1CZMA

Drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
260
structure length
260
Chain Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE I
total genus 74
structure length 260
sequence length 260
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1993-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1czmA00
1UGDA 4YHAA 3V5GA 3FW3A 1T9NA 1YO1A 3NI5A 4JSZA 1ZH9A 4CA2A 3RJ7A 1AVNA 4WUPA 1ZSAA 4RFDA 2VVAX 1LGDA 2FOYA 4WUQA 3S9TA 4R59A 5FNGA 1KOQA 5E5RA 3IGPA 2POUA 4UOVA 1CNJA 3UYQA 3HS4A 1CA2A 12CAA 4M2WA 4QTLA 5SZ3A 5A6HA 3T85A 1UGBA 4KAPA 3K34A 5DSNA 1CAOA 1CAJA 3OYQA 1I9QA 3RZ5A 1DMYA 3PO6A 5SZ1A 4BCWA 5FNMA 4QSJA 1G54A 3KS3A 1CCSA 3KIGA 1CINA 2FMGA 4Y0JA 3QYKA 3HKNA 5FLRA 4K0ZA 2FNKA 3KOKA 3M14A 4KV0A 1TBTX 4R5AA 3RLDA 5SZ5A 5L3OA 1CNWA 4Q78A 2HNCA 4RUZA 4Q6DA 4HEZA 2NN1A 1I8ZA 2H15A 4LP6A 5DVXA 5EZTX 1G3ZA 1EOUA 3MHMA 4QJMA 2NWYA 4E3GA 3U3AX 1CIMA 4ZWXA 5SZ4A 1F2WA 2X7UA 3MNUA 3HLJA 5FNKA 1CILA 3RZ8A 1HVAA 1XEGA 2W2JA 3T84A 4Q7VA 1FSRA 4HEWA 4E49A 4JSWA 4FVOA 3RGEA 3S97A 3SBIA 5L6KA 1CVHA 1CVBA 1AZMA 1JCZA 3BL1A 1CALA 3DC9A 5JDVB 1UGGA 3Q31A 2O4ZA 1G4OA 1UGFA 4KNIA 3P5LA 3W6HA 1ZGEA 1FSQA 3T82A 3V7XA 4Z1NA 2NWPA 1TEQX 5FL6A 1RZEA 5DSRA 3BETA 3N2PA 3MNHA 2ABEA 5G0BA 4FRCA 4XZ5A 5FDCA 1G6VA 3N3JA 5JEGB 3HKUA 1CNKA 1FQMA 3M2YA 3MNIA 4Q08A 4G0CA 2Q1QA 3DCSA 1G4JA 2WEHA 4ZWYA 1TH9A 5FLOA 4Q81A 4KNJA 5E5UA 5SZ0A 1YDCA 4K1QA 3HFPA 4ZWZA 4ETQC 3FFPX 3M40A 3DAZA 1IF9A 3F8EA 4HF3A 1I9LA 1BNTA 5EKHA 1BV3A 3M3XA 4FVNA 1CVDA 4YYTA 1CANA 4FU5A 5FNHA 5J8ZA 1BNVA 1G52A 5DSPA 3V3JA 4E3HA 3D93A 3DCWA 3M04A 4KNMA 5SZ7A 3U7CA 3T5UA 4QK3A 3OIMA 3RG4A 2GD8A 4CNXA 2HD6A 3JXHC 3M2ZA 1Z9YA 4Q8YA 1TE3X 1RAZA 3P55A 4Q99A 4KUWA 4YWPA 1HECA 5EIJA 1FQLA 3UYNA 4WW8A 3S72B 4IDRX 5C8IA 1H9QA 3RYJB 1FQRA 2NXRA 1CCTA 1XQ0A 2X7TA 2HOCA 2WEOA 3IBLA 3DV7A 5DOGA 2WD3A 3B1BA 4YGNA 3RZ7A 9CA2A 4Q6EA 5DSMA 5FDIA 1YDAA 1BICA 1G1DA 3DA2A 3P44A 3CZVA 1G53A 4JS6A 3S78B 4ZAOA 2Q1BA 4QSIA 5IPZA 1YDBA 1CNXA 3CAJA 2QO8A 3M5SA 3OILA 5FLTA 4DZ9A 2POVA 4QSBA 5EKJA 3V2MA 5E2MA 4CACA 4HU1A 3U47A 3ZNCA 4Z1EA 2F14A 3D0NA 3JXGA 3M2XA 4RN4A 2NMXA 3RYXB 5E2SA 1CNHA 4Q09A 5DSIA 2OSMA 1CNBA 1HEDA 3V3FA 4KP8A 2NN7A 4YGJA 5AMLA 1CAMA 3RZ0B 1I9MA 5AMDA 4HT0A 4QJOA 3P3HA 5BRUA 1LZVA 3M96A 5E28A 3OKVA 4XE1A 1UGCA 4Q9YA 8CA2A 4RH2A 5FLQA 5EHVA 3MZCA 1J9WA 1BN4A 4Q07A 4X5SA 1G0FA 1G0EA 5JEPB 5CACA 5JQ0A 1BN1A 1BNNA 4E5QA 5EH8A 4JSAA 5EHEA 4L5VA 4MDGA 1CVFA 3JXFA 5DRSA 3SBHA 2Q38A 1MUAA 3MYQA 3IBUA 3OIKA 4QJXA 2WEJA 3DVDA 4YVYA 2FMZA 3P4VA 4QSAA 5FLSA 3P58A 1KEQA 3W6IA 2HKKA 3DD8A 3RYYA 1TG9A 3K2FA 3GZ0A 3S74B 3KOIA 4Z0QA 5E2NA 2EU2A 3FE4A 3S73B 4QIYA 1CVEA 4RFCA 2IT4A 4GL1X 1TEUX 4Q7PA 4PXXA 5JG3B 2HFWA 1LUGA 4YGKA 4K0TA 4Q90A 3DBUA 1HEAA 3HKQA 4TWMA 4E3DA 1RZCA 1FR4A 3T5ZA 1JD0A 1H9NA 5JESB 1Z93A 4QJPA 1LG6A 3CYUA 2CA2A 7CA2A 4MDMA 1RZDA 3ZP9A 4Z1KA 1MOOA 3DC3A 4M2UA 1DCBA 2X7SA 2NXTA 3RYVB 3MHCA 4ILXA 1RZBA 1KWRA 3MNKA 4BF1A 1OQ5A 5G03A 4CNRA 1ZFQA 4ITPA 5FNJA 1TB0X 3P5AA 3N4BA 2FOQA 4DZ7A 3KWAA 5G01A 3IAIA 3MNAA 1TTMA 1BNQA 1UGEA 5BNLA 4RUYA 3D9ZA 1XEVA 4FPTA 4Q7SA 4E4AA 1HEBA 3MDZA 1V9IC 3MWOA 5EH7A 4HEYA 4RUXA 4E3FA 1THKA 4YXUA 1IF4A 3VBDA 5CJFA 4E9OX 3MHLA 3IEOA 1HCAA 3M98A 5DSJA 4CNVA 2AX2A 4R5BA 1AM6A 4MLTA 5EOIA 1HUHA 4K0SA 4Q8XA 4Q0LA 5SZ6A 2NNVA 4XIXA 1YO0A 1BZMA 2POWA 1CCUA 4KUYA 1CRAA 1CVAA 1FLJA 1RJ5A 5LMDA 4QEFA 4YGLA 1FR7A 3M1KA 1CNGA 3R16A 4N0XB 4Q7WA 4N16A 3B4FA 3HKTA 3BL0A 1RAYA 5DSQA 3S71B 2AW1A 5BYIA 4QK1A 1BNUA 1CRMA 1KWQA 2EU3A 3RG3A 4PYYA 3TMJA 5JEHB 3NB5A 3PJJA 3M1QA 3CA2A 3U45X 4M2VA 3V2JA 5G0CA 5DSLA 3OKUA 2HL4A 1YO2A 2NNSA 1I9PA 4YXIA 3ML2A 3F4XA 4XIWA 1FSNA 5FL5A 3ML5A 3MHOA 4Q83A 3N0NA 4TWLA 4QY3A 5HPJA 2QOAA 2FOVA 1A42A 3DVCA 3OY0A 2OSFA 4LHIA 2FOSA 1I90A 5FNIA 1IF5A 2NNGA 5BRWA 3S76A 3MHIA 3D92A 1ZSCA 2WEGA 4ITOA 1RZAA 4KUVA 4WL4A 3P3JA 5CLUA 4Z1JA 3S75B 3M5TA 1ZE8A 3NJ9A 1CNCA 5E2RA 1URTA 1UGAA 3IBIA 1G46A 5JGTB 4Q49A 5A25A 5EHWA 1CAZA 3RZ1B 2FNMA 5JQTA 1RJ6A 1CAIA 2QP6A 3M1JA 3C7PA 4QJWA 4COQA 2GEHA 4JSSA 4WR7A 4K13A 3SAXA 3V3IB 4CNWA 2FW4A 2VVBX 3DD0A 5JG5B 3KKXA 3LXEA 1I91A 3M1WA 1CNIA 4FIKA 3IBNA 1BNWA 5FL4A 1CA3A 4G7AA 4KNNA 3RYZA 3DCCA 4ZX0A 4C3TA 3M2NA 3R17B 4PZHA 3S8XA 4HT2A 4L5WA 3T83A 4L5UA 2CABA 4RIVA 1CVCA 3EFIA 3M67A 4YX4A 4QK2A 1BCDA 3L14A 3SAPA 1CAKA 3PYKA 3EFTA 4QJ0A 4MLXA 2NWOA 4CQ0A 4ZX1A 1Z97A 1I9NA 1BN3A 3F7UA 4WW6A 1I9OA 5EKMA 1DMXA 2FNNA 5CA2A 2EZ7A 4BF6A 1CAYA 2FOUA 5DSKA 3MMFA 4MO8A 4ZWIA 2CBCA 2H4NA 4Q87A 2CBDA 4YGFA 1HCBA 4Q8ZA 1G48A 2NWZA 1FQNA 1JV0A 5FNLA 5DOHA 6CA2A 2ILIA 4PQ7A 4Q06A 4IWZA 1IF8A 5FLPA 3DVBA 1DCAA 3V3GB 1TG3A 1V9EA 4KP5A 4YXOA 3F7BA 3KNEA 4LU3A 2CBBA 1G45A 3K7KA 1YDDA 2CBEA 3MNJA 1KOPA 1OKMA 1Y7WA 1ZSBA 3KLDB 4PYXA 3M5EA 1ZGFA 2WD2A 1H4NA 1IF6A 3D8WA 3OYSA 5SZ2A 5JGSB 3TVOX 1ZFKA 4QIZA 4XFWA 5E2KA 5BRVA 4RIUA 1OKLA 2CBAA 4M2RA 1CAHA 4MTYA 1HUGA 1OKNA 1ZNCA 5AMGA 3S77B 5DSOA 1XPZA 2NXSA 4FL7A 4MDLA 1BNMA 3V3HB 3TVNX 1CZMA 3KONA 5EH5A 2ZNCA 2NNOA 1CNYA 4HBAA 1IF7A 1LG5A
chains in the Genus database with same CATH superfamily
1UGDA 4YHAA 3V5GA 3FW3A 1T9NA 1YO1A 3NI5A 4JSZA 1ZH9A 4CA2A 3RJ7A 1AVNA 4WUPA 1ZSAA 4RFDA 2VVAX 1LGDA 2FOYA 4WUQA 3S9TA 4R59A 5FNGA 1KOQA 5E5RA 3IGPA 2POUA 4UOVA 1CNJA 3UYQA 3HS4A 1CA2A 12CAA 4M2WA 4QTLA 5SZ3A 5A6HA 3T85A 1UGBA 4KAPA 3K34A 5DSNA 1CAOA 1CAJA 3OYQA 1I9QA 3RZ5A 1DMYA 3PO6A 5SZ1A 4BCWA 5FNMA 4QSJA 1G54A 3KS3A 1CCSA 3KIGA 1CINA 2FMGA 4Y0JA 3QYKA 3HKNA 5FLRA 4K0ZA 2FNKA 3KOKA 3M14A 4KV0A 1TBTX 4R5AA 3RLDA 5SZ5A 5L3OA 1CNWA 4Q78A 2HNCA 4RUZA 4Q6DA 4HEZA 2NN1A 1I8ZA 2H15A 4LP6A 5DVXA 5EZTX 1G3ZA 1EOUA 3MHMA 4QJMA 2NWYA 4E3GA 3U3AX 1CIMA 4ZWXA 5SZ4A 1F2WA 2X7UA 3MNUA 3HLJA 5FNKA 1CILA 3RZ8A 1HVAA 1XEGA 2W2JA 3T84A 4Q7VA 1FSRA 4HEWA 4E49A 4JSWA 4FVOA 3RGEA 3S97A 3SBIA 5L6KA 1CVHA 1CVBA 1AZMA 1JCZA 3BL1A 1CALA 3DC9A 5JDVB 1UGGA 3Q31A 2O4ZA 1G4OA 1UGFA 4KNIA 3P5LA 3W6HA 1ZGEA 1FSQA 3T82A 3V7XA 4Z1NA 2NWPA 1TEQX 5FL6A 1RZEA 5DSRA 3BETA 3N2PA 3MNHA 2ABEA 5G0BA 4FRCA 4XZ5A 5FDCA 1G6VA 3N3JA 5JEGB 3HKUA 1CNKA 1FQMA 3M2YA 3MNIA 4Q08A 4G0CA 2Q1QA 3DCSA 1G4JA 2WEHA 4ZWYA 1TH9A 5FLOA 4Q81A 4KNJA 5E5UA 5SZ0A 1YDCA 4K1QA 3HFPA 4ZWZA 4ETQC 3FFPX 3M40A 3DAZA 1IF9A 3F8EA 4HF3A 1I9LA 1BNTA 5EKHA 1BV3A 3M3XA 4FVNA 1CVDA 4YYTA 1CANA 4FU5A 5FNHA 5J8ZA 1BNVA 1G52A 5DSPA 3V3JA 4E3HA 3D93A 3DCWA 3M04A 4KNMA 5SZ7A 3U7CA 3T5UA 4QK3A 3OIMA 3RG4A 2GD8A 4CNXA 2HD6A 3JXHC 3M2ZA 1Z9YA 4Q8YA 1TE3X 1RAZA 3P55A 4Q99A 4KUWA 4YWPA 1HECA 5EIJA 1FQLA 3UYNA 4WW8A 3S72B 4IDRX 5C8IA 1H9QA 3RYJB 1FQRA 2NXRA 1CCTA 1XQ0A 2X7TA 2HOCA 2WEOA 3IBLA 3DV7A 5DOGA 2WD3A 3B1BA 4YGNA 3RZ7A 9CA2A 4Q6EA 5DSMA 5FDIA 1YDAA 1BICA 1G1DA 3DA2A 3P44A 3CZVA 1G53A 4JS6A 3S78B 4ZAOA 2Q1BA 4QSIA 5IPZA 1YDBA 1CNXA 3CAJA 2QO8A 3M5SA 3OILA 5FLTA 4DZ9A 2POVA 4QSBA 5EKJA 3V2MA 5E2MA 4CACA 4HU1A 3U47A 3ZNCA 4Z1EA 2F14A 3D0NA 3JXGA 3M2XA 4RN4A 2NMXA 3RYXB 5E2SA 1CNHA 4Q09A 5DSIA 2OSMA 1CNBA 1HEDA 3V3FA 4KP8A 2NN7A 4YGJA 5AMLA 1CAMA 3RZ0B 1I9MA 5AMDA 4HT0A 4QJOA 3P3HA 5BRUA 1LZVA 3M96A 5E28A 3OKVA 4XE1A 1UGCA 4Q9YA 8CA2A 4RH2A 5FLQA 5EHVA 3MZCA 1J9WA 1BN4A 4Q07A 4X5SA 1G0FA 1G0EA 5JEPB 5CACA 5JQ0A 1BN1A 1BNNA 4E5QA 5EH8A 4JSAA 5EHEA 4L5VA 4MDGA 1CVFA 3JXFA 5DRSA 3SBHA 2Q38A 1MUAA 3MYQA 3IBUA 3OIKA 4QJXA 2WEJA 3DVDA 4YVYA 2FMZA 3P4VA 4QSAA 5FLSA 3P58A 1KEQA 3W6IA 2HKKA 3DD8A 3RYYA 1TG9A 3K2FA 3GZ0A 3S74B 3KOIA 4Z0QA 5E2NA 2EU2A 3FE4A 3S73B 4QIYA 1CVEA 4RFCA 2IT4A 4GL1X 1TEUX 4Q7PA 4PXXA 5JG3B 2HFWA 1LUGA 4YGKA 4K0TA 4Q90A 3DBUA 1HEAA 3HKQA 4TWMA 4E3DA 1RZCA 1FR4A 3T5ZA 1JD0A 1H9NA 5JESB 1Z93A 4QJPA 1LG6A 3CYUA 2CA2A 7CA2A 4MDMA 1RZDA 3ZP9A 4Z1KA 1MOOA 3DC3A 4M2UA 1DCBA 2X7SA 2NXTA 3RYVB 3MHCA 4ILXA 1RZBA 1KWRA 3MNKA 4BF1A 1OQ5A 5G03A 4CNRA 1ZFQA 4ITPA 5FNJA 1TB0X 3P5AA 3N4BA 2FOQA 4DZ7A 3KWAA 5G01A 3IAIA 3MNAA 1TTMA 1BNQA 1UGEA 5BNLA 4RUYA 3D9ZA 1XEVA 4FPTA 4Q7SA 4E4AA 1HEBA 3MDZA 1V9IC 3MWOA 5EH7A 4HEYA 4RUXA 4E3FA 1THKA 4YXUA 1IF4A 3VBDA 5CJFA 4E9OX 3MHLA 3IEOA 1HCAA 3M98A 5DSJA 4CNVA 2AX2A 4R5BA 1AM6A 4MLTA 5EOIA 1HUHA 4K0SA 4Q8XA 4Q0LA 5SZ6A 2NNVA 4XIXA 1YO0A 1BZMA 2POWA 1CCUA 4KUYA 1CRAA 1CVAA 1FLJA 1RJ5A 5LMDA 4QEFA 4YGLA 1FR7A 3M1KA 1CNGA 3R16A 4N0XB 4Q7WA 4N16A 3B4FA 3HKTA 3BL0A 1RAYA 5DSQA 3S71B 2AW1A 5BYIA 4QK1A 1BNUA 1CRMA 1KWQA 2EU3A 3RG3A 4PYYA 3TMJA 5JEHB 3NB5A 3PJJA 3M1QA 3CA2A 3U45X 4M2VA 3V2JA 5G0CA 5DSLA 3OKUA 2HL4A 1YO2A 2NNSA 1I9PA 4YXIA 3ML2A 3F4XA 4XIWA 1FSNA 5FL5A 3ML5A 3MHOA 4Q83A 3N0NA 4TWLA 4QY3A 5HPJA 2QOAA 2FOVA 1A42A 3DVCA 3OY0A 2OSFA 4LHIA 2FOSA 1I90A 5FNIA 1IF5A 2NNGA 5BRWA 3S76A 3MHIA 3D92A 1ZSCA 2WEGA 4ITOA 1RZAA 4KUVA 4WL4A 3P3JA 5CLUA 4Z1JA 3S75B 3M5TA 1ZE8A 3NJ9A 1CNCA 5E2RA 1URTA 1UGAA 3IBIA 1G46A 5JGTB 4Q49A 5A25A 5EHWA 1CAZA 3RZ1B 2FNMA 5JQTA 1RJ6A 1CAIA 2QP6A 3M1JA 3C7PA 4QJWA 4COQA 2GEHA 4JSSA 4WR7A 4K13A 3SAXA 3V3IB 4CNWA 2FW4A 2VVBX 3DD0A 5JG5B 3KKXA 3LXEA 1I91A 3M1WA 1CNIA 4FIKA 3IBNA 1BNWA 5FL4A 1CA3A 4G7AA 4KNNA 3RYZA 3DCCA 4ZX0A 4C3TA 3M2NA 3R17B 4PZHA 3S8XA 4HT2A 4L5WA 3T83A 4L5UA 2CABA 4RIVA 1CVCA 3EFIA 3M67A 4YX4A 4QK2A 1BCDA 3L14A 3SAPA 1CAKA 3PYKA 3EFTA 4QJ0A 4MLXA 2NWOA 4CQ0A 4ZX1A 1Z97A 1I9NA 1BN3A 3F7UA 4WW6A 1I9OA 5EKMA 1DMXA 2FNNA 5CA2A 2EZ7A 4BF6A 1CAYA 2FOUA 5DSKA 3MMFA 4MO8A 4ZWIA 2CBCA 2H4NA 4Q87A 2CBDA 4YGFA 1HCBA 4Q8ZA 1G48A 2NWZA 1FQNA 1JV0A 5FNLA 5DOHA 6CA2A 2ILIA 4PQ7A 4Q06A 4IWZA 1IF8A 5FLPA 3DVBA 1DCAA 3V3GB 1TG3A 1V9EA 4KP5A 4YXOA 3F7BA 3KNEA 4LU3A 2CBBA 1G45A 3K7KA 1YDDA 2CBEA 3MNJA 1KOPA 1OKMA 1Y7WA 1ZSBA 3KLDB 4PYXA 3M5EA 1ZGFA 2WD2A 1H4NA 1IF6A 3D8WA 3OYSA 5SZ2A 5JGSB 3TVOX 1ZFKA 4QIZA 4XFWA 5E2KA 5BRVA 4RIUA 1OKLA 2CBAA 4M2RA 1CAHA 4MTYA 1HUGA 1OKNA 1ZNCA 5AMGA 3S77B 5DSOA 1XPZA 2NXSA 4FL7A 4MDLA 1BNMA 3V3HB 3TVNX 1CZMA 3KONA 5EH5A 2ZNCA 2NNOA 1CNYA 4HBAA 1IF7A 1LG5A
chains in the Genus database with same CATH topology
1UGDA 4YHAA 3V5GA 3FW3A 1T9NA 1YO1A 3NI5A 4JSZA 1ZH9A 4CA2A 3RJ7A 1AVNA 4WUPA 1ZSAA 4RFDA 2VVAX 1LGDA 2FOYA 4WUQA 3S9TA 4R59A 5FNGA 1KOQA 5E5RA 3IGPA 2POUA 4UOVA 1CNJA 3UYQA 3HS4A 1CA2A 12CAA 4M2WA 4QTLA 5SZ3A 5A6HA 3T85A 1UGBA 4KAPA 3K34A 5DSNA 1CAOA 1CAJA 3OYQA 1I9QA 3RZ5A 1DMYA 3PO6A 5SZ1A 4BCWA 5FNMA 4QSJA 1G54A 3KS3A 1CCSA 3KIGA 1CINA 2FMGA 4Y0JA 3QYKA 3HKNA 5FLRA 4K0ZA 2FNKA 3KOKA 3M14A 4KV0A 1TBTX 4R5AA 3RLDA 5SZ5A 5L3OA 1CNWA 4Q78A 2HNCA 4RUZA 4Q6DA 4HEZA 2NN1A 1I8ZA 2H15A 4LP6A 5DVXA 5EZTX 1G3ZA 1EOUA 3MHMA 4QJMA 2NWYA 4E3GA 3U3AX 1CIMA 4ZWXA 5SZ4A 1F2WA 2X7UA 3MNUA 3HLJA 5FNKA 1CILA 3RZ8A 1HVAA 1XEGA 2W2JA 3T84A 4Q7VA 1FSRA 4HEWA 4E49A 4JSWA 4FVOA 3RGEA 3S97A 3SBIA 5L6KA 1CVHA 1CVBA 1AZMA 1JCZA 3BL1A 1CALA 3DC9A 5JDVB 1UGGA 3Q31A 2O4ZA 1G4OA 1UGFA 4KNIA 3P5LA 3W6HA 1ZGEA 1FSQA 3T82A 3V7XA 4Z1NA 2NWPA 1TEQX 5FL6A 1RZEA 5DSRA 3BETA 3N2PA 3MNHA 2ABEA 5G0BA 4FRCA 4XZ5A 5FDCA 1G6VA 3N3JA 5JEGB 3HKUA 1CNKA 1FQMA 3M2YA 3MNIA 4Q08A 4G0CA 2Q1QA 3DCSA 1G4JA 2WEHA 4ZWYA 1TH9A 5FLOA 4Q81A 4KNJA 5E5UA 5SZ0A 1YDCA 4K1QA 3HFPA 4ZWZA 4ETQC 3FFPX 3M40A 3DAZA 1IF9A 3F8EA 4HF3A 1I9LA 1BNTA 5EKHA 1BV3A 3M3XA 4FVNA 1CVDA 4YYTA 1CANA 4FU5A 5FNHA 5J8ZA 1BNVA 1G52A 5DSPA 3V3JA 4E3HA 3D93A 3DCWA 3M04A 4KNMA 5SZ7A 3U7CA 3T5UA 4QK3A 3OIMA 3RG4A 2GD8A 4CNXA 2HD6A 3JXHC 3M2ZA 1Z9YA 4Q8YA 1TE3X 1RAZA 3P55A 4Q99A 4KUWA 4YWPA 1HECA 5EIJA 1FQLA 3UYNA 4WW8A 3S72B 4IDRX 5C8IA 1H9QA 3RYJB 1FQRA 2NXRA 1CCTA 1XQ0A 2X7TA 2HOCA 2WEOA 3IBLA 3DV7A 5DOGA 2WD3A 3B1BA 4YGNA 3RZ7A 9CA2A 4Q6EA 5DSMA 5FDIA 1YDAA 1BICA 1G1DA 3DA2A 3P44A 3CZVA 1G53A 4JS6A 3S78B 4ZAOA 2Q1BA 4QSIA 5IPZA 1YDBA 1CNXA 3CAJA 2QO8A 3M5SA 3OILA 5FLTA 4DZ9A 2POVA 4QSBA 5EKJA 3V2MA 5E2MA 4CACA 4HU1A 3U47A 3ZNCA 4Z1EA 2F14A 3D0NA 3JXGA 3M2XA 4RN4A 2NMXA 3RYXB 5E2SA 1CNHA 4Q09A 5DSIA 2OSMA 1CNBA 1HEDA 3V3FA 4KP8A 2NN7A 4YGJA 5AMLA 1CAMA 3RZ0B 1I9MA 5AMDA 4HT0A 4QJOA 3P3HA 5BRUA 1LZVA 3M96A 5E28A 3OKVA 4XE1A 1UGCA 4Q9YA 8CA2A 4RH2A 5FLQA 5EHVA 3MZCA 1J9WA 1BN4A 4Q07A 4X5SA 1G0FA 1G0EA 5JEPB 5CACA 5JQ0A 1BN1A 1BNNA 4E5QA 5EH8A 4JSAA 5EHEA 4L5VA 4MDGA 1CVFA 3JXFA 5DRSA 3SBHA 2Q38A 1MUAA 3MYQA 3IBUA 3OIKA 4QJXA 2WEJA 3DVDA 4YVYA 2FMZA 3P4VA 4QSAA 5FLSA 3P58A 1KEQA 3W6IA 2HKKA 3DD8A 3RYYA 1TG9A 3K2FA 3GZ0A 3S74B 3KOIA 4Z0QA 5E2NA 2EU2A 3FE4A 3S73B 4QIYA 1CVEA 4RFCA 2IT4A 4GL1X 1TEUX 4Q7PA 4PXXA 5JG3B 2HFWA 1LUGA 4YGKA 4K0TA 4Q90A 3DBUA 1HEAA 3HKQA 4TWMA 4E3DA 1RZCA 1FR4A 3T5ZA 1JD0A 1H9NA 5JESB 1Z93A 4QJPA 1LG6A 3CYUA 2CA2A 7CA2A 4MDMA 1RZDA 3ZP9A 4Z1KA 1MOOA 3DC3A 4M2UA 1DCBA 2X7SA 2NXTA 3RYVB 3MHCA 4ILXA 1RZBA 1KWRA 3MNKA 4BF1A 1OQ5A 5G03A 4CNRA 1ZFQA 4ITPA 5FNJA 1TB0X 3P5AA 3N4BA 2FOQA 4DZ7A 3KWAA 5G01A 3IAIA 3MNAA 1TTMA 1BNQA 1UGEA 5BNLA 4RUYA 3D9ZA 1XEVA 4FPTA 4Q7SA 4E4AA 1HEBA 3MDZA 1V9IC 3MWOA 5EH7A 4HEYA 4RUXA 4E3FA 1THKA 4YXUA 1IF4A 3VBDA 5CJFA 4E9OX 3MHLA 3IEOA 1HCAA 3M98A 5DSJA 4CNVA 2AX2A 4R5BA 1AM6A 4MLTA 5EOIA 1HUHA 4K0SA 4Q8XA 4Q0LA 5SZ6A 2NNVA 4XIXA 1YO0A 1BZMA 2POWA 1CCUA 4KUYA 1CRAA 1CVAA 1FLJA 1RJ5A 5LMDA 4QEFA 4YGLA 1FR7A 3M1KA 1CNGA 3R16A 4N0XB 4Q7WA 4N16A 3B4FA 3HKTA 3BL0A 1RAYA 5DSQA 3S71B 2AW1A 5BYIA 4QK1A 1BNUA 1CRMA 1KWQA 2EU3A 3RG3A 4PYYA 3TMJA 5JEHB 3NB5A 3PJJA 3M1QA 3CA2A 3U45X 4M2VA 3V2JA 5G0CA 5DSLA 3OKUA 2HL4A 1YO2A 2NNSA 1I9PA 4YXIA 3ML2A 3F4XA 4XIWA 1FSNA 5FL5A 3ML5A 3MHOA 4Q83A 3N0NA 4TWLA 4QY3A 5HPJA 2QOAA 2FOVA 1A42A 3DVCA 3OY0A 2OSFA 4LHIA 2FOSA 1I90A 5FNIA 1IF5A 2NNGA 5BRWA 3S76A 3MHIA 3D92A 1ZSCA 2WEGA 4ITOA 1RZAA 4KUVA 4WL4A 3P3JA 5CLUA 4Z1JA 3S75B 3M5TA 1ZE8A 3NJ9A 1CNCA 5E2RA 1URTA 1UGAA 3IBIA 1G46A 5JGTB 4Q49A 5A25A 5EHWA 1CAZA 3RZ1B 2FNMA 5JQTA 1RJ6A 1CAIA 2QP6A 3M1JA 3C7PA 4QJWA 4COQA 2GEHA 4JSSA 4WR7A 4K13A 3SAXA 3V3IB 4CNWA 2FW4A 2VVBX 3DD0A 5JG5B 3KKXA 3LXEA 1I91A 3M1WA 1CNIA 4FIKA 3IBNA 1BNWA 5FL4A 1CA3A 4G7AA 4KNNA 3RYZA 3DCCA 4ZX0A 4C3TA 3M2NA 3R17B 4PZHA 3S8XA 4HT2A 4L5WA 3T83A 4L5UA 2CABA 4RIVA 1CVCA 3EFIA 3M67A 4YX4A 4QK2A 1BCDA 3L14A 3SAPA 1CAKA 3PYKA 3EFTA 4QJ0A 4MLXA 2NWOA 4CQ0A 4ZX1A 1Z97A 1I9NA 1BN3A 3F7UA 4WW6A 1I9OA 5EKMA 1DMXA 2FNNA 5CA2A 2EZ7A 4BF6A 1CAYA 2FOUA 5DSKA 3MMFA 4MO8A 4ZWIA 2CBCA 2H4NA 4Q87A 2CBDA 4YGFA 1HCBA 4Q8ZA 1G48A 2NWZA 1FQNA 1JV0A 5FNLA 5DOHA 6CA2A 2ILIA 4PQ7A 4Q06A 4IWZA 1IF8A 5FLPA 3DVBA 1DCAA 3V3GB 1TG3A 1V9EA 4KP5A 4YXOA 3F7BA 3KNEA 4LU3A 2CBBA 1G45A 3K7KA 1YDDA 2CBEA 3MNJA 1KOPA 1OKMA 1Y7WA 1ZSBA 3KLDB 4PYXA 3M5EA 1ZGFA 2WD2A 1H4NA 1IF6A 3D8WA 3OYSA 5SZ2A 5JGSB 3TVOX 1ZFKA 4QIZA 4XFWA 5E2KA 5BRVA 4RIUA 1OKLA 2CBAA 4M2RA 1CAHA 4MTYA 1HUGA 1OKNA 1ZNCA 5AMGA 3S77B 5DSOA 1XPZA 2NXSA 4FL7A 4MDLA 1BNMA 3V3HB 3TVNX 1CZMA 3KONA 5EH5A 2ZNCA 2NNOA 1CNYA 4HBAA 1IF7A 1LG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGD A;  4YHA A;  3V5G A;  3FW3 A;  1T9N A;  1YO1 A;  3NI5 A;  4JSZ A;  1ZH9 A;  4CA2 A;  3RJ7 A;  1AVN A;  4WUP A;  1ZSA A;  4RFD A;  2VVA X;  1LGD A;  2FOY A;  4WUQ A;  3S9T A;  4R59 A;  5FNG A;  1KOQ A;  5E5R A;  3IGP A;  2POU A;  4UOV A;  1CNJ A;  3UYQ A;  3HS4 A;  1CA2 A;  12CA A;  4M2W A;  4QTL A;  5SZ3 A;  5A6H A;  3T85 A;  1UGB A;  4KAP A;  3K34 A;  5DSN A;  1CAO A;  1CAJ A;  3OYQ A;  1I9Q A;  3RZ5 A;  1DMY A;  3PO6 A;  5SZ1 A;  4BCW A;  5FNM A;  4QSJ A;  1G54 A;  3KS3 A;  1CCS A;  3KIG A;  1CIN A;  2FMG A;  4Y0J A;  3QYK A;  3HKN A;  5FLR A;  4K0Z A;  2FNK A;  3KOK A;  3M14 A;  4KV0 A;  1TBT X;  4R5A A;  3RLD A;  5SZ5 A;  5L3O A;  1CNW A;  4Q78 A;  2HNC A;  4RUZ A;  4Q6D A;  4HEZ A;  2NN1 A;  1I8Z A;  2H15 A;  4LP6 A;  5DVX A;  5EZT X;  1G3Z A;  1EOU A;  3MHM A;  4QJM A;  2NWY A;  4E3G A;  3U3A X;  1CIM A;  4ZWX A;  5SZ4 A;  1F2W A;  2X7U A;  3MNU A;  3HLJ A;  5FNK A;  1CIL A;  3RZ8 A;  1HVA A;  1XEG A;  2W2J A;  3T84 A;  4Q7V A;  1FSR A;  4HEW A;  4E49 A;  4JSW A;  4FVO A;  3RGE A;  3S97 A;  3SBI A;  5L6K A;  1CVH A;  1CVB A;  1AZM A;  1JCZ A;  3BL1 A;  1CAL A;  3DC9 A;  5JDV B;  1UGG A;  3Q31 A;  2O4Z A;  1G4O A;  1UGF A;  4KNI A;  3P5L A;  3W6H A;  1ZGE A;  1FSQ A;  3T82 A;  3V7X A;  4Z1N A;  2NWP A;  1TEQ X;  5FL6 A;  1RZE A;  5DSR A;  3BET A;  3N2P A;  3MNH A;  2ABE A;  5G0B A;  4FRC A;  4XZ5 A;  5FDC A;  1G6V A;  3N3J A;  5JEG B;  3HKU A;  1CNK A;  1FQM A;  3M2Y A;  3MNI A;  4Q08 A;  4G0C A;  2Q1Q A;  3DCS A;  1G4J A;  2WEH A;  4ZWY A;  1TH9 A;  5FLO A;  4Q81 A;  4KNJ A;  5E5U A;  5SZ0 A;  1YDC A;  4K1Q A;  3HFP A;  4ZWZ A;  4ETQ C;  3FFP X;  3M40 A;  3DAZ A;  1IF9 A;  3F8E A;  4HF3 A;  1I9L A;  1BNT A;  5EKH A;  1BV3 A;  3M3X A;  4FVN A;  1CVD A;  4YYT A;  1CAN A;  4FU5 A;  5FNH A;  5J8Z A;  1BNV A;  1G52 A;  5DSP A;  3V3J A;  4E3H A;  3D93 A;  3DCW A;  3M04 A;  4KNM A;  5SZ7 A;  3U7C A;  3T5U A;  4QK3 A;  3OIM A;  3RG4 A;  2GD8 A;  4CNX A;  2HD6 A;  3JXH C;  3M2Z A;  1Z9Y A;  4Q8Y A;  1TE3 X;  1RAZ A;  3P55 A;  4Q99 A;  4KUW A;  4YWP A;  1HEC A;  5EIJ A;  1FQL A;  3UYN A;  4WW8 A;  3S72 B;  4IDR X;  5C8I A;  1H9Q A;  3RYJ B;  1FQR A;  2NXR A;  1CCT A;  1XQ0 A;  2X7T A;  2HOC A;  2WEO A;  3IBL A;  3DV7 A;  5DOG A;  2WD3 A;  3B1B A;  4YGN A;  3RZ7 A;  9CA2 A;  4Q6E A;  5DSM A;  5FDI A;  1YDA A;  1BIC A;  1G1D A;  3DA2 A;  3P44 A;  3CZV A;  1G53 A;  4JS6 A;  3S78 B;  4ZAO A;  2Q1B A;  4QSI A;  5IPZ A;  1YDB A;  1CNX A;  3CAJ A;  2QO8 A;  3M5S A;  3OIL A;  5FLT A;  4DZ9 A;  2POV A;  4QSB A;  5EKJ A;  3V2M A;  5E2M A;  4CAC A;  4HU1 A;  3U47 A;  3ZNC A;  4Z1E A;  2F14 A;  3D0N A;  3JXG A;  3M2X A;  4RN4 A;  2NMX A;  3RYX B;  5E2S A;  1CNH A;  4Q09 A;  5DSI A;  2OSM A;  1CNB A;  1HED A;  3V3F A;  4KP8 A;  2NN7 A;  4YGJ A;  5AML A;  1CAM A;  3RZ0 B;  1I9M A;  5AMD A;  4HT0 A;  4QJO A;  3P3H A;  5BRU A;  1LZV A;  3M96 A;  5E28 A;  3OKV A;  4XE1 A;  1UGC A;  4Q9Y A;  8CA2 A;  4RH2 A;  5FLQ A;  5EHV A;  3MZC A;  1J9W A;  1BN4 A;  4Q07 A;  4X5S A;  1G0F A;  1G0E A;  5JEP B;  5CAC A;  5JQ0 A;  1BN1 A;  1BNN A;  4E5Q A;  5EH8 A;  4JSA A;  5EHE A;  4L5V A;  4MDG A;  1CVF A;  3JXF A;  5DRS A;  3SBH A;  2Q38 A;  1MUA A;  3MYQ A;  3IBU A;  3OIK A;  4QJX A;  2WEJ A;  3DVD A;  4YVY A;  2FMZ A;  3P4V A;  4QSA A;  5FLS A;  3P58 A;  1KEQ A;  3W6I A;  2HKK A;  3DD8 A;  3RYY A;  1TG9 A;  3K2F A;  3GZ0 A;  3S74 B;  3KOI A;  4Z0Q A;  5E2N A;  2EU2 A;  3FE4 A;  3S73 B;  4QIY A;  1CVE A;  4RFC A;  2IT4 A;  4GL1 X;  1TEU X;  4Q7P A;  4PXX A;  5JG3 B;  2HFW A;  1LUG A;  4YGK A;  4K0T A;  4Q90 A;  3DBU A;  1HEA A;  3HKQ A;  4TWM A;  4E3D A;  1RZC A;  1FR4 A;  3T5Z A;  1JD0 A;  1H9N A;  5JES B;  1Z93 A;  4QJP A;  1LG6 A;  3CYU A;  2CA2 A;  7CA2 A;  4MDM A;  1RZD A;  3ZP9 A;  4Z1K A;  1MOO A;  3DC3 A;  4M2U A;  1DCB A;  2X7S A;  2NXT A;  3RYV B;  3MHC A;  4ILX A;  1RZB A;  1KWR A;  3MNK A;  4BF1 A;  1OQ5 A;  5G03 A;  4CNR A;  1ZFQ A;  4ITP A;  5FNJ A;  1TB0 X;  3P5A A;  3N4B A;  2FOQ A;  4DZ7 A;  3KWA A;  5G01 A;  3IAI A;  3MNA A;  1TTM A;  1BNQ A;  1UGE A;  5BNL A;  4RUY A;  3D9Z A;  1XEV A;  4FPT A;  4Q7S A;  4E4A A;  1HEB A;  3MDZ A;  1V9I C;  3MWO A;  5EH7 A;  4HEY A;  4RUX A;  4E3F A;  1THK A;  4YXU A;  1IF4 A;  3VBD A;  5CJF A;  4E9O X;  3MHL A;  3IEO A;  1HCA A;  3M98 A;  5DSJ A;  4CNV A;  2AX2 A;  4R5B A;  1AM6 A;  4MLT A;  5EOI A;  1HUH A;  4K0S A;  4Q8X A;  4Q0L A;  5SZ6 A;  2NNV A;  4XIX A;  1YO0 A;  1BZM A;  2POW A;  1CCU A;  4KUY A;  1CRA A;  1CVA A;  1FLJ A;  1RJ5 A;  5LMD A;  4QEF A;  4YGL A;  1FR7 A;  3M1K A;  1CNG A;  3R16 A;  4N0X B;  4Q7W A;  4N16 A;  3B4F A;  3HKT A;  3BL0 A;  1RAY A;  5DSQ A;  3S71 B;  2AW1 A;  5BYI A;  4QK1 A;  1BNU A;  1CRM A;  1KWQ A;  2EU3 A;  3RG3 A;  4PYY A;  3TMJ A;  5JEH B;  3NB5 A;  3PJJ A;  3M1Q A;  3CA2 A;  3U45 X;  4M2V A;  3V2J A;  5G0C A;  5DSL A;  3OKU A;  2HL4 A;  1YO2 A;  2NNS A;  1I9P A;  4YXI A;  3ML2 A;  3F4X A;  4XIW A;  1FSN A;  5FL5 A;  3ML5 A;  3MHO A;  4Q83 A;  3N0N A;  4TWL A;  4QY3 A;  5HPJ A;  2QOA A;  2FOV A;  1A42 A;  3DVC A;  3OY0 A;  2OSF A;  4LHI A;  2FOS A;  1I90 A;  5FNI A;  1IF5 A;  2NNG A;  5BRW A;  3S76 A;  3MHI A;  3D92 A;  1ZSC A;  2WEG A;  4ITO A;  1RZA A;  4KUV A;  4WL4 A;  3P3J A;  5CLU A;  4Z1J A;  3S75 B;  3M5T A;  1ZE8 A;  3NJ9 A;  1CNC A;  5E2R A;  1URT A;  1UGA A;  3IBI A;  1G46 A;  5JGT B;  4Q49 A;  5A25 A;  5EHW A;  1CAZ A;  3RZ1 B;  2FNM A;  5JQT A;  1RJ6 A;  1CAI A;  2QP6 A;  3M1J A;  3C7P A;  4QJW A;  4COQ A;  2GEH A;  4JSS A;  4WR7 A;  4K13 A;  3SAX A;  3V3I B;  4CNW A;  2FW4 A;  2VVB X;  3DD0 A;  5JG5 B;  3KKX A;  3LXE A;  1I91 A;  3M1W A;  1CNI A;  4FIK A;  3IBN A;  1BNW A;  5FL4 A;  1CA3 A;  4G7A A;  4KNN A;  3RYZ A;  3DCC A;  4ZX0 A;  4C3T A;  3M2N A;  3R17 B;  4PZH A;  3S8X A;  4HT2 A;  4L5W A;  3T83 A;  4L5U A;  2CAB A;  4RIV A;  1CVC A;  3EFI A;  3M67 A;  4YX4 A;  4QK2 A;  1BCD A;  3L14 A;  3SAP A;  1CAK A;  3PYK A;  3EFT A;  4QJ0 A;  4MLX A;  2NWO A;  4CQ0 A;  4ZX1 A;  1Z97 A;  1I9N A;  1BN3 A;  3F7U A;  4WW6 A;  1I9O A;  5EKM A;  1DMX A;  2FNN A;  5CA2 A;  2EZ7 A;  4BF6 A;  1CAY A;  2FOU A;  5DSK A;  3MMF A;  4MO8 A;  4ZWI A;  2CBC A;  2H4N A;  4Q87 A;  2CBD A;  4YGF A;  1HCB A;  4Q8Z A;  1G48 A;  2NWZ A;  1FQN A;  1JV0 A;  5FNL A;  5DOH A;  6CA2 A;  2ILI A;  4PQ7 A;  4Q06 A;  4IWZ A;  1IF8 A;  5FLP A;  3DVB A;  1DCA A;  3V3G B;  1TG3 A;  1V9E A;  4KP5 A;  4YXO A;  3F7B A;  3KNE A;  4LU3 A;  2CBB A;  1G45 A;  3K7K A;  1YDD A;  2CBE A;  3MNJ A;  1KOP A;  1OKM A;  1Y7W A;  1ZSB A;  3KLD B;  4PYX A;  3M5E A;  1ZGF A;  2WD2 A;  1H4N A;  1IF6 A;  3D8W A;  3OYS A;  5SZ2 A;  5JGS B;  3TVO X;  1ZFK A;  4QIZ A;  4XFW A;  5E2K A;  5BRV A;  4RIU A;  1OKL A;  2CBA A;  4M2R A;  1CAH A;  4MTY A;  1HUG A;  1OKN A;  1ZNC A;  5AMG A;  3S77 B;  5DSO A;  1XPZ A;  2NXS A;  4FL7 A;  4MDL A;  1BNM A;  3V3H B;  3TVN X;  1CZM A;  3KON A;  5EH5 A;  2ZNC A;  2NNO A;  1CNY A;  4HBA A;  1IF7 A;  1LG5 A; 
#chains in the Genus database with same CATH topology
 1UGD A;  4YHA A;  3V5G A;  3FW3 A;  1T9N A;  1YO1 A;  3NI5 A;  4JSZ A;  1ZH9 A;  4CA2 A;  3RJ7 A;  1AVN A;  4WUP A;  1ZSA A;  4RFD A;  2VVA X;  1LGD A;  2FOY A;  4WUQ A;  3S9T A;  4R59 A;  5FNG A;  1KOQ A;  5E5R A;  3IGP A;  2POU A;  4UOV A;  1CNJ A;  3UYQ A;  3HS4 A;  1CA2 A;  12CA A;  4M2W A;  4QTL A;  5SZ3 A;  5A6H A;  3T85 A;  1UGB A;  4KAP A;  3K34 A;  5DSN A;  1CAO A;  1CAJ A;  3OYQ A;  1I9Q A;  3RZ5 A;  1DMY A;  3PO6 A;  5SZ1 A;  4BCW A;  5FNM A;  4QSJ A;  1G54 A;  3KS3 A;  1CCS A;  3KIG A;  1CIN A;  2FMG A;  4Y0J A;  3QYK A;  3HKN A;  5FLR A;  4K0Z A;  2FNK A;  3KOK A;  3M14 A;  4KV0 A;  1TBT X;  4R5A A;  3RLD A;  5SZ5 A;  5L3O A;  1CNW A;  4Q78 A;  2HNC A;  4RUZ A;  4Q6D A;  4HEZ A;  2NN1 A;  1I8Z A;  2H15 A;  4LP6 A;  5DVX A;  5EZT X;  1G3Z A;  1EOU A;  3MHM A;  4QJM A;  2NWY A;  4E3G A;  3U3A X;  1CIM A;  4ZWX A;  5SZ4 A;  1F2W A;  2X7U A;  3MNU A;  3HLJ A;  5FNK A;  1CIL A;  3RZ8 A;  1HVA A;  1XEG A;  2W2J A;  3T84 A;  4Q7V A;  1FSR A;  4HEW A;  4E49 A;  4JSW A;  4FVO A;  3RGE A;  3S97 A;  3SBI A;  5L6K A;  1CVH A;  1CVB A;  1AZM A;  1JCZ A;  3BL1 A;  1CAL A;  3DC9 A;  5JDV B;  1UGG A;  3Q31 A;  2O4Z A;  1G4O A;  1UGF A;  4KNI A;  3P5L A;  3W6H A;  1ZGE A;  1FSQ A;  3T82 A;  3V7X A;  4Z1N A;  2NWP A;  1TEQ X;  5FL6 A;  1RZE A;  5DSR A;  3BET A;  3N2P A;  3MNH A;  2ABE A;  5G0B A;  4FRC A;  4XZ5 A;  5FDC A;  1G6V A;  3N3J A;  5JEG B;  3HKU A;  1CNK A;  1FQM A;  3M2Y A;  3MNI A;  4Q08 A;  4G0C A;  2Q1Q A;  3DCS A;  1G4J A;  2WEH A;  4ZWY A;  1TH9 A;  5FLO A;  4Q81 A;  4KNJ A;  5E5U A;  5SZ0 A;  1YDC A;  4K1Q A;  3HFP A;  4ZWZ A;  4ETQ C;  3FFP X;  3M40 A;  3DAZ A;  1IF9 A;  3F8E A;  4HF3 A;  1I9L A;  1BNT A;  5EKH A;  1BV3 A;  3M3X A;  4FVN A;  1CVD A;  4YYT A;  1CAN A;  4FU5 A;  5FNH A;  5J8Z A;  1BNV A;  1G52 A;  5DSP A;  3V3J A;  4E3H A;  3D93 A;  3DCW A;  3M04 A;  4KNM A;  5SZ7 A;  3U7C A;  3T5U A;  4QK3 A;  3OIM A;  3RG4 A;  2GD8 A;  4CNX A;  2HD6 A;  3JXH C;  3M2Z A;  1Z9Y A;  4Q8Y A;  1TE3 X;  1RAZ A;  3P55 A;  4Q99 A;  4KUW A;  4YWP A;  1HEC A;  5EIJ A;  1FQL A;  3UYN A;  4WW8 A;  3S72 B;  4IDR X;  5C8I A;  1H9Q A;  3RYJ B;  1FQR A;  2NXR A;  1CCT A;  1XQ0 A;  2X7T A;  2HOC A;  2WEO A;  3IBL A;  3DV7 A;  5DOG A;  2WD3 A;  3B1B A;  4YGN A;  3RZ7 A;  9CA2 A;  4Q6E A;  5DSM A;  5FDI A;  1YDA A;  1BIC A;  1G1D A;  3DA2 A;  3P44 A;  3CZV A;  1G53 A;  4JS6 A;  3S78 B;  4ZAO A;  2Q1B A;  4QSI A;  5IPZ A;  1YDB A;  1CNX A;  3CAJ A;  2QO8 A;  3M5S A;  3OIL A;  5FLT A;  4DZ9 A;  2POV A;  4QSB A;  5EKJ A;  3V2M A;  5E2M A;  4CAC A;  4HU1 A;  3U47 A;  3ZNC A;  4Z1E A;  2F14 A;  3D0N A;  3JXG A;  3M2X A;  4RN4 A;  2NMX A;  3RYX B;  5E2S A;  1CNH A;  4Q09 A;  5DSI A;  2OSM A;  1CNB A;  1HED A;  3V3F A;  4KP8 A;  2NN7 A;  4YGJ A;  5AML A;  1CAM A;  3RZ0 B;  1I9M A;  5AMD A;  4HT0 A;  4QJO A;  3P3H A;  5BRU A;  1LZV A;  3M96 A;  5E28 A;  3OKV A;  4XE1 A;  1UGC A;  4Q9Y A;  8CA2 A;  4RH2 A;  5FLQ A;  5EHV A;  3MZC A;  1J9W A;  1BN4 A;  4Q07 A;  4X5S A;  1G0F A;  1G0E A;  5JEP B;  5CAC A;  5JQ0 A;  1BN1 A;  1BNN A;  4E5Q A;  5EH8 A;  4JSA A;  5EHE A;  4L5V A;  4MDG A;  1CVF A;  3JXF A;  5DRS A;  3SBH A;  2Q38 A;  1MUA A;  3MYQ A;  3IBU A;  3OIK A;  4QJX A;  2WEJ A;  3DVD A;  4YVY A;  2FMZ A;  3P4V A;  4QSA A;  5FLS A;  3P58 A;  1KEQ A;  3W6I A;  2HKK A;  3DD8 A;  3RYY A;  1TG9 A;  3K2F A;  3GZ0 A;  3S74 B;  3KOI A;  4Z0Q A;  5E2N A;  2EU2 A;  3FE4 A;  3S73 B;  4QIY A;  1CVE A;  4RFC A;  2IT4 A;  4GL1 X;  1TEU X;  4Q7P A;  4PXX A;  5JG3 B;  2HFW A;  1LUG A;  4YGK A;  4K0T A;  4Q90 A;  3DBU A;  1HEA A;  3HKQ A;  4TWM A;  4E3D A;  1RZC A;  1FR4 A;  3T5Z A;  1JD0 A;  1H9N A;  5JES B;  1Z93 A;  4QJP A;  1LG6 A;  3CYU A;  2CA2 A;  7CA2 A;  4MDM A;  1RZD A;  3ZP9 A;  4Z1K A;  1MOO A;  3DC3 A;  4M2U A;  1DCB A;  2X7S A;  2NXT A;  3RYV B;  3MHC A;  4ILX A;  1RZB A;  1KWR A;  3MNK A;  4BF1 A;  1OQ5 A;  5G03 A;  4CNR A;  1ZFQ A;  4ITP A;  5FNJ A;  1TB0 X;  3P5A A;  3N4B A;  2FOQ A;  4DZ7 A;  3KWA A;  5G01 A;  3IAI A;  3MNA A;  1TTM A;  1BNQ A;  1UGE A;  5BNL A;  4RUY A;  3D9Z A;  1XEV A;  4FPT A;  4Q7S A;  4E4A A;  1HEB A;  3MDZ A;  1V9I C;  3MWO A;  5EH7 A;  4HEY A;  4RUX A;  4E3F A;  1THK A;  4YXU A;  1IF4 A;  3VBD A;  5CJF A;  4E9O X;  3MHL A;  3IEO A;  1HCA A;  3M98 A;  5DSJ A;  4CNV A;  2AX2 A;  4R5B A;  1AM6 A;  4MLT A;  5EOI A;  1HUH A;  4K0S A;  4Q8X A;  4Q0L A;  5SZ6 A;  2NNV A;  4XIX A;  1YO0 A;  1BZM A;  2POW A;  1CCU A;  4KUY A;  1CRA A;  1CVA A;  1FLJ A;  1RJ5 A;  5LMD A;  4QEF A;  4YGL A;  1FR7 A;  3M1K A;  1CNG A;  3R16 A;  4N0X B;  4Q7W A;  4N16 A;  3B4F A;  3HKT A;  3BL0 A;  1RAY A;  5DSQ A;  3S71 B;  2AW1 A;  5BYI A;  4QK1 A;  1BNU A;  1CRM A;  1KWQ A;  2EU3 A;  3RG3 A;  4PYY A;  3TMJ A;  5JEH B;  3NB5 A;  3PJJ A;  3M1Q A;  3CA2 A;  3U45 X;  4M2V A;  3V2J A;  5G0C A;  5DSL A;  3OKU A;  2HL4 A;  1YO2 A;  2NNS A;  1I9P A;  4YXI A;  3ML2 A;  3F4X A;  4XIW A;  1FSN A;  5FL5 A;  3ML5 A;  3MHO A;  4Q83 A;  3N0N A;  4TWL A;  4QY3 A;  5HPJ A;  2QOA A;  2FOV A;  1A42 A;  3DVC A;  3OY0 A;  2OSF A;  4LHI A;  2FOS A;  1I90 A;  5FNI A;  1IF5 A;  2NNG A;  5BRW A;  3S76 A;  3MHI A;  3D92 A;  1ZSC A;  2WEG A;  4ITO A;  1RZA A;  4KUV A;  4WL4 A;  3P3J A;  5CLU A;  4Z1J A;  3S75 B;  3M5T A;  1ZE8 A;  3NJ9 A;  1CNC A;  5E2R A;  1URT A;  1UGA A;  3IBI A;  1G46 A;  5JGT B;  4Q49 A;  5A25 A;  5EHW A;  1CAZ A;  3RZ1 B;  2FNM A;  5JQT A;  1RJ6 A;  1CAI A;  2QP6 A;  3M1J A;  3C7P A;  4QJW A;  4COQ A;  2GEH A;  4JSS A;  4WR7 A;  4K13 A;  3SAX A;  3V3I B;  4CNW A;  2FW4 A;  2VVB X;  3DD0 A;  5JG5 B;  3KKX A;  3LXE A;  1I91 A;  3M1W A;  1CNI A;  4FIK A;  3IBN A;  1BNW A;  5FL4 A;  1CA3 A;  4G7A A;  4KNN A;  3RYZ A;  3DCC A;  4ZX0 A;  4C3T A;  3M2N A;  3R17 B;  4PZH A;  3S8X A;  4HT2 A;  4L5W A;  3T83 A;  4L5U A;  2CAB A;  4RIV A;  1CVC A;  3EFI A;  3M67 A;  4YX4 A;  4QK2 A;  1BCD A;  3L14 A;  3SAP A;  1CAK A;  3PYK A;  3EFT A;  4QJ0 A;  4MLX A;  2NWO A;  4CQ0 A;  4ZX1 A;  1Z97 A;  1I9N A;  1BN3 A;  3F7U A;  4WW6 A;  1I9O A;  5EKM A;  1DMX A;  2FNN A;  5CA2 A;  2EZ7 A;  4BF6 A;  1CAY A;  2FOU A;  5DSK A;  3MMF A;  4MO8 A;  4ZWI A;  2CBC A;  2H4N A;  4Q87 A;  2CBD A;  4YGF A;  1HCB A;  4Q8Z A;  1G48 A;  2NWZ A;  1FQN A;  1JV0 A;  5FNL A;  5DOH A;  6CA2 A;  2ILI A;  4PQ7 A;  4Q06 A;  4IWZ A;  1IF8 A;  5FLP A;  3DVB A;  1DCA A;  3V3G B;  1TG3 A;  1V9E A;  4KP5 A;  4YXO A;  3F7B A;  3KNE A;  4LU3 A;  2CBB A;  1G45 A;  3K7K A;  1YDD A;  2CBE A;  3MNJ A;  1KOP A;  1OKM A;  1Y7W A;  1ZSB A;  3KLD B;  4PYX A;  3M5E A;  1ZGF A;  2WD2 A;  1H4N A;  1IF6 A;  3D8W A;  3OYS A;  5SZ2 A;  5JGS B;  3TVO X;  1ZFK A;  4QIZ A;  4XFW A;  5E2K A;  5BRV A;  4RIU A;  1OKL A;  2CBA A;  4M2R A;  1CAH A;  4MTY A;  1HUG A;  1OKN A;  1ZNC A;  5AMG A;  3S77 B;  5DSO A;  1XPZ A;  2NXS A;  4FL7 A;  4MDL A;  1BNM A;  3V3H B;  3TVN X;  1CZM A;  3KON A;  5EH5 A;  2ZNC A;  2NNO A;  1CNY A;  4HBA A;  1IF7 A;  1LG5 A; 
#chains in the Genus database with same CATH homology
 1UGD A;  4YHA A;  3V5G A;  3FW3 A;  1T9N A;  1YO1 A;  3NI5 A;  4JSZ A;  1ZH9 A;  4CA2 A;  3RJ7 A;  1AVN A;  4WUP A;  1ZSA A;  4RFD A;  2VVA X;  1LGD A;  2FOY A;  4WUQ A;  3S9T A;  4R59 A;  5FNG A;  1KOQ A;  5E5R A;  3IGP A;  2POU A;  4UOV A;  1CNJ A;  3UYQ A;  3HS4 A;  1CA2 A;  12CA A;  4M2W A;  4QTL A;  5SZ3 A;  5A6H A;  3T85 A;  1UGB A;  4KAP A;  3K34 A;  5DSN A;  1CAO A;  1CAJ A;  3OYQ A;  1I9Q A;  3RZ5 A;  1DMY A;  3PO6 A;  5SZ1 A;  4BCW A;  5FNM A;  4QSJ A;  1G54 A;  3KS3 A;  1CCS A;  3KIG A;  1CIN A;  2FMG A;  4Y0J A;  3QYK A;  3HKN A;  5FLR A;  4K0Z A;  2FNK A;  3KOK A;  3M14 A;  4KV0 A;  1TBT X;  4R5A A;  3RLD A;  5SZ5 A;  5L3O A;  1CNW A;  4Q78 A;  2HNC A;  4RUZ A;  4Q6D A;  4HEZ A;  2NN1 A;  1I8Z A;  2H15 A;  4LP6 A;  5DVX A;  5EZT X;  1G3Z A;  1EOU A;  3MHM A;  4QJM A;  2NWY A;  4E3G A;  3U3A X;  1CIM A;  4ZWX A;  5SZ4 A;  1F2W A;  2X7U A;  3MNU A;  3HLJ A;  5FNK A;  1CIL A;  3RZ8 A;  1HVA A;  1XEG A;  2W2J A;  3T84 A;  4Q7V A;  1FSR A;  4HEW A;  4E49 A;  4JSW A;  4FVO A;  3RGE A;  3S97 A;  3SBI A;  5L6K A;  1CVH A;  1CVB A;  1AZM A;  1JCZ A;  3BL1 A;  1CAL A;  3DC9 A;  5JDV B;  1UGG A;  3Q31 A;  2O4Z A;  1G4O A;  1UGF A;  4KNI A;  3P5L A;  3W6H A;  1ZGE A;  1FSQ A;  3T82 A;  3V7X A;  4Z1N A;  2NWP A;  1TEQ X;  5FL6 A;  1RZE A;  5DSR A;  3BET A;  3N2P A;  3MNH A;  2ABE A;  5G0B A;  4FRC A;  4XZ5 A;  5FDC A;  1G6V A;  3N3J A;  5JEG B;  3HKU A;  1CNK A;  1FQM A;  3M2Y A;  3MNI A;  4Q08 A;  4G0C A;  2Q1Q A;  3DCS A;  1G4J A;  2WEH A;  4ZWY A;  1TH9 A;  5FLO A;  4Q81 A;  4KNJ A;  5E5U A;  5SZ0 A;  1YDC A;  4K1Q A;  3HFP A;  4ZWZ A;  4ETQ C;  3FFP X;  3M40 A;  3DAZ A;  1IF9 A;  3F8E A;  4HF3 A;  1I9L A;  1BNT A;  5EKH A;  1BV3 A;  3M3X A;  4FVN A;  1CVD A;  4YYT A;  1CAN A;  4FU5 A;  5FNH A;  5J8Z A;  1BNV A;  1G52 A;  5DSP A;  3V3J A;  4E3H A;  3D93 A;  3DCW A;  3M04 A;  4KNM A;  5SZ7 A;  3U7C A;  3T5U A;  4QK3 A;  3OIM A;  3RG4 A;  2GD8 A;  4CNX A;  2HD6 A;  3JXH C;  3M2Z A;  1Z9Y A;  4Q8Y A;  1TE3 X;  1RAZ A;  3P55 A;  4Q99 A;  4KUW A;  4YWP A;  1HEC A;  5EIJ A;  1FQL A;  3UYN A;  4WW8 A;  3S72 B;  4IDR X;  5C8I A;  1H9Q A;  3RYJ B;  1FQR A;  2NXR A;  1CCT A;  1XQ0 A;  2X7T A;  2HOC A;  2WEO A;  3IBL A;  3DV7 A;  5DOG A;  2WD3 A;  3B1B A;  4YGN A;  3RZ7 A;  9CA2 A;  4Q6E A;  5DSM A;  5FDI A;  1YDA A;  1BIC A;  1G1D A;  3DA2 A;  3P44 A;  3CZV A;  1G53 A;  4JS6 A;  3S78 B;  4ZAO A;  2Q1B A;  4QSI A;  5IPZ A;  1YDB A;  1CNX A;  3CAJ A;  2QO8 A;  3M5S A;  3OIL A;  5FLT A;  4DZ9 A;  2POV A;  4QSB A;  5EKJ A;  3V2M A;  5E2M A;  4CAC A;  4HU1 A;  3U47 A;  3ZNC A;  4Z1E A;  2F14 A;  3D0N A;  3JXG A;  3M2X A;  4RN4 A;  2NMX A;  3RYX B;  5E2S A;  1CNH A;  4Q09 A;  5DSI A;  2OSM A;  1CNB A;  1HED A;  3V3F A;  4KP8 A;  2NN7 A;  4YGJ A;  5AML A;  1CAM A;  3RZ0 B;  1I9M A;  5AMD A;  4HT0 A;  4QJO A;  3P3H A;  5BRU A;  1LZV A;  3M96 A;  5E28 A;  3OKV A;  4XE1 A;  1UGC A;  4Q9Y A;  8CA2 A;  4RH2 A;  5FLQ A;  5EHV A;  3MZC A;  1J9W A;  1BN4 A;  4Q07 A;  4X5S A;  1G0F A;  1G0E A;  5JEP B;  5CAC A;  5JQ0 A;  1BN1 A;  1BNN A;  4E5Q A;  5EH8 A;  4JSA A;  5EHE A;  4L5V A;  4MDG A;  1CVF A;  3JXF A;  5DRS A;  3SBH A;  2Q38 A;  1MUA A;  3MYQ A;  3IBU A;  3OIK A;  4QJX A;  2WEJ A;  3DVD A;  4YVY A;  2FMZ A;  3P4V A;  4QSA A;  5FLS A;  3P58 A;  1KEQ A;  3W6I A;  2HKK A;  3DD8 A;  3RYY A;  1TG9 A;  3K2F A;  3GZ0 A;  3S74 B;  3KOI A;  4Z0Q A;  5E2N A;  2EU2 A;  3FE4 A;  3S73 B;  4QIY A;  1CVE A;  4RFC A;  2IT4 A;  4GL1 X;  1TEU X;  4Q7P A;  4PXX A;  5JG3 B;  2HFW A;  1LUG A;  4YGK A;  4K0T A;  4Q90 A;  3DBU A;  1HEA A;  3HKQ A;  4TWM A;  4E3D A;  1RZC A;  1FR4 A;  3T5Z A;  1JD0 A;  1H9N A;  5JES B;  1Z93 A;  4QJP A;  1LG6 A;  3CYU A;  2CA2 A;  7CA2 A;  4MDM A;  1RZD A;  3ZP9 A;  4Z1K A;  1MOO A;  3DC3 A;  4M2U A;  1DCB A;  2X7S A;  2NXT A;  3RYV B;  3MHC A;  4ILX A;  1RZB A;  1KWR A;  3MNK A;  4BF1 A;  1OQ5 A;  5G03 A;  4CNR A;  1ZFQ A;  4ITP A;  5FNJ A;  1TB0 X;  3P5A A;  3N4B A;  2FOQ A;  4DZ7 A;  3KWA A;  5G01 A;  3IAI A;  3MNA A;  1TTM A;  1BNQ A;  1UGE A;  5BNL A;  4RUY A;  3D9Z A;  1XEV A;  4FPT A;  4Q7S A;  4E4A A;  1HEB A;  3MDZ A;  1V9I C;  3MWO A;  5EH7 A;  4HEY A;  4RUX A;  4E3F A;  1THK A;  4YXU A;  1IF4 A;  3VBD A;  5CJF A;  4E9O X;  3MHL A;  3IEO A;  1HCA A;  3M98 A;  5DSJ A;  4CNV A;  2AX2 A;  4R5B A;  1AM6 A;  4MLT A;  5EOI A;  1HUH A;  4K0S A;  4Q8X A;  4Q0L A;  5SZ6 A;  2NNV A;  4XIX A;  1YO0 A;  1BZM A;  2POW A;  1CCU A;  4KUY A;  1CRA A;  1CVA A;  1FLJ A;  1RJ5 A;  5LMD A;  4QEF A;  4YGL A;  1FR7 A;  3M1K A;  1CNG A;  3R16 A;  4N0X B;  4Q7W A;  4N16 A;  3B4F A;  3HKT A;  3BL0 A;  1RAY A;  5DSQ A;  3S71 B;  2AW1 A;  5BYI A;  4QK1 A;  1BNU A;  1CRM A;  1KWQ A;  2EU3 A;  3RG3 A;  4PYY A;  3TMJ A;  5JEH B;  3NB5 A;  3PJJ A;  3M1Q A;  3CA2 A;  3U45 X;  4M2V A;  3V2J A;  5G0C A;  5DSL A;  3OKU A;  2HL4 A;  1YO2 A;  2NNS A;  1I9P A;  4YXI A;  3ML2 A;  3F4X A;  4XIW A;  1FSN A;  5FL5 A;  3ML5 A;  3MHO A;  4Q83 A;  3N0N A;  4TWL A;  4QY3 A;  5HPJ A;  2QOA A;  2FOV A;  1A42 A;  3DVC A;  3OY0 A;  2OSF A;  4LHI A;  2FOS A;  1I90 A;  5FNI A;  1IF5 A;  2NNG A;  5BRW A;  3S76 A;  3MHI A;  3D92 A;  1ZSC A;  2WEG A;  4ITO A;  1RZA A;  4KUV A;  4WL4 A;  3P3J A;  5CLU A;  4Z1J A;  3S75 B;  3M5T A;  1ZE8 A;  3NJ9 A;  1CNC A;  5E2R A;  1URT A;  1UGA A;  3IBI A;  1G46 A;  5JGT B;  4Q49 A;  5A25 A;  5EHW A;  1CAZ A;  3RZ1 B;  2FNM A;  5JQT A;  1RJ6 A;  1CAI A;  2QP6 A;  3M1J A;  3C7P A;  4QJW A;  4COQ A;  2GEH A;  4JSS A;  4WR7 A;  4K13 A;  3SAX A;  3V3I B;  4CNW A;  2FW4 A;  2VVB X;  3DD0 A;  5JG5 B;  3KKX A;  3LXE A;  1I91 A;  3M1W A;  1CNI A;  4FIK A;  3IBN A;  1BNW A;  5FL4 A;  1CA3 A;  4G7A A;  4KNN A;  3RYZ A;  3DCC A;  4ZX0 A;  4C3T A;  3M2N A;  3R17 B;  4PZH A;  3S8X A;  4HT2 A;  4L5W A;  3T83 A;  4L5U A;  2CAB A;  4RIV A;  1CVC A;  3EFI A;  3M67 A;  4YX4 A;  4QK2 A;  1BCD A;  3L14 A;  3SAP A;  1CAK A;  3PYK A;  3EFT A;  4QJ0 A;  4MLX A;  2NWO A;  4CQ0 A;  4ZX1 A;  1Z97 A;  1I9N A;  1BN3 A;  3F7U A;  4WW6 A;  1I9O A;  5EKM A;  1DMX A;  2FNN A;  5CA2 A;  2EZ7 A;  4BF6 A;  1CAY A;  2FOU A;  5DSK A;  3MMF A;  4MO8 A;  4ZWI A;  2CBC A;  2H4N A;  4Q87 A;  2CBD A;  4YGF A;  1HCB A;  4Q8Z A;  1G48 A;  2NWZ A;  1FQN A;  1JV0 A;  5FNL A;  5DOH A;  6CA2 A;  2ILI A;  4PQ7 A;  4Q06 A;  4IWZ A;  1IF8 A;  5FLP A;  3DVB A;  1DCA A;  3V3G B;  1TG3 A;  1V9E A;  4KP5 A;  4YXO A;  3F7B A;  3KNE A;  4LU3 A;  2CBB A;  1G45 A;  3K7K A;  1YDD A;  2CBE A;  3MNJ A;  1KOP A;  1OKM A;  1Y7W A;  1ZSB A;  3KLD B;  4PYX A;  3M5E A;  1ZGF A;  2WD2 A;  1H4N A;  1IF6 A;  3D8W A;  3OYS A;  5SZ2 A;  5JGS B;  3TVO X;  1ZFK A;  4QIZ A;  4XFW A;  5E2K A;  5BRV A;  4RIU A;  1OKL A;  2CBA A;  4M2R A;  1CAH A;  4MTY A;  1HUG A;  1OKN A;  1ZNC A;  5AMG A;  3S77 B;  5DSO A;  1XPZ A;  2NXS A;  4FL7 A;  4MDL A;  1BNM A;  3V3H B;  3TVN X;  1CZM A;  3KON A;  5EH5 A;  2ZNC A;  2NNO A;  1CNY A;  4HBA A;  1IF7 A;  1LG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...