1CXOA

Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organization suggests the existence of a possible phospholipid binding site.
pubmed doi rcsb
source organism Naja nigricollis
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN GAMMA
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cxoA00
4OM5A 1PLOA 2ABXA 1ONJA 2QJ9C 1CRFA 1CB9A 2JVEA 1LX5B 1M9ZA 1BXPA 1I02A 1HC9B 5DO6A 1NXBA 1CXOA 1NYSA 1LSIA 2MUOA 2J8BA 2L03A 1KS6A 1IQ9A 1ES7B 1LJZA 1IK8A 1XT3A 2GOOC 1QKEA 3BT1U 1G6MA 2MUPA 3LAQU 1QM7A 1CDQA 1VB0A 1ZADA 1F8UB 2X8BB 4BDTB 2PJYB 2UWRA 1F94A 3EBXA 4OM4A 4FAOC 1CDSA 2QC1A 1IDHA 2MHYA 1HAAA 1HC9A 2L5SA 5DZ5A 1FSSB 1B41B 1CREA 1ABTA 2N99A 4EY8B 2HLQA 1QKDA 1MR6A 2OFSA 5IMYC 1JBDA 1KTZB 1KC4A 2NBTA 1NTNA 3BT2U 4P7UA 1S4YA 3HH7A 3NH7A 3KFDE 1KXIA 1NEAA 2QJAC 2H7ZA 1KL8A 4UY2C 4AEAA 1CTXA 1KBAA 3KFDI 1COEA 1IDLA 2LCRA 1LXHA 1LXGA 2PJYC 2CRTA 2HLRA 1CDRA 1FRAA 4BIKB 5IMTD 1MAHF 1TXBA 2JQPA 1FFJA 2VLWA 3U74U 2GOOB 1FASA 2MJYA 4DO8A 1FSCA 1IKCA 1CODA 4RUDA 1W6BA 2MFAA 5EBXA 2BHIA 1TGXA 2CRSA 4FAOE 1ERGA 2H5FA 1L4WA 2MJ4A 2H64C 2H7ZB 3EVSC 2CCXA 1KBTA 2CTXA 1KU6B 5DU1A 4QTIU 4IYEA 1V6PA 3VTSA 1JGKA 2H62C 2BTXA 1NTXA 2H62D 1BTEA 2LA1A 3ERAA 1IDIA 1H0JA 1FF4A 1CCQA 1HAJA 2UX2A 1REWC 1DRSA 4HQPF 2QJBC 2CDXA 1YWHA 2K3GA 1CHVS 2ERAA 3PLCA 1ERAA 1KBSA 2I9BE 1RL5A 1UG4A 3NDSA 2FD6U 1NORA 1RGJA 1TFSA 4LFTA 1CDTA 4XJJA 3NEQA 1CXNA 2MJ0A 2H64B 1CVOA 1NYUA 3QB4B 3U73U 1TXAA 1JE9A 1HOYA 6EBXA 1IJCA 1IDGA 3FEVA 4ZQYA 2H8UA 1KFHA
chains in the Genus database with same CATH superfamily
4OM5A 1PLOA 2ABXA 1ONJA 2QJ9C 1CRFA 1CB9A 2JVEA 1LX5B 1M9ZA 1BXPA 1I02A 1HC9B 5DO6A 1NXBA 1CXOA 1NYSA 1LSIA 2MUOA 2J8BA 2L03A 1KS6A 1IQ9A 1ES7B 1LJZA 1IK8A 1XT3A 2GOOC 1QKEA 3BT1U 1G6MA 2MUPA 3LAQU 1QM7A 1CDQA 1VB0A 1ZADA 1F8UB 2X8BB 4BDTB 2PJYB 2UWRA 1F94A 3EBXA 4OM4A 4FAOC 1CDSA 2QC1A 1IDHA 2MHYA 1HAAA 1HC9A 2L5SA 5DZ5A 1FSSB 1B41B 1CREA 4KSNA 1ABTA 2N99A 4EY8B 2HLQA 1QKDA 1MR6A 2OFSA 5IMYC 1JBDA 1KTZB 1KC4A 2NBTA 1NTNA 3BT2U 4P7UA 1S4YA 3HH7A 3NH7A 3KFDE 1KXIA 1NEAA 2QJAC 2H7ZA 1KL8A 4UY2C 4AEAA 1CTXA 1KBAA 3KFDI 1COEA 1IDLA 2LCRA 1LXHA 1LXGA 2PJYC 2CRTA 2HLRA 1CDRA 1FRAA 4BIKB 5IMTD 1MAHF 1TXBA 2JQPA 1FFJA 2VLWA 3U74U 2GOOB 1FASA 2MJYA 4DO8A 1FSCA 1IKCA 1CODA 4RUDA 1W6BA 2MFAA 5EBXA 2BHIA 1TGXA 2CRSA 4FAOE 1ERGA 2H5FA 1L4WA 2MJ4A 2H64C 2H7ZB 3EVSC 2CCXA 1KBTA 2CTXA 1KU6B 5DU1A 4QTIU 4IYEA 1V6PA 3VTSA 1JGKA 2H62C 2BTXA 1NTXA 2H62D 1BTEA 2LA1A 3ERAA 1IDIA 1H0JA 1FF4A 1CCQA 1HAJA 2UX2A 1REWC 1DRSA 4HQPF 2QJBC 2CDXA 1YWHA 2K3GA 1CHVS 2ERAA 3PLCA 1ERAA 1KBSA 2I9BE 1RL5A 1UG4A 3NDSA 2FD6U 1NORA 1RGJA 1TFSA 4LFTA 1CDTA 4XJJA 3NEQA 1CXNA 2MJ0A 2H64B 1CVOA 1NYUA 3QB4B 3U73U 1TXAA 1JE9A 1HOYA 6EBXA 1IJCA 1IDGA 3FEVA 4ZQYA 2H8UA 1KFHA
chains in the Genus database with same CATH topology
4OM5A 1PLOA 2ABXA 1ONJA 2QJ9C 1CRFA 1CB9A 2JVEA 1LX5B 1M9ZA 1BXPA 1I02A 1HC9B 5DO6A 1NXBA 1CXOA 1NYSA 1LSIA 2MUOA 2J8BA 2L03A 1KS6A 1IQ9A 1ES7B 1LJZA 1IK8A 1XT3A 2GOOC 1QKEA 3BT1U 1G6MA 2MUPA 3LAQU 1QM7A 1CDQA 1VB0A 1ZADA 1F8UB 2X8BB 4BDTB 2PJYB 2UWRA 1F94A 3EBXA 4OM4A 4FAOC 1CDSA 2QC1A 1IDHA 2MHYA 1HAAA 1HC9A 2L5SA 5DZ5A 1FSSB 1B41B 1CREA 4KSNA 1ABTA 2N99A 4EY8B 2HLQA 1QKDA 1MR6A 2OFSA 5IMYC 1JBDA 1KTZB 1KC4A 2NBTA 1NTNA 3BT2U 4P7UA 1S4YA 3HH7A 3NH7A 3KFDE 1KXIA 1NEAA 2QJAC 2H7ZA 1KL8A 4UY2C 4AEAA 1CTXA 1KBAA 3KFDI 1COEA 1IDLA 2LCRA 1LXHA 1LXGA 2PJYC 2CRTA 2HLRA 1CDRA 1FRAA 4BIKB 5IMTD 1MAHF 1TXBA 2JQPA 1FFJA 2VLWA 3U74U 2GOOB 1FASA 2MJYA 4DO8A 1FSCA 1IKCA 1CODA 4RUDA 1W6BA 2MFAA 5EBXA 2BHIA 1TGXA 2CRSA 4FAOE 1ERGA 2H5FA 1L4WA 2MJ4A 2H64C 2H7ZB 3EVSC 2CCXA 1KBTA 2CTXA 1KU6B 5DU1A 4QTIU 4IYEA 1V6PA 3VTSA 1JGKA 2H62C 2BTXA 1NTXA 2H62D 1BTEA 2LA1A 3ERAA 1IDIA 1H0JA 1FF4A 1CCQA 1HAJA 2UX2A 1REWC 1DRSA 4HQPF 2QJBC 2CDXA 1YWHA 2K3GA 1CHVS 2ERAA 3PLCA 1ERAA 1KBSA 2I9BE 1RL5A 1UG4A 3NDSA 2FD6U 1NORA 1RGJA 1TFSA 4LFTA 1CDTA 4XJJA 3NEQA 1CXNA 2MJ0A 2H64B 1CVOA 1NYUA 3QB4B 3U73U 1TXAA 1JE9A 1HOYA 6EBXA 1IJCA 1IDGA 3FEVA 4ZQYA 2H8UA 1KFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM5 A;  1PLO A;  2ABX A;  1ONJ A;  2QJ9 C;  1CRF A;  1CB9 A;  2JVE A;  1LX5 B;  1M9Z A;  1BXP A;  1I02 A;  1HC9 B;  5DO6 A;  1NXB A;  1CXO A;  1NYS A;  1LSI A;  2MUO A;  2J8B A;  2L03 A;  1KS6 A;  1IQ9 A;  1ES7 B;  1LJZ A;  1IK8 A;  1XT3 A;  2GOO C;  1QKE A;  3BT1 U;  1G6M A;  2MUP A;  3LAQ U;  1QM7 A;  1CDQ A;  1VB0 A;  1ZAD A;  1F8U B;  2X8B B;  4BDT B;  2PJY B;  2UWR A;  1F94 A;  3EBX A;  4OM4 A;  4FAO C;  1CDS A;  2QC1 A;  1IDH A;  2MHY A;  1HAA A;  1HC9 A;  2L5S A;  5DZ5 A;  1FSS B;  1B41 B;  1CRE A;  1ABT A;  2N99 A;  4EY8 B;  2HLQ A;  1QKD A;  1MR6 A;  2OFS A;  5IMY C;  1JBD A;  1KTZ B;  1KC4 A;  2NBT A;  1NTN A;  3BT2 U;  4P7U A;  1S4Y A;  3HH7 A;  3NH7 A;  3KFD E;  1KXI A;  1NEA A;  2QJA C;  2H7Z A;  1KL8 A;  4UY2 C;  4AEA A;  1CTX A;  1KBA A;  3KFD I;  1COE A;  1IDL A;  2LCR A;  1LXH A;  1LXG A;  2PJY C;  2CRT A;  2HLR A;  1CDR A;  1FRA A;  4BIK B;  5IMT D;  1MAH F;  1TXB A;  2JQP A;  1FFJ A;  2VLW A;  3U74 U;  2GOO B;  1FAS A;  2MJY A;  4DO8 A;  1FSC A;  1IKC A;  1COD A;  4RUD A;  1W6B A;  2MFA A;  5EBX A;  2BHI A;  1TGX A;  2CRS A;  4FAO E;  1ERG A;  2H5F A;  1L4W A;  2MJ4 A;  2H64 C;  2H7Z B;  3EVS C;  2CCX A;  1KBT A;  2CTX A;  1KU6 B;  5DU1 A;  4QTI U;  4IYE A;  1V6P A;  3VTS A;  1JGK A;  2H62 C;  2BTX A;  1NTX A;  2H62 D;  1BTE A;  2LA1 A;  3ERA A;  1IDI A;  1H0J A;  1FF4 A;  1CCQ A;  1HAJ A;  2UX2 A;  1REW C;  1DRS A;  4HQP F;  2QJB C;  2CDX A;  1YWH A;  2K3G A;  1CHV S;  2ERA A;  3PLC A;  1ERA A;  1KBS A;  2I9B E;  1RL5 A;  1UG4 A;  3NDS A;  2FD6 U;  1NOR A;  1RGJ A;  1TFS A;  4LFT A;  1CDT A;  4XJJ A;  3NEQ A;  1CXN A;  2MJ0 A;  2H64 B;  1CVO A;  1NYU A;  3QB4 B;  3U73 U;  1TXA A;  1JE9 A;  1HOY A;  6EBX A;  1IJC A;  1IDG A;  3FEV A;  4ZQY A;  2H8U A;  1KFH A; 
#chains in the Genus database with same CATH topology
 4OM5 A;  1PLO A;  2ABX A;  1ONJ A;  2QJ9 C;  1CRF A;  1CB9 A;  2JVE A;  1LX5 B;  1M9Z A;  1BXP A;  1I02 A;  1HC9 B;  5DO6 A;  1NXB A;  1CXO A;  1NYS A;  1LSI A;  2MUO A;  2J8B A;  2L03 A;  1KS6 A;  1IQ9 A;  1ES7 B;  1LJZ A;  1IK8 A;  1XT3 A;  2GOO C;  1QKE A;  3BT1 U;  1G6M A;  2MUP A;  3LAQ U;  1QM7 A;  1CDQ A;  1VB0 A;  1ZAD A;  1F8U B;  2X8B B;  4BDT B;  2PJY B;  2UWR A;  1F94 A;  3EBX A;  4OM4 A;  4FAO C;  1CDS A;  2QC1 A;  1IDH A;  2MHY A;  1HAA A;  1HC9 A;  2L5S A;  5DZ5 A;  1FSS B;  1B41 B;  1CRE A;  4KSN A;  1ABT A;  2N99 A;  4EY8 B;  2HLQ A;  1QKD A;  1MR6 A;  2OFS A;  5IMY C;  1JBD A;  1KTZ B;  1KC4 A;  2NBT A;  1NTN A;  3BT2 U;  4P7U A;  1S4Y A;  3HH7 A;  3NH7 A;  3KFD E;  1KXI A;  1NEA A;  2QJA C;  2H7Z A;  1KL8 A;  4UY2 C;  4AEA A;  1CTX A;  1KBA A;  3KFD I;  1COE A;  1IDL A;  2LCR A;  1LXH A;  1LXG A;  2PJY C;  2CRT A;  2HLR A;  1CDR A;  1FRA A;  4BIK B;  5IMT D;  1MAH F;  1TXB A;  2JQP A;  1FFJ A;  2VLW A;  3U74 U;  2GOO B;  1FAS A;  2MJY A;  4DO8 A;  1FSC A;  1IKC A;  1COD A;  4RUD A;  1W6B A;  2MFA A;  5EBX A;  2BHI A;  1TGX A;  2CRS A;  4FAO E;  1ERG A;  2H5F A;  1L4W A;  2MJ4 A;  2H64 C;  2H7Z B;  3EVS C;  2CCX A;  1KBT A;  2CTX A;  1KU6 B;  5DU1 A;  4QTI U;  4IYE A;  1V6P A;  3VTS A;  1JGK A;  2H62 C;  2BTX A;  1NTX A;  2H62 D;  1BTE A;  2LA1 A;  3ERA A;  1IDI A;  1H0J A;  1FF4 A;  1CCQ A;  1HAJ A;  2UX2 A;  1REW C;  1DRS A;  4HQP F;  2QJB C;  2CDX A;  1YWH A;  2K3G A;  1CHV S;  2ERA A;  3PLC A;  1ERA A;  1KBS A;  2I9B E;  1RL5 A;  1UG4 A;  3NDS A;  2FD6 U;  1NOR A;  1RGJ A;  1TFS A;  4LFT A;  1CDT A;  4XJJ A;  3NEQ A;  1CXN A;  2MJ0 A;  2H64 B;  1CVO A;  1NYU A;  3QB4 B;  3U73 U;  1TXA A;  1JE9 A;  1HOY A;  6EBX A;  1IJC A;  1IDG A;  3FEV A;  4ZQY A;  2H8U A;  1KFH A; 
#chains in the Genus database with same CATH homology
 4OM5 A;  1PLO A;  2ABX A;  1ONJ A;  2QJ9 C;  1CRF A;  1CB9 A;  2JVE A;  1LX5 B;  1M9Z A;  1BXP A;  1I02 A;  1HC9 B;  5DO6 A;  1NXB A;  1CXO A;  1NYS A;  1LSI A;  2MUO A;  2J8B A;  2L03 A;  1KS6 A;  1IQ9 A;  1ES7 B;  1LJZ A;  1IK8 A;  1XT3 A;  2GOO C;  1QKE A;  3BT1 U;  1G6M A;  2MUP A;  3LAQ U;  1QM7 A;  1CDQ A;  1VB0 A;  1ZAD A;  1F8U B;  2X8B B;  4BDT B;  2PJY B;  2UWR A;  1F94 A;  3EBX A;  4OM4 A;  4FAO C;  1CDS A;  2QC1 A;  1IDH A;  2MHY A;  1HAA A;  1HC9 A;  2L5S A;  5DZ5 A;  1FSS B;  1B41 B;  1CRE A;  4KSN A;  1ABT A;  2N99 A;  4EY8 B;  2HLQ A;  1QKD A;  1MR6 A;  2OFS A;  5IMY C;  1JBD A;  1KTZ B;  1KC4 A;  2NBT A;  1NTN A;  3BT2 U;  4P7U A;  1S4Y A;  3HH7 A;  3NH7 A;  3KFD E;  1KXI A;  1NEA A;  2QJA C;  2H7Z A;  1KL8 A;  4UY2 C;  4AEA A;  1CTX A;  1KBA A;  3KFD I;  1COE A;  1IDL A;  2LCR A;  1LXH A;  1LXG A;  2PJY C;  2CRT A;  2HLR A;  1CDR A;  1FRA A;  4BIK B;  5IMT D;  1MAH F;  1TXB A;  2JQP A;  1FFJ A;  2VLW A;  3U74 U;  2GOO B;  1FAS A;  2MJY A;  4DO8 A;  1FSC A;  1IKC A;  1COD A;  4RUD A;  1W6B A;  2MFA A;  5EBX A;  2BHI A;  1TGX A;  2CRS A;  4FAO E;  1ERG A;  2H5F A;  1L4W A;  2MJ4 A;  2H64 C;  2H7Z B;  3EVS C;  2CCX A;  1KBT A;  2CTX A;  1KU6 B;  5DU1 A;  4QTI U;  4IYE A;  1V6P A;  3VTS A;  1JGK A;  2H62 C;  2BTX A;  1NTX A;  2H62 D;  1BTE A;  2LA1 A;  3ERA A;  1IDI A;  1H0J A;  1FF4 A;  1CCQ A;  1HAJ A;  2UX2 A;  1REW C;  1DRS A;  4HQP F;  2QJB C;  2CDX A;  1YWH A;  2K3G A;  1CHV S;  2ERA A;  3PLC A;  1ERA A;  1KBS A;  2I9B E;  1RL5 A;  1UG4 A;  3NDS A;  2FD6 U;  1NOR A;  1RGJ A;  1TFS A;  4LFT A;  1CDT A;  4XJJ A;  3NEQ A;  1CXN A;  2MJ0 A;  2H64 B;  1CVO A;  1NYU A;  3QB4 B;  3U73 U;  1TXA A;  1JE9 A;  1HOY A;  6EBX A;  1IJC A;  1IDG A;  3FEV A;  4ZQY A;  2H8U A;  1KFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...