A;  3NQH A;  4JX0 A;  5GKA C;  4R9A A;  3VBR B;  1S2E A;  2BWC A;  4OVE A;  1HXS 3;  2KR2 A;  3WW4 A;  1PO2 2;  2BNM A;  4I02 A;  2JDN A;  2Q0A A;  3OUI A;  4MXW A;  4QPI C;  2RR1 1;  3IDA A;  5FAX A;  1JYV A;  2JB8 A;  1AYM 1;  1ULC A;  2QQV A;  2E26 A;  4Q1P A;  1RGS A;  3IPV B;  2KXL A;  2D3R A;  3TAY A;  1XE0 A;  4H7M A;  2VMD A;  3U07 A;  1X9P A;  1E5R A;  4ZON A;  3WT3 A;  4P00 B;  5BYN A;  3VHP A;  1LOF C;  4DOU A;  2W95 A;  5A33 A;  2C0Z A;  5EP9 A;  3ZFF B;  3RWN A;  1WME A;  2ZGO A;  1OC1 A;  1VPH A;  2Q5T A;  4HK9 A;  4P9Y A;  4Q4W 1;  4MV2 A;  1O7F A;  5FTT C;  3VD3 A;  3LEK A;  4LPL A;  1N1Y A;  5FY1 A;  1W8Z A;  4IGO A;  1SLB A;  1I9R A;  1UYZ A;  2NMN A;  4IER A;  1N3O A;  1BBT 1;  2R1B A;  4IUG A;  2AEZ A;  4QHZ A;  5CVR A;  3VBO A;  2JDU A;  2ZXQ A;  5IFP A;  3MLK A;  4WBB A;  3BPZ A;  4NHK A;  5C8C B;  4EN9 B;  3FE5 A;  1OT5 A;  3ZLI A;  5A3U A;  2Q8D A;  3H1W A;  1IKP A;  4BXS V;  5T5L A;  3I97 A;  2DV9 A;  4Z82 A;  1HXS 1;  1ZZC A;  1GNZ A;  5M0T A;  4QDQ A;  5KXE A;  4UAP A;  2C4X A;  1ZZ6 A;  3NWK A;  3ZYF A;  3KV9 A;  4R9B A;  1BMV 2;  1JUH A;  3VBS A;  3ZDV A;  1IOA A;  1GQH A;  1AL2 3;  1ULE A;  2WFF 2;  3CZU A;  1VBE 2;  4GUL A;  1W0O A;  4JQT A;  5CFC C;  1G86 A;  4MGS A;  4CZS A;  2OZJ A;  4W6Y A;  4D6R A;  4E4D X;  3MV0 1;  2VPV A;  1WKY A;  5FZ1 A;  1YC6 1;  1NCQ C;  4BYY A;  4DMI A;  2DVF A;  4DEQ A;  4LNV A;  3T08 A;  4GJZ A;  4CXW A;  2B8M A;  2OPK A;  1JW6 A;  2CGN A;  2PLV 3;  1OFS A;  4TN7 A;  4Y20 A;  5DUX A;  5JR7 B;  3VUO A;  4ZPI A;  2BW8 A;  3C8X A;  3URF A;  1WA6 X;  3OTF A;  1NAE A;  3HAG A;  4TLF A;  1H2N A;  2UWC A;  1BVP 1;  1FOD 1;  2WC2 A;  1RUJ 2;  1SLL A;  3M4F A;  4KQ7 A;  1Q43 A;  2RS5 3;  3P3P A;  5SV8 A;  2PAE A;  1S1A A;  1HN1 A;  3SKV A;  1PX3 A;  3HBZ A;  4H2A A;  1DYO A;  1S0E A;  3ZYP A;  4CCC A;  2R0H A;  1GOG A;  4TSV A;  1AL2 1;  2QFE A;  4LXL A;  4N9H A;  3M70 A;  5F8P A;  3PUI A;  2YC2 A;  1NX9 A;  2XJQ A;  5LY2 A;  1JZ8 A;  5EQU A;  1H4H A;  3LA2 A;  2RS3 3;  4M4R A;  2ENR A;  1NG0 A;  3THD A;  4CU9 A;  1N3Q A;  3I3D A;  1LGN A;  5D8A A;  5FYH A;  2E53 A;  3ZN4 A;  5A3L A;  2X29 A;  2AZ5 A;  3EO6 A;  4Q8K A;  1BK0 A;  3MIF A;  3AKS A;  3K77 A;  1UIJ A;  2VD7 A;  5A3N A;  1RIN A;  4XDQ A;  3VBF B;  2QZ2 A;  2RJL A;  2VW1 A;  2GAU A;  4COY A;  1H9W A;  2RS1 3;  1AHS A;  3TOJ A;  2A3Y A;  2P4E A;  4R4X A;  5FPV A;  1H2K A;  4AVA A;  2ARA A;  4UFK A;  2YBP A;  1WLT A;  3ES4 A;  2RS5 1;  3H50 A;  3VBR A;  1UKG A;  1OPM A;  4AHW A;  1NCR A;  1O8S A;  5KR7 A;  1VJ2 A;  4QPW A;  1DDL A;  3KS7 A;  4UYB A;  2VW2 A;  2WO1 A;  4N53 C;  5ANQ A;  5I8Y A;  3O1P A;  4LA3 A;  2VEC A;  1W2A X;  5FXW A;  3HIF A;  2R06 2;  4LE4 A;  3GZT B;  1JHN A;  2E7Q A;  4QQ2 A;  2GNB A;  3O1T A;  2UYA A;  2VUJ A;  2PTM A;  1AX2 A;  5B4N A;  5KHG A;  2RS3 1;  3ZMO A;  4OHX A;  4R8H A;  3TN9 3;  4N53 B;  4Y1Z A;  4CDX B;  3AFK A;  2W92 A;  5EJZ B;  2R0F A;  5FDB A;  4QKB A;  4D7S A;  4EN6 B;  3OGR A;  1IPK A;  2WLQ A;  5IHR A;  1D2S A;  1SLT A;  1HRV 3;  3GBF A;  1JOD A;  3U10 A;  3BGA A;  3OY8 B;  2JD9 A;  1Z7S 3;  2QQU A;  5LK5 A;  1LOE A;  2A71 A;  1VB2 A;  2VZU A;  1BXH A;  2EIG A;  2YY1 A;  3POF A;  3SH3 A;  1WCD J;  4YVS C;  1C5I A;  5CKQ A;  1EP0 A;  5L7O A;  4IE6 A;  2VCB A;  3KCX A;  3AB0 A;  1S4C A;  3MV1 1;  4M00 A;  3APB A;  3H1M A;  5T5O A;  5F9T A;  4RS5 C;  3ZYG A;  1XJA A;  2FCV A;  1V9U 2;  1WZX A;  1UKR A;  3BOW A;  3IKW A;  4QDS A;  4HPK B;  1UPS A;  5IAV A;  3MW4 A;  4DRV A;  2AEN A;  5APA A;  2EF6 A;  3WF1 A;  2VH9 A;  1HJF A;  3GCW A;  4RQP B;  5IT6 A;  2VZ3 A;  1W28 A;  1S2K A;  4Q8L A;  5FXV A;  2N7G A;  2QQO A;  3U1X A;  5FZK A;  3RYP A;  3WQ7 A;  2PQQ A;  1WGP A;  1GWK A;  4V2V A;  5C7G A;  4XOG A;  1IG3 A;  4RS5 B;  4KNC A;  3Q8E A;  3VB9 A;  5FZ6 A;  3AKR A;  3D3A A;  1F15 A;  3LA7 A;  4IEZ A;  3TN9 1;  4E8D A;  1VP6 A;  4GWJ A;  3CDZ B;  3AP5 A;  1XC6 A;  1B09 A;  1CX4 A;  1HRV 1;  1W8O A;  2WS9 2;  4MHU A;  4PLO A;  1OA4 A;  3V65 A;  4UW4 A;  3WQB A;  4CDU A;  1Z7S 1;  2ZZJ A;  3AZV A;  3D0J A;  1ND2 A;  2HWB 3;  3MIC A;  3T09 A;  5GZC A;  2Q1M A;  3BI3 A;  4GA9 A;  2D5H A;  4LBQ A;  5FZD A;  2V4V A;  4KG8 A;  3TWI A;  2E6V A;  5JOY A;  1H1A A;  2FMD A;  4RFT 0;  3O1M A;  2NYY A;  1W6P B;  2F6B A;  3T2O A;  3VBH A;  2VCC A;  4XFI A;  4QKN A;  4BIF A;  4QXK A;  3JU9 A;  3CJX A;  3D4K A;  1W6Q A;  2JKX A;  4Y5S A;  4YAR A;  1LGC A;  1KD7 A;  1RMU 3;  3FBM A;  3LOB A;  4OUM A;  1W2U A;  1Y7B A;  4FQ4 A;  1UOG A;  1X8E A;  4MUV A;  2K9Z A;  1TMF 2;  3M3I A;  4N7U A;  5FZE A;  1VBA 2;  3H8U A;  3M7A A;  3NNM A;  4JGY C;  5DAX A;  3P1I A;  4XBN A;  1RJ8 A;  4Q0S A;  3I3B A;  1GIC A;  3FHQ A;  4UFM A;  2EIB A;  2HWB 1;  4ET7 A;  4F3J A;  5JZG C;  4K40 A;  1W0N A;  3IZO A;  3EBR A;  4ZY9 A;  2VBD A;  5FIX A;  4MVT A;  1YXW A;  2DTW A;  3LGR A;  1P8J A;  3PL0 A;  2QQW A;  4JV4 A;  4L99 A;  3ACH A;  1JMU B;  4JGY B;  2D6M A;  4PI2 A;  1F35 A;  5FYY A;  3JD7 2;  4AK3 A;  1HV1 A;  2VVF A;  2NM1 A;  1B35 A;  2XL7 A;  4B7E A;  1HRI 2;  3QD6 A;  1I5Z A;  2D3S A;  3KB5 A;  3W9A A;  5JI9 A;  2BRT A;  1PK6 A;  2WZR 3;  4TXW A;  1PIV 2;  1JYI A;  2PN5 A;  1NOV A;  3DGT A;  1RMU 1;  2W08 A;  1D4M 3;  3JQX A;  5C5T A;  5BNN A;  4PT6 A;  3QH7 A;  1WLD A;  3LE0 A;  3J7M A;  4ITC A;  4UOJ A;  5FXZ A;  3IB3 A;  3MZH A;  1AXY A;  4IV3 A;  2W47 A;  3CO2 A;  4CP0 A;  4NHY A;  1Y4W A;  2YU1 A;  3BUC A;  1TEI A;  3B69 A;  2D7F A;  3HQR A;  4XQD A;  2H0V A;  5EV7 A;  2O14 A;  2HKX A;  2OII A;  1JOJ A;  1MAC A;  1RUF 3;  2JEN A;  4FCA A;  1HLC A;  1RC6 A;  3OEA A;  5K0U B;  1ZZ7 A;  4Z2A A;  4RGK A;  4HSL A;  4UW5 A;  3AP9 A;  4YZ3 A;  5J1X A;  4Q4V 3;  5E88 A;  1GP4 A;  4ISR A;  1TNF A;  2MPF A;  1UXZ A;  5A1F A;  1OA3 A;  2JKB A;  1SDD B;  1LOA A;  2W1W A;  4GB3 2;  1NA1 C;  3OGG A;  4AOC A;  4CVU A;  1IS6 A;  2JXA A;  4OLL A;  3ZFE C;  4A2U A;  1PVC 2;  1RUD 3;  5H9R A;  2WZR 1;  1UPI A;  1CZV A;  1H8T A;  1RXG A;  2E32 A;  2VZO A;  1NT0 A;  1NZI A;  2ZHL A;  4RQP A;  3USU A;  2WAO A;  5B2G B;  2ZGP A;  1D2Q A;  1V6K A;  5CFD C;  3U14 A;  1ODM A;  4COW A;  4HT1 T;  5JSP A;  4B7K A;  3PU3 A;  1NA1 B;  4IQP A;  1HB1 A;  3NRU A;  3RJR A;  4LHN A;  3VHO A;  2Z2S B;  4YZ5 A;  2QUO A;  1CAU B;  1H4G A;  2C1F A;  2WN3 A;  4HL0 A;  3C7O A;  4QAW A;  1XXN A;  3NNJ A;  4IEP A;  4BQ1 A;  3VHN A;  1W8T A;  3POW A;  5FZH A;  2ORX A;  4XIL A;  1AL0 G;  4LIV A;  2I2S A;  3E6C C;  4C1X A;  3PVO A;  4JGZ A;  3H8R A;  3CL1 A;  4QQH A;  2GC1 A;  4MGI E;  4Q4V 1;  3FLT A;  3HT2 A;  4AFB A;  3MPB A;  4CU6 A;  1I5P A;  2VUD A;  1MS8 A;  4LTA A;  5IK5 A;  1Y3T A;  5FLI A;  4GD4 A;  5JCT A;  5KXC A;  4Y1V A;  1UX7 A;  4GH4 C;  3DPR C;  3GXU A;  2W68 A;  4HKL A;  2WT0 A;  3MO4 A;  2QQL A;  4AQT A;  1RUD 1;  1W6P A;  3AKT A;  2VVE A;  1F4H A;  2CWM A;  4LO5 B;  2GNT A;  3UNP A;  3LEG A;  4E2G A;  2ID4 A;  3S5A A;  3USS A;  3FHI B;  3IBM A;  4BOW A;  1UU6 A;  3Q8B A;  2WYS A;  5KC6 A;  1XSQ A;  4QU2 A;  4GH4 B;  4QX5 A;  4K21 A;  4LK7 A;  2QCS B;  3Q8A A;  5I0T A;  5IYY A;  1O91 A;  3ZYI B;  2BER A;  1K5M C;  4Y22 B;  3IIA A;  3BVC A;  3OGV A;  4WM8 C;  3O1V A;  2YFZ A;  3ZFF C;  1GQG A;  3ACL A;  2WT1 A;  4PF1 A;  1V6J A;  2XON A;  2YUE A;  3P3N A;  1W8F A;  2ERF A;  4UT5 A;  2ZS6 B;  4Q4Y 3;  2VMH A;  2W2I A;  4O65 A;  1DBN A;  2EXJ A;  4X6R B;  3KZ4 C;  1RYY A;  3DF0 A;  3ZSJ A;  2VOT A;  1HQW A;  4OFG A;  1LHU A;  4MX3 A;  4NRQ A;  2VZT A;  2YRO A;  4KWJ A;  4P08 A;  2WA4 A;  4PHZ A;  3AX4 A;  4WM7 C;  2VOV A;  1QNW A;  1UMZ A;  3ENR A;  3B93 A;  1W6M B;  1L7L A;  3CLP A;  1ACC A;  1HKD A;  3OYW A;  3WNL A;  1PM4 A;  1S0B A;  2W5F A;  1POV 3;  2RG4 A;  2XWJ B;  2R07 2;  5EYY A;  2JG8 A;  4EZ4 A;  5K7P A;  2HWD 3;  2ZGN A;  5IJR A;  1UY0 A;  1WCS A;  1XOY A;  4XUR A;  4AHZ A;  5EFU A;  3THP A;  2WZE A;  3VBU C;  2XML A;  1ASJ 3;  3AYE A;  1N47 A;  5FZ0 A;  3I3Q A;  5DN2 A;  2E9Q A;  3X29 B;  1Z0H A;  2ZAB A;  3THT A;  1AR6 2;  4XYX A;  2C26 A;  3PMS A;  2WL1 A;  3I59 B;  1OD3 A;  4YVW C;  3E5U A;  3O7O A;  4BIO A;  2XJV A;  4FSJ A;  4AAP A;  2WR9 A;  3WDV A;  4BZ4 A;  1QH6 A;  4MLO A;  2D6K A;  4N90 A;  1RUG 2;  4Q5O A;  1QF3 A;  4RHV 3;  3D0S A;  5F3C A;  2WQZ C;  2DFC A;  4NVP A;  4Q4Y 1;  1JN2 P;  4S2G A;  1SLC A;  3LF7 A;  1ZBE 3;  2QKD A;  4P9G A;  4YRD A;  3RQ0 A;  3RYR A;  2J1A A;  1GAN A;  1W6O A;  3NJX A;  1F5F A;  1GUI A;  4QXC A;  1XYN A;  1R1A 3;  2YC4 A;  5F7U A;  2WAA A;  1W9F A;  5CEH A;  4JKK A;  4BA6 A;  2ZAC A;  2ZA9 A;  3AC0 A;  2RDS A;  2W39 A;  1BZW A;  3OUH A;  4LHL A;  2BZD A;  2GAL A;  5EJ3 A;  1D7P M;  3AVS A;  2ILM A;  1DGW X;  2UWA A;  3PME A;  5JOW A;  3H8O A;  4WV8 A;  2WNV C;  2PHX A;  2HWD 1;  2G9Z A;  1OSG A;  4QB2 A;  4AED C;  1RVF 1;  5FZI A;  1GZW A;  1CAV A;  4EJR A;  4PLN A;  1MQT A;  1ASJ 1;  3VDC A;  2E31 A;  2RMU 3;  3ACG A;  2B45 X;  1M4W A;  1URX A;  2JDP A;  2Z4F A;  1CJD A;  2GDF A;  1RUC 1;  3J7L A;  2VL4 A;  5BUV A;  2D43 A;  2NP0 A;  4QXH A;  3MPP G;  2VBP A;  3K3N A;  1JYX A;  4AED B;  3HQX A;  2GME A;  3VZJ A;  4DRR A;  4X6Q B;  1EAH 3;  3H0O A;  4RHV 1;  4FI9 A;  4XAA A;  1AR8 2;  1GV9 A;  1X7N A;  3IMM A;  2BVB A;  5GAL A;  1AVB A;  1NXM A;  1ZBE 1;  5LA9 A;  1BKZ A;  5DAP A;  1H30 A;  4ZS2 A;  4BMB A;  3DL3 A;  5FBZ A;  4CCN A;  1H8V A;  2VAU A;  1WW7 A;  3VDD C;  1R1A 1;  1EV1 3;  3T3Y A;  3I49 A;  1JU4 A;  1REF A;  2EAL A;  2P3J A;  4OHZ A;  1JZ4 A;  2G9F A;  1OQE A;  4OQ9 A;  3L2H A;  4B8E A;  2DVA A;  5J09 A;  3CZJ A;  2RV9 A;  5I8T A;  1RHI 1;  1U5X A;  1W04 A;  2Y0I A;  4QPG A;  3OOX A;  4LEJ A;  1BK1 A;  2IFW A;  4CEY A;  4ZZ5 A;  1JZ6 A;  1O8P A;  1VBC 2;  4XF4 A;  2D6O X;  2DYC A;  4KMQ A;  3FJS A;  3VDD B;  5ABJ A;  1SBD A;  2IXH A;  2RMU 1;  2A6W A;  1UYX A;  1JOB A;  2R04 2;  4CP9 A;  3N9N A;  4TZD A;  4K1Y A;  5GZD A;  3ACF A;  2JG9 C;  3R4U A;  2R49 A;  3PJY A;  3WOG A;  3WF3 A;  2B9V A;  2XLF A;  4B1M A;  1REE A;  5FCC A;  1FV2 A;  1CN1 A;  3RI8 A;  1EAH 1;  2ZZQ A;  1LR5 A;  1VRB A;  1W2T A;  4OHV A;  4LBO A;  4DY5 A;  5FO7 B;  5J37 A;  3I3M A;  3POB A;  2J1R A;  3I7D A;  4RFR B;  4AFM A;  2RJK A;  3PTR B;  5A3T A;  3OD4 A;  2PXJ A;  3ZYR A;  3UGG A;  5GLV A;  5C4W A;  2HEY F;  4LOT A;  1VRH 2;  1RIT A;  2PHF A;  5F3I A;  5JVV A;  5BPX A;  3RMY A;  1VR3 A;  3WP3 A;  4N8M A;  4AXO A;  1O59 A;  1IPJ A;  3K46 A;  1R64 A;  2X10 A;  2WII B;  5E89 A;  1HDK A;  5EPA A;  3VKO A;  1NUK A;  1H2L A;  3A23 A;  3E5Q A;  4MSV A;  1JBC A;  2HJI A;  5F2S A;  5A33 B;  3VBO C;  3Q8C A;  1LTE A;  2Z5W A;  3E1F 1;  3UL2 A;  5A32 A;  1FMD 3;  4W8J A;  4YW3 A;  3JZV A;  5E6H A;  5FMC A;  3V0A B;  4BLI A;  1TME 1;  2HH9 A;  3BIE A;  3CNA A;  1MS9 A;  4XC9 A;  1RUH 2;  4XBL A;  3L2Y A;  4LHS A;  5KHK A;  1ULF A;  2YB7 A;  2NN8 A;  5FK7 A;  4A44 A;  2XJR A;  4XEZ A;  1JI6 A;  2A6Z A;  4QB1 A;  1RIR A;  1YQ8 A;  4GWN A;  3VBO B;  5L9V A;  2PMW B;  1PO1 3;  5JXJ A;  2BFU L;  4FPH A;  1YIP A;  4XIO A;  5A6Q A;  3RZJ A;  4XF0 A;  3Q9O A;  4GZ9 A;  4DEV A;  3SH5 A;  4XXP A;  2Y6K A;  2VO5 A;  5E1R A;  1GOF A;  3CF6 E;  1FPN 2;  3KT7 A;  5CB7 A;  4MZU A;  4BQ3 A;  5IK8 A;  1IKQ A;  4XTM A;  3MYX A;  2ADE A;  1W9T A;  1MEC 3;  1O5L A;  1VAM A;  4JQR A;  4AGR A;  1RED A;  1TQ5 A;  1XU1 A;  3VBS B;  3MHZ A;  3B00 A;  4R52 A;  1OLQ A;  1UO9 A;  2XH6 A;  2DU0 A;  2LRP A;  3LCP A;  4KG0 A;  4LO8 A;  5A6Y A;  1IQD C;  4P9W A;  4AW7 A;  2VTX A;  4L97 A;  4Z2W A;  2QTW B;  1FMD 1;  2Y60 A;  2GC2 A;  3BOP A;  3CEW A;  4FP2 A;  5JWP A;  3UET A;  4PJY A;  4MHR A;  5LRR A;  2X53 S;  4LLO A;  1XNT A;  3ZKY A;  5ACA 2;  1LAJ A;  4MGT A;  4KBZ A;  3UK9 A;  3WNM A;  5H9Q A;  1VBB 2;  1UY4 A;  5KBF A;  1W2N A;  4RN5 A;  2ZPX A;  1PO1 1;  2TUN A;  4UW3 A;  4H3W A;  3KVB A;  1QQP 3;  5J7M A;  3W5N A;  1W03 A;  2Y8K A;  2ZX0 A;  3AMH A;  3N3H A;  4J1X A;  4Q0P A;  4WVM A;  2DUP A;  2J1T A;  1PGW 2;  4MAD A;  4XBQ A;  3NO8 A;  3S7E A;  4E4S A;  2A73 B;  2C24 A;  1LCL A;  1WMD A;  5D21 A;  4LKD A;  2GP5 A;  4CRQ A;  1Q8V A;  5ERL A;  1K5J A;  2XG3 A;  5D8A C;  1MEC 1;  5CA6 A;  1O3T A;  1ZRC A;  1TVG A;  1PGS A;  3WIN E;  2QDR A;  4FFI A;  4FPK A;  4YFZ A;  2VNG A;  5EHD A;  4IEQ A;  3UKT A;  3U78 A;  1NLQ A;  4YZ1 A;  4RR3 C;  3OBT A;  3J8F 3;  5F6K A;  3T2P A;  2BP6 A;  5IK7 A;  3III A;  1ZBA 3;  4FAH A;  3VKM A;  5GZE A;  2PLV 2;  1W39 A;  1HB4 A;  4NII A;  4Q4W 3;  5C71 A;  3VBR C;  3FX3 A;  3J7H A;  2IWG B;  5JUV A;  5FKC A;  2VQT A;  5DXD A;  5KXD A;  1YFY A;  2FZ1 A;  2H0B A;  4IEU A;  4LK6 A;  4IEV A;  5FY7 A;  5A3M A;  1QQP 1;  3HBK A;  3SC7 X;  4YPJ A;  3KMH A;  4GKY A;  1QXP A;  2EIE A;  5FYS A;  3K48 A;  2V5D A;  1YQC A;  1NCR B;  2UU8 A;  4AEJ A;  3DKQ A;  3LKJ A;  2JDZ A;  4Y4Y A;  5CYY A;  4DIN B;  1BEV 3;  3K75 B;  2V4A A;  1RJ7 A;  2TBV A;  3K51 A;  1KDK A;  4GJY A;  2VJX A;  3RG0 A;  2A3X A;  2PHT A;  1OVP A;  1QXR A;  1UZY A;  5I0U A;  1U5Y A;  5IVV A;  1WD4 A;  3H8X A;  3MUY 1;  4RGA A;  4CCJ A;  5LRS A;  2RM2 3;  4UWD A;  1ZNP A;  3J8F 1;  4QX0 A;  4P5Y A;  1UXX X;  1GZC A;  1ZBA 1;  4HK8 A;  4KWL A;  1UL9 A;  3POG A;  1LHO A;  1RUE 2;  3I2O A;  1F2N A;  5C8C C;  4CU7 A;  5L7O C;  4W50 A;  1V6M A;  4LBL A;  4DUW A;  2D44 A;  4HVQ A;  3V0A A;  1LOB A;  3WDX A;  4FFF A;  4BXF A;  2RS1 2;  2E63 A;  3OJB A;  5A1A A;  4KGG A;  5AC9 3;  2TNF A;  4Q1R A;  1OQ1 A;  2HWE 2;  5LA2 A;  3ZXJ A;  1ZRE A;  4HG6 B;  3JBG 1;  3T1L A;  3GDB A;  2GN3 A;  4CP1 A;  4R4Z A;  1KFX L;  1N1S A;  1MZ6 A;  1XND A;  2GP3 A;  2XJS A;  2VOX A;  3N7J A;  1QDC A;  4P9I A;  3UYJ A;  5L7O B;  1KDM A;  3KV6 A;  1O3R A;  1FOD 3;  4PBP A;  2NMO A;  1HW5 A;  3WG1 A;  5FP4 A;  1BEV 1;  3NV1 A;  4Y24 A;  3T0A A;  4A42 A;  4KI5 M;  1UOJ A;  2ZHM A;  4CDW A;  4EWA A;  2HWC 2;  1OA2 A;  2WSU A;  5IUQ A;  2ES3 A;  2VZR A;  4FTB A;  2YHJ A;  1ALY A;  3JQW A;  3LSD A;  1JYW A;  1QJE A;  3PHM A;  1IZ3 A;  2RM2 1;  1NE4 A;  3AMN A;  4LIT A;  4FPJ A;  4NIG A;  4G9S B;  4RA0 A;  5FZM A;  4ZU7 A;  1CWP A;  5LB6 A;  2XB6 C;  3BKZ A;  1IG0 A;  1IGO A;  1ZM1 A;  2GC3 A;  4FXG B;  3ZXL A;  4K8R B;  2OW4 A;  1OUS A;  4I09 A;  5A7O A;  3I2K A;  4CDU B;  1W99 A;  5AC9 1;  4AVS A;  4C8D A;  3MGU A;  5FKB A;  2DBN A;  1W8W A;  4SBV A;  1ND2 B;  3VBH C;  4E4Z A;  4LT5 A;  1KXG A;  5JXG A;  4URA A;  1I6X A;  4EQV A;  1KS4 A;  3S57 A;  2VUA A;  4BME A;  2J1E A;  2FCT A;  4N7I A;  1ZRI A;  1DLC A;  4LBQ B;  3WDT A;  3VLB B;  2XKP A;  1QY4 A;  3EB7 A;  3ELN A;  3FBY A;  1YNA A;  2EXH A;  4I0B A;  3FC0 A;  4A7K A;  1ZZ8 A;  1QJU 3;  2FHR A;  3FFQ A;  3VBH B;  5FPX A;  3MW2 A;  1W6Q B;  4FPF A;  3PNA A;  1QJF A;  1SFP A;  1KEX A;  4CPB D;  2A75 A;  4XJW A;  2Z42 A;  1X33 A;  5GZF A;  3VV1 A;  1QHD A;  3WHT A;  1JH5 A;  2IFR A;  3WF2 A;  3HOB A;  3VBF C;  2XGX A;  3ITQ A;  2CY6 A;  2GH2 A;  4P9X A;  4AYU A;  5LBF A;  4B3N A;  3DEC A;  5DUV A;  2QQI A;  5FP3 A;  3N9P A;  1CJP A;  4IXL A;  4EN7 B;  5C9A A;  1ULP A;  5FUP A;  3KLS A;  2HBU A;  4FPO B;  2QBX A;  2JEC A;  5FWE A;  1AYN 2;  1B35 C;  1QJY 3;  2EA7 A;  3GJA A;  1SQ4 A;  1X82 A;  3HR9 A;  2R1D A;  2JDH A;  3KSC A;  3N7K A;  2ZGL A;  5BNN C;  2BYV E;  2KM2 A;  2JIG A;  3H7J A;  2CWS A;  3NNL A;  2X8K A;  2ZTN A;  2OQ6 A;  3HQU A;  3NNG A;  3TNQ A;  3WSO A;  3T4H B;  4ATE A;  3LFM A;  1UWW A;  4EWE A;  4IV3 C;  1B35 B;  3WX5 A;  4DB5 A;  1QJU 1;  4QX7 A;  4XE9 A;  2AYH A;  2DVD A;  1PK6 B;  2Q4S A;  2XXZ A;  3UES A;  4CDX C;  3GCX A;  3HPN A;  3TEY A;  2W1Q A;  3A21 A;  4CYD A;  4K9S A;  5BNN B;  3HWJ A;  1NY7 1;  3PVE A;  1X8M A;  4Y5T A;  2WNU B;  4IV3 B;  3POE A;  4HFS A;  5C3Q A;  5D2A A;  1OLM E;  1QJX 2;  2FDF A;  1Y9Q A;  4LBN A;  2PYT A;  4OMC A;  2Y33 A;  5JMO A;  2ZGR A;  1COV 2;  3GGL A;  1CES A;  5FPA A;  3K4A A;  1Y9G A;  4GAL A;  3QAC A;  3UKV A;  4CUG A;  5FV3 A;  5DAB A;  3CBN A;  3T1M A;  3VZM A;  1QJY 1;  2W91 A;  5JOX A;  4IGQ A;  5F37 A;  2P37 A;  4AQ6 A;  1LES A;  3OSD A;  1AF9 A;  3R05 A;  4IEW A;  4K7J A;  4O7X A;  4A3Z A;  3ZFG B;  4RQP C;  4DNY A;  1PO2 1;  3DXU A;  3ZDS A;  3SIT A;  5FJH A;  4Z1V A;  3RDI A;  5FLJ A;  1O3Q A;  2B9U A;  3LZZ A;  4BCU A;  5CBL A;  3A4U A;  1MR5 A;  1ENR A;  1D4M 2;  2ARX A;  2ZGT A;  2W9X A;  2ZX3 A;  3BOD A;  4IE0 A;  3UKN A;  4XFC A;  3P6B A;  3KGL A;  4L11 A;  2WFF 3;  1NLS A;  1H8T B;  3T2Q A;  1VBE 3;  3USU B;  1DCS A;  1ZA7 A;  5CG8 A;  5BY5 A;  1WLC A;  2RDQ A;  4JGZ C;  1ENQ A;  3VN4 A;  4HOO A;  4ASK A;  1AX0 A;  2P6H A;  2D98 A;  1T6B X;  4LKS A;  3POY A;  1RUF 2;  4B29 A;  3C3V A;  2DWR A;  1E5S A;  5FYC A;  4AI3 A;  2VNO A;  2VME A;  4IE5 A;  4XTP A;  3U37 A;  5FZA A;  5K8S A;  1O4T A;  3MF9 A;  3WDW A;  2CYF A;  1ULG A;  3LB9 A;  4BWO A;  1OKQ A;  3C7H A;  4WVZ A;  1AJK A;  4JGZ B;  4CSW A;  1OF3 A;  1W0P A;  1DGL A;  2ARE A;  3GHM A;  4QGN A;  4XZP A;  4XDO A;  3RNS A;  3QCW A;  3ZVX A;  5HCA A;  5TSW A;  4JCK A;  5C6C A;  1NXD 1;  2IUW A;  2W3J A;  1JYT A;  3ZOI A;  2WWS A;  1GZT A;  4Y1X A;  1BMV 1;  3ATG A;  2PAM A;  3KCC A;  3POJ A;  5I93 A;  5A3O A;  1SMV A;  2WFF 1;  1H1I A;  1LKN A;  1VBE 1;  1W8N A;  2Y26 A;  3ALQ A;  4XFB A;  4AHY A;  1OQD A;  3WNO A;  4CEW B;  3PIJ A;  4JTO A;  1U12 A;  5B4X A;  3VL8 A;  5GLU A;  1OUX A;  4M3C A;  1O6U A;  5LEK A;  2QNK A;  4PLM A;  3ZO0 B;  2WYF A;  2EAA A;  3ZYB A;  5CFC A;  3INA A;  2BNO A;  1ZX5 A;  2MEV 2;  4JKL A;  1BQP A;  4LUK A;  4LKF A;  4B4P A;  4AFD A;  4AI1 A;  4XUP A;  1MS5 A;  1QXJ A;  1NCQ A;  4O9E A;  1CGP A;  1Z78 A;  2G19 A;  1A8D A;  2YBK A;  3A0N A;  1S0G A;  3VD5 A;  2JG8 C;  1UYP A;  4D3W A;  4DUX A;  3PVN A;  4I01 A;  5BXX A;  2FDI A;  5C33 A;  2VOK A;  1LHN A;  2OQ7 A;  5FY8 A;  5AFE A;  1VE0 A;  1RUJ 1;  4COZ A;  1K42 A;  1VBD 2;  1KS5 A;  1NYW A;  2A6V A;  1RUI 2;  2Z69 A;  3OCP A;  4FPC A;  1ZRD A;  3KCY A;  5KHJ A;  4XFA A;  1UN1 A;  1Y43 B;  1W8U A;  4RL7 A;  2VMF A;  3NL1 A;  4J25 A;  3AP6 A;  2J22 A;  3LAG A;  3OYW B;  4DZG A;  2OT7 A;  1XE7 A;  1LOG A;  4N43 A;  2JG8 B;  4IND A;  4OZO A;  2R06 3;  5LCW L;  1O3S A;  4IE4 A;  5JOZ A;  2RDN A;  3WUD A;  3ZMN A;  3IWZ A;  4A41 A;  3WG2 A;  3POS A;  5JLV A;  3RSJ A;  4NPL A;  2DVB A;  5K0U C;  1WW5 A;  3WDY A;  3AKP A;  3VGI A;  4ASM B;  2WNU A;  5AVP A;  1GP5 A;  3RZG A;  3QBQ A;  4OUS A;  2YDE A;  1LED A;  5DDJ 2;  3VD4 A;  3PUS A;  3M8L A;  3E6B A;  2Y6H A;  4JC1 A;  4OI0 A;  4XJA A;  3AM2 A;  4JHT A;  5HV0 A;  3O1R A;  4JHZ A;  3Q8F A;  4Y33 A;  5FP9 A;  4UFH A;  4DY3 A;  1H6Y A;  1LJ7 A;  2P3I A;  3AZX A;  4XUT A;  3ZM8 A;  4FOQ A;  1W6O B;  4Y4R A;  3ZFG A;  1S0I A;  5JXH A;  1J3P A;  3RZH A;  1V9U 3;  2ZKN A;  2DUR A;  1V6L A;  2GC0 A;  5FUN A;  2E33 A;  5FRA A;  2RE9 A;  4PDW A;  1VMF A;  4ZXE A;  4Z92 B;  3DXT A;  2K2S A;  4YGB A;  2SBA A;  2IXK A;  3AP7 A;  1TNR A;  2R06 1;  4PI0 A;  5K9Y A;  3VDA A;  2JDY A;  3QLQ A;  5CIR A;  2ZBJ A;  4YGD A;  1GZW B;  2P2K A;  5FZF A;  3ZYH A;  4YZ4 A;  1CAV B;  3K2O A;  3RS6 A;  1MQT B;  5J3U A;  4BQW A;  1QH7 A;  4HVR A;  5FZC A;  2VZP A;  3WCR A;  5BNP A;  5JAX A;  1KRI A;  4UFJ A;  1DZT A;  2IXJ A;  2QQJ A;  4DQA A;  4E4H A;  3M3O A;  4ES8 A;  4AVC A;  3ILR A;  3V0B B;  2P6C A;  3N9L A;  3OPW A;  2WS9 3;  2D3P A;  2CGP A;  1YQ6 A;  2BQP A;  5CIS A;  5C5U A;  4D7T A;  3KVA A;  3C7E A;  4FTE A;  3M1H A;  1UCX A;  1YWK A;  3AXE A;  2QVS B;  1AR9 2;  2XQR A;  1YIF A;  4XXA A;  3D8C A;  2FMY A;  4BQ5 A;  4DXZ A;  5IFT A;  3G6J B;  1UMH A;  4H14 A;  4CEY C;  4QM8 A;  1W3V A;  4HKW A;  4CXX A;  2YU2 A;  5GJ6 A;  2ZAH A;  3M3C A;  2YXS A;  5AVA A;  4YW4 A;  1V9U 1;  1PGL 2;  4YVS A;  3K4Z A;  2X09 A;  5FZG A;  4W6W A;  4ONU A;  1WD3 A;  4MO3 M;  4MGY E;  5C3O A;  5FPB A;  2UYB A;  5EYX A;  4NPM A;  4KWK A;  2XLA A;  1CR7 A;  4QPG B;  4CEY B;  2A7A A;  5F1R A;  4O61 A;  1FYU A;  4AFA A;  3B5L B;  1E5H A;  2LRO A;  2E7A A;  4CEW A;  5ABJ B;  4D6Q A;  5GM0 A;  3O0X A;  1TMF 3;  4AHX A;  1VBA 3;  4CP9 B;  1J1L A;  2PQS A;  4R9D A;  4C91 A;  2XBO 2;  4YG6 A;  1C5H A;  3O0V A;  2ZMN A;  2WS9 1;  1UY2 A;  1C8M 2;  2RHP A;  3WR0 A;  4COV A;  3OBZ A;  5C4W C;  3O5S A;  1U0A A;  1QKQ A;  5A7Q A;  4EE2 A;  1A8M A;  5FJK A;  4HXC A;  2AC1 A;  4ATF A;  2R6Q A;  2HWF 2;  3IT8 A;  3LDK A;  5DZE A;  1EV1 2;  3AL5 A;  3F2Z A;  2WT2 A;  4GMP 3;  3C7F A;  5JMC A;  1R09 2;  3NKT A;  3M2M A;  3WCS A;  1NE6 A;  4A7Y A;  5FMO S;  3R6S A;  1GSL A;  5FXX A;  2ZCW A;  4N9I A;  2J7M A;  3JD7 3;  3VDB A;  5HCF A;  4NIH A;  1AR7 2;  1V6N A;  5FZ3 A;  5FY0 A;  5FK8 A;  5C4W B;  1HRI 3;  3DYM A;  1UD1 A;  3ECQ A;  3H3L A;  2LW8 A;  1PIV 3;  5T3N A;  1C3H A;  1SPP A;  2DUQ A;  4O9G A;  5FZO B;  4GIQ A;  5FYU A;  4AZZ A;  1QOT A;  1QOS A;  1RVF 3;  2GH8 A;  3AMM A;  4C90 A;  4F8A A;  2DCJ A;  3WW3 A;  2B7Y A;  2B4K A;  3I2F A;  1YFU A;  4CP2 A;  2WRA A;  4YLZ A;  1XU2 A;  1TMF 1;  2C9K A;  3OBR A;  3SKJ E;  1WBF A;  1F31 A;  1VBA 1;  1PNF A;  2DCZ A;  4BK4 A;  3SLI A;  1RUC 3;  3PUQ A;  5A32 B;  4OQ8 A;  1HIX A;  1FX5 A;  3LIG A;  1Y9M A;  3MDP A;  5JR2 A;  4NRP A;  4OI2 A;  4BU2 A;  1G7Y A;  4GXL A;  4JTN A;  5G05 L;  1O4Z A;  3HNY M;  3BTY A;  1DFQ A;  3WG4 A;  5FFO C;  4XUO A;  4XIK A;  1DZQ A;  4GMP 1;  2WQ8 A;  5JZG A;  2BV4 A;  4GB3 3;  5E16 A;  1K45 A;  3QH6 A;  3J26 N;  3JD7 1;  3NMB A;  3NV4 A;  4M4P A;  4GAZ A;  3ZPY A;  4FOY A;  4XJ9 A;  3BN6 A;  1APN A;  3IDC B;  3VZN A;  1HRI 1;  1PVC 3;  3W59 A;  3WF0 A;  1PIV 1;  3UJQ A;  4AGV A;  2VTX J;  1SBF A;  1YCI A;  1MS0 A;  1R08 2;  3ZSE A;  3ORJ A;  1UOB A;  5IVB A;  1Q3E A;  2HYX A;  1DQ5 A;  1RHI 3;  4Q4X 2;  3D82 A;  1ND3 A;  3B01 A;  4M3C E;  4G4F A;  3I2G A;  5DMY A;  3S30 A;  4YW2 A;  4XF9 A;  1NQJ A;  4HAN A;  4YG3 A;  4BQY A;  2AR6 A;  2GSY A;  1G8W A;  4Q0U A;  2FDK A;  3FHA A;  4XDP A;  4CDQ A;  5G04 L;  3V0B A;  5IW0 A;  5EWS A;  2B39 A;  3HNB M;  2V5Y A;  4B4Q A;  3ZKU A;  2PA7 A;  5A7N A;  2JE9 A;  2QDN A;  5DAQ A;  1LUL A;  5LA1 A;  3LA3 A;  2EID A;  3FUO A;  3NV2 A;  3JB8 A;  4Z07 A;  3PVB B;  1LU2 A;  3QOP A;  1WCU A;  2JD4 A;  3ZSK A;  3O1O A;  3KM5 A;  1ULD A;  1BLZ A;  4IE7 A;  3S5Q A;  3WVJ A;  4GB3 1;  3AKQ A;  4PBO A;  4WVM B;  3T2T A;  2DBI A;  1BHG A;  3NAP B;  2VTF A;  4B4R A;  1DP0 A;  5FP8 A;  1PVC 1;  1SFY A;  5A3W A;  2VBB A;  4Y26 A; 
#chains in the Genus database with same CATH homology
 4MOA A;  5JUV A;  2VQT A;  5DQ0 A;  4QX2 A;  4DXT A;  5B4N A;  4YPJ A;  2EIE A;  3T0B A;  5EJZ B;  2W92 A;  2V5D A;  1GOH A;  3ETP A;  3OGR A;  5CYY A;  5IHR A;  3K75 B;  1US3 A;  3BGA A;  2VJX A;  2JD9 A;  1UY3 A;  2VZU A;  4OYU A;  4P02 B;  3OEB A;  3GM8 A;  2YFU A;  3MUY 1;  3VD7 A;  3WNK A;  2VCB A;  2JDA A;  3MV1 1;  4QX0 A;  4P5Y A;  1UXX X;  2EIC A;  3K4D A;  4QDS A;  4CU7 A;  4DUV A;  4W50 A;  4DUW A;  2XQX A;  3WF1 A;  2VZ3 A;  5EJ1 B;  4LQR A;  5A1A A;  2QQO A;  1JZ7 A;  4E8C A;  5LA2 A;  4CUB A;  5C7G A;  4HG6 B;  2WAB A;  4D0Q A;  3GDB A;  2J1S A;  3D3A A;  1CZS A;  4E8D A;  5HXM A;  2ZEY A;  4GWJ A;  1W9W A;  3CDZ B;  1XC6 A;  4A42 A;  3T0A A;  1W8O A;  4KI5 M;  3WQB A;  2VZ1 A;  3SEE A;  2VZR A;  1T2X A;  4ARX A;  1JYW A;  2DDU A;  3T09 A;  2W46 A;  3OGS A;  3CMG A;  1PMJ X;  1NKG A;  2V4V A;  1PX4 A;  4OMD A;  3ACI A;  4RYD A;  3T2O A;  2VCC A;  2JKX A;  3I2K A;  1W99 A;  2RVA A;  1K12 A;  4A6O A;  5JXG A;  1WCQ A;  1GMM A;  3FL7 A;  2J1E A;  2VCA A;  1DLC A;  1PMH X;  4L0P A;  3EB7 A;  3P1I A;  2XOM A;  3I3B A;  3FHQ A;  2EIB A;  4ET7 A;  1KEX A;  1W0N A;  3NJV A;  2WO3 A;  4ZY9 A;  2L9L A;  2ORZ A;  1P8J A;  3WF4 A;  3WF2 A;  3HOB A;  2ZEW A;  3ACH A;  1CIY A;  3DEC A;  2QQI A;  1J83 A;  1ULP A;  4TXW A;  2LS6 A;  2QBX A;  3CQO A;  3THC A;  2W87 A;  4PT6 A;  1UMI A;  3LE0 A;  4UOJ A;  4XUN A;  3IB3 A;  2W47 A;  1GU3 A;  3NNG A;  3WSO A;  1UWW A;  1SHW B;  3OEA A;  3UES A;  2VQU A;  1W9S A;  3HPN A;  4Z2A A;  2W1Q A;  3A21 A;  5J1X A;  1MPX A;  4DXR A;  1UXZ A;  1SDD B;  2W1W A;  5FUI A;  2Y6L A;  4CVU A;  2CDO A;  4AAX A;  4QX1 A;  4GWI A;  4OMC A;  4QX3 A;  5JMO A;  3GGL A;  4DXS A;  3K4A A;  1CZV A;  2V72 A;  2E32 A;  4CUA A;  2VZO A;  1KGY A;  2WAO A;  2W91 A;  1GNY A;  4A3Z A;  2OKX A;  3NRU A;  3VD9 A;  2J1V A;  4TTG A;  2XHN A;  2WBK A;  2WN3 A;  4KWU A;  3C7O A;  4QAW A;  3OB8 A;  3IAQ A;  4XVH A;  2W1U A;  2ORX A;  2QQN A;  2W9X A;  2WO2 A;  3P6B A;  5JXI A;  3T2Q A;  3SEP A;  4MGQ A;  4CU6 A;  1JZ5 A;  1I5P A;  1GQP A;  3JXS A;  4CU8 A;  1EUT A;  4LKS A;  1UX7 A;  3GXU A;  3MO4 A;  2QQL A;  2VME A;  3U37 A;  1JZ2 A;  4AG4 A;  1F4H A;  3FN9 A;  5EIY B;  3UNP A;  3LEG A;  2ID4 A;  3HNM A;  3C7H A;  1OF3 A;  2WYS A;  2R7E B;  4CUC A;  3DYP A;  3MBW A;  3WEZ A;  5IYY A;  2BER A;  5LA0 A;  2W3J A;  4XUQ A;  3OGV A;  2YG0 A;  2BGO A;  2YFZ A;  4PF1 A;  2XON A;  1W8N A;  2Y64 A;  3WNO A;  3HEI A;  1RYY A;  2VOT A;  1LNS A;  5B4X A;  3CKH A;  2RJ2 A;  3A7Q A;  2VZT A;  4P08 A;  1ULO A;  5C70 A;  3WNL A;  2W5F A;  1EUU A;  2HLE A;  4JKL A;  2W1S A;  4XUP A;  5IJR A;  1UY0 A;  4XUR A;  3IAP A;  3VD5 A;  2WZE A;  3EYP A;  4DUX A;  1XPW A;  1K42 A;  5DN2 A;  3I2I A;  1L7R A;  1UY1 A;  2C26 A;  1JHJ A;  2VMF A;  1OD3 A;  2VR4 A;  2Y6G A;  2J22 A;  4BK5 A;  4OZO A;  4W4Z A;  5LCW L;  2DCK A;  3C7G A;  3HN3 A;  1JYN A;  1OH4 A;  4A41 A;  2W94 A;  3LPG A;  2J1A A;  3NJX A;  1GUI A;  4UI9 L;  2YC4 A;  5F7U A;  2WAA A;  4JKK A;  3AC0 A;  3DYO A;  1CZT A;  5I0D A;  2BZD A;  1D7P M;  2VC9 A;  2CDP A;  4QB2 A;  3VD4 A;  2WDB A;  2Y6H A;  4ZZ8 A;  1J84 A;  4JHZ A;  1SG3 A;  1H6Y A;  4JKM A;  3W5M A;  3VDC A;  4QB6 A;  4XUT A;  2E31 A;  3ZM8 A;  3ACG A;  3T0D A;  2Z4F A;  5JXH A;  2VL4 A;  2WN2 A;  1H6X A;  4D8M A;  2E33 A;  2Y6J A;  1JYX A;  4ZXE A;  3HJR A;  4FI9 A;  1L7Q A;  3VDA A;  1UYY A;  2VM9 A;  2VZP A;  2BBA A;  1JU4 A;  1K3I A;  1JZ4 A;  2QQJ A;  1JU3 A;  1OF4 A;  3A22 A;  3CZJ A;  3WNP A;  2RV9 A;  2QQM A;  3C7E A;  1JZ6 A;  4ZZ5 A;  1O8P A;  3I3E A;  1F4A A;  3OG2 A;  3LPF A;  4KMQ A;  1UZ0 A;  5IFT A;  5DPN A;  1UMH A;  3NQH A;  4JX0 A;  1UYX A;  4PQQ A;  2WZ8 A;  3I2H A;  3OBA A;  3ACF A;  3MUZ 1;  3K4Z A;  2X09 A;  3IDA A;  1JYV A;  3WF3 A;  2B9V A;  4MO3 M;  4BDV B;  2E26 A;  2KD7 A;  2VMD A;  4P00 B;  2W95 A;  2J1R A;  4ARY A;  2J1U A;  5HPO A;  3VD3 A;  2PQS A;  3LEK A;  4LPL A;  2X05 A;  1UYZ A;  1CX1 A;  1UY2 A;  3PUH A;  4IUG A;  1O59 A;  3K46 A;  5IFP A;  1R64 A;  2ZXQ A;  2X10 A;  1YQ2 A;  1OT5 A;  1NUK A;  3A23 A;  3F2Z A;  3C7F A;  4BXS V;  3I97 A;  1US2 A;  3E1F 1;  2WUH A;  2J7M A;  3I2J A;  4QDQ A;  4UAP A;  2C4X A;  4W8J A;  3VDB A;  3DYM A;  3ECQ A;  2LW8 A;  4LHS A;  3LQC A;  2YB7 A;  4A44 A;  1JI6 A;  3CZU A;  4QB1 A;  5JXJ A;  3LEI A;  4GZ9 A;  2DCJ A;  4DEV A;  3I2F A;  2B4K A;  4MGS A;  4A4A A;  2Y6K A;  2C9K A;  2VO5 A;  3SKJ E;  3MV0 1;  1WKY A;  3WNN A;  4BK4 A;  1GOF A;  3T08 A;  4DEQ A;  4OUE A;  1W9T A;  5JR2 A;  5G05 L;  3C8X A;  2VMC A;  3HNY M;  1NAE A;  4XUO A;  1IQD C;  2WQ8 A;  2VZS A;  1K45 A;  2QQK A;  1HN1 A;  4M4P A;  3SKV A;  1PX3 A;  3BN6 A;  3WF0 A;  2JE8 A;  1DYO A;  3UET A;  1GOG A;  1XNT A;  1JZ3 A;  2VZQ A;  3WNM A;  2HYX A;  2ZEX A;  2VZV A;  1UY4 A;  3PUI A;  2YC2 A;  1NX9 A;  4RN5 A;  3I2G A;  2BGP A;  5DMY A;  1JZ8 A;  3W5N A;  4M4R A;  3THD A;  4A45 A;  2Y8K A;  4CU9 A;  3I3D A;  2J1T A;  3FHA A;  4MAD A;  5G04 L;  3CIH A;  4QDR A;  3K77 A;  3HNB M;  1TVG A;  2ZEZ A;  5LA1 A;  3ABZ A;  2EID A;  5CZK A;  1XNA A;  3T2P A;  4XZU G;  3III A;  1O8S A;  4BJ0 A;  4QPW A;  1TG7 A;  1BHG A;  2WO1 A;  2VTF A;  1DP0 A;  5C71 A;  3J7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...