1CZMA

Drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
260
structure length
260
Chain Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Drug-protein interactions. Refined structures of three sulfonamide drug complexes of human carbonic anhydrase I enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE I
total genus 74
structure length 260
sequence length 260
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1993-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1czmA00
1OKLA 1LGDA 5FNKA 2OSMA 4Q81A 3IAIA 4FVOA 4Q83A 1LUGA 4JSSA 1EOUA 2GD8A 5DSOA 1OQ5A 3RYJB 1FR7A 4MLTA 1KEQA 4WW8A 3KWAA 2WEHA 3RZ7A 4Q09A 2HNCA 4MDMA 2HL4A 3KS3A 3K7KA 5DSQA 2NNSA 3F4XA 3QYKA 5FDIA 2ZNCA 2HKKA 4MTYA 3BETA 3M3XA 1G1DA 3U3AX 4YGFA 4MDGA 2NNVA 5G01A 5DSIA 3M1KA 1G45A 3M2XA 3T83A 4PQ7A 5BRWA 3DAZA 3KLDB 4RUXA 4FPTA 1A42A 4K13A 4TWLA 3M5EA 1CA3A 5J8ZA 4M2UA 4RUYA 1JD0A 4E3FA 4QJ0A 2X7UA 3JXGA 1DMYA 4Y0JA 2ILIA 3DBUA 3K2FA 1CAOA 3VBDA 2NXSA 3IBLA 5DSRA 5AMLA 5LMDA 1MOOA 1CAHA 3M67A 3RZ0B 3W6HA 4FIKA 3CA2A 4M2RA 1IF9A 4ETQC 2FNKA 4QJPA 3P5LA 1G54A 2NWYA 3MYQA 1FSQA 4Q6DA 3P58A 5G0BA 1CVHA 1CZMA 4Q7VA 3V5GA 2NXTA 1CILA 5JEHB 3U47A 3ZP9A 1FLJA 1BN4A 4FL7A 3UYQA 4QIYA 4QIZA 3KNEA 2QOAA 3V2MA 1BZMA 1TBTX 1URTA 3T82A 1CNCA 3P44A 3ML5A 3D0NA 5EHVA 4KNMA 4E3HA 3CZVA 4CNXA 5CACA 4Q08A 3MWOA 1V9EA 4X5SA 3U7CA 4BCWA 3DD0A 5FNIA 2EU2A 3V3IB 2Q38A 5DSPA 3FFPX 3T84A 3N2PA 4Q49A 4QJWA 3MNJA 5SZ3A 1FQLA 1T9NA 3RYXB 3V7XA 5EH7A 1LG5A 1RAYA 4HEYA 1G46A 1G6VA 1RZAA 1V9IC 4HEZA 2HOCA 4DZ7A 5JDVB 1G0FA 4CA2A 1BNTA 2CBAA 2AW1A 4WW6A 4QEFA 3RLDA 4PYYA 12CAA 3S77B 1BNMA 3TVOX 4ZWZA 1BNVA 5FNGA 4RN4A 5AMDA 4DZ9A 2CBDA 2WEGA 4MDLA 3CYUA 5FLPA 2NXRA 4K0SA 5EHWA 5EOIA 1CA2A 2CBEA 4E3GA 4Q8YA 4YXOA 1THKA 4K0ZA 1H9NA 3V2JA 3SBHA 2AX2A 4ZAOA 4KAPA 5EH8A 5FLOA 5SZ7A 2WD2A 2FW4A 1G4JA 1CVCA 5SZ2A 3M1JA 4KP8A 2O4ZA 4ZWIA 4KP5A 5FNHA 4QJOA 3D9ZA 4G0CA 4Q8ZA 2QP6A 5JG3B 3MHOA 5DRSA 1XQ0A 4XFWA 1ZFKA 8CA2A 3S76A 4HT2A 5DSJA 2NMXA 1CNWA 3N3JA 3DVCA 4YX4A 1CAMA 1CAIA 4MO8A 1IF4A 3HKNA 4RFCA 4E3DA 1CINA 4RFDA 1Z93A 3P3JA 3RG4A 3S72B 4FRCA 3M2NA 2FOSA 1TG3A 3V3GB 3P3HA 2EU3A 4L5VA 1IF5A 1CNBA 3DC9A 3IBNA 1KWQA 3TMJA 3ZNCA 3OY0A 4QJXA 1CIMA 1CCUA 4JS6A 4CACA 3T5ZA 4PZHA 4RUZA 1CALA 2X7SA 3OIMA 3S75B 2POUA 2X7TA 5E5UA 4ZX1A 5CA2A 1ZSAA 2FOQA 4ITOA 5HPJA 7CA2A 3DC3A 3PJJA 4QTLA 3HKQA 3M2ZA 3DD8A 3N0NA 3OYQA 3FE4A 3IBUA 1BV3A 1BCDA 5E5RA 4FU5A 5SZ5A 3OKUA 5JEGB 5BRVA 5BYIA 3OYSA 1YDCA 1RJ6A 5FL4A 4Q87A 4QJMA 5FL5A 1UGEA 4K0TA 3S73B 1CRMA 4Q99A 3U45X 5JGSB 1TEQX 1G52A 1LZVA 1ZSCA 2GEHA 4YVYA 4Q0LA 4LU3A 3S8XA 5CLUA 4CQ0A 3KOIA 1BNNA 5JEPB 5JQ0A 1TE3X 5FNLA 4E5QA 1J9WA 5L6KA 3NB5A 4M2VA 3MZCA 3K34A 1XEGA 3P4VA 5DOHA 3V3HB 1ZNCA 4Q6EA 4IWZA 1BNWA 1RJ5A 2NWZA 4LHIA 5EIJA 1CNKA 4PXXA 2F14A 1RZBA 1UGCA 1OKNA 2FNMA 4Q7PA 1UGFA 4QSAA 4RIUA 3RZ5A 1RZEA 4YYTA 2FOUA 3NI5A 3OIKA 4HT0A 2FOYA 1YDAA 1CAJA 3JXFA 1HVAA 2CBBA 4MLXA 5BRUA 3RZ1B 1Z97A 3MMFA 3EFTA 4WUQA 4HBAA 4KNNA 3D93A 1CVFA 1ZSBA 5EHEA 1CVDA 3F7UA 3HLJA 4KV0A 1AM6A 5SZ4A 1KOQA 4WR7A 4E9OX 3P55A 1TG9A 1I8ZA 4Z1JA 3S97A 3S9TA 2CBCA 4KUYA 1IF8A 5E2SA 4C3TA 1I90A 5SZ6A 3MNKA 3F7BA 3MHIA 3M98A 3ML2A 2NN7A 3OILA 4R5AA 4Q90A 9CA2A 3M04A 4JSWA 2VVAX 1I91A 1CNIA 3M14A 1FSNA 2HD6A 1TTMA 1CAKA 1ZGEA 3HFPA 4JSAA 4XIXA 5JG5B 4Q06A 2FNNA 3M1QA 2W2JA 2Q1QA 2WD3A 3SAPA 3BL0A 3M1WA 3RYYA 4R59A 5EH5A 3T85A 3F8EA 5JQTA 1CNGA 2WEOA 3NJ9A 1H9QA 4Q7WA 4QSJA 3S71B 3P5AA 2NNOA 4FVNA 1CVBA 4QSIA 1KWRA 5DSLA 1YO0A 2H15A 3KIGA 4QK2A 1TEUX 5G0CA 1ZFQA 3M96A 1HEDA 4K1QA 3V3JA 6CA2A 1CNJA 3M5SA 4HU1A 1UGAA 5CJFA 1TH9A 4BF6A 1CRAA 1DCBA 4N16A 1I9OA 1CVAA 3OKVA 3MNUA 1FR4A 1YDDA 3R17B 5FNJA 4HEWA 1UGGA 5EKHA 3B4FA 1RZDA 2VVBX 3PO6A 3MHCA 5A25A 1I9PA 5EKMA 3C7PA 2POVA 4ITPA 1I9NA 3M2YA 2CA2A 3SBIA 1ZE8A 1IF7A 3M40A 1H4NA 3FW3A 2QO8A 4YXIA 4UOVA 1CANA 1RAZA 1HCBA 3Q31A 5DSMA 1ZGFA 5E28A 1CCTA 1HUHA 4XZ5A 3S78B 1BN3A 4PYXA 3V3FA 1CNXA 4Q07A 4R5BA 3M5TA 4CNVA 4M2WA 3DCSA 2POWA 1UGDA 3MDZA 5FDCA 1Y7WA 5FLRA 2FMGA 4CNRA 3D92A 3RZ8A 3KONA 1CAYA 1G3ZA 1CNYA 3BL1A 4ZX0A 3CAJA 5E2NA 4YHAA 3DA2A 2HFWA 2H4NA 5FLTA 4QK1A 1CAZA 4QY3A 3PYKA 1HEBA 4QSBA 4ILXA 3RYVB 4ZWYA 1BICA 3HKUA 3B1BA 5E2MA 1G53A 4RH2A 1OKMA 3RYZA 3IBIA 1FQRA 4BF1A 1XEVA 4E49A 4TWMA 3TVNX 4LP6A 4L5UA 4RIVA 4YGKA 5JESB 1BNQA 1G48A 3DVDA 3JXHC 1RZCA 1G0EA 1FQMA 1FQNA 3EFIA 2NWOA 3IGPA 1AZMA 3DV7A 4YGLA 4Q78A 5DOGA 1IF6A 3GZ0A 4WUPA 5SZ0A 3S74B 4IDRX 1HUGA 3MHLA 5FLQA 4KNJA 3MNIA 3T5UA 5FNMA 4KNIA 3R16A 3DVBA 2Q1BA 3N4BA 5SZ1A 1I9LA 3LXEA 1CVEA 3RGEA 1DMXA 4E4AA 5C8IA 3DCCA 1G4OA 1YDBA 5JGTB 1YO2A 4Z0QA 1HCAA 3DCWA 3MNHA 4KUVA 2NWPA 5FLSA 1DCAA 2OSFA 4XIWA 5DVXA 1UGBA 1F2WA 4YXUA 2NNGA 4CNWA 2IT4A 4Q8XA 4KUWA 2FMZA 4N0XB 1BNUA 5E2KA 4QK3A 1Z9YA 2WEJA 3L14A 4YWPA 5EZTX 5AMGA 4Z1NA 1ZH9A 1AVNA 4G7AA 4YGJA 1CNHA 1CCSA 2CABA 4L5WA 5FL6A 4XE1A 5L3OA 3W6IA 4COQA 5E2RA 5BNLA 1LG6A 3HKTA 3IEOA 3KOKA 3SAXA 1JV0A 5G03A 1MUAA 4HF3A 5A6HA 1KOPA 2NN1A 5DSNA 5EKJA 3RJ7A 4Q9YA 4JSZA 5DSKA 3KKXA 1I9MA 5IPZA 4Z1EA 3UYNA 3D8WA 1HECA 3HS4A 1I9QA 1YO1A 2EZ7A 1XPZA 1HEAA 4GL1X 1JCZA 1FSRA 1TB0X 4Z1KA 1BN1A 3RG3A 4YGNA 3MHMA 4WL4A 4ZWXA 2FOVA 2ABEA 3MNAA 4Q7SA
chains in the Genus database with same CATH superfamily
1OKLA 1LGDA 5FNKA 2OSMA 4Q81A 3IAIA 4FVOA 4Q83A 1LUGA 4JSSA 1EOUA 2GD8A 5DSOA 1OQ5A 3RYJB 1FR7A 4MLTA 1KEQA 4WW8A 3KWAA 2WEHA 3RZ7A 4Q09A 2HNCA 4MDMA 2HL4A 3KS3A 3K7KA 5DSQA 2NNSA 3F4XA 3QYKA 5FDIA 2ZNCA 2HKKA 4MTYA 3BETA 3M3XA 1G1DA 3U3AX 4YGFA 4MDGA 2NNVA 5G01A 5DSIA 3M1KA 1G45A 3M2XA 3T83A 4PQ7A 5BRWA 3DAZA 3KLDB 4RUXA 4FPTA 1A42A 4K13A 4TWLA 3M5EA 1CA3A 5J8ZA 4M2UA 4RUYA 1JD0A 4E3FA 4QJ0A 2X7UA 3JXGA 1DMYA 4Y0JA 2ILIA 3DBUA 3K2FA 1CAOA 3VBDA 2NXSA 3IBLA 5DSRA 5AMLA 5LMDA 1MOOA 1CAHA 3M67A 3RZ0B 3W6HA 4FIKA 3CA2A 4M2RA 1IF9A 4ETQC 2FNKA 4QJPA 3P5LA 1G54A 2NWYA 3MYQA 1FSQA 4Q6DA 3P58A 5G0BA 1CVHA 1CZMA 4Q7VA 3V5GA 2NXTA 1CILA 5JEHB 3U47A 3ZP9A 1FLJA 1BN4A 4FL7A 3UYQA 4QIYA 4QIZA 3KNEA 2QOAA 3V2MA 1BZMA 1TBTX 1URTA 3T82A 1CNCA 3P44A 3ML5A 3D0NA 5EHVA 4KNMA 4E3HA 3CZVA 4CNXA 5CACA 4Q08A 3MWOA 1V9EA 4X5SA 3U7CA 4BCWA 3DD0A 5FNIA 2EU2A 3V3IB 2Q38A 5DSPA 3FFPX 3T84A 3N2PA 4Q49A 4QJWA 3MNJA 5SZ3A 1FQLA 1T9NA 3RYXB 3V7XA 5EH7A 1LG5A 1RAYA 4HEYA 1G46A 1G6VA 1RZAA 1V9IC 4HEZA 2HOCA 4DZ7A 5JDVB 1G0FA 4CA2A 1BNTA 2CBAA 2AW1A 4WW6A 4QEFA 3RLDA 4PYYA 12CAA 3S77B 1BNMA 3TVOX 4ZWZA 1BNVA 5FNGA 4RN4A 5AMDA 4DZ9A 2CBDA 2WEGA 4MDLA 3CYUA 5FLPA 2NXRA 4K0SA 5EHWA 5EOIA 1CA2A 2CBEA 4E3GA 4Q8YA 4YXOA 1THKA 4K0ZA 1H9NA 3V2JA 3SBHA 2AX2A 4ZAOA 4KAPA 5EH8A 5FLOA 5SZ7A 2WD2A 2FW4A 1G4JA 1CVCA 5SZ2A 3M1JA 4KP8A 2O4ZA 4ZWIA 4KP5A 5FNHA 4QJOA 3D9ZA 4G0CA 4Q8ZA 2QP6A 5JG3B 3MHOA 5DRSA 1XQ0A 4XFWA 1ZFKA 8CA2A 3S76A 4HT2A 5DSJA 2NMXA 1CNWA 3N3JA 3DVCA 4YX4A 1CAMA 1CAIA 4MO8A 1IF4A 3HKNA 4RFCA 4E3DA 1CINA 4RFDA 1Z93A 3P3JA 3RG4A 3S72B 4FRCA 3M2NA 2FOSA 1TG3A 3V3GB 3P3HA 2EU3A 4L5VA 1IF5A 1CNBA 3DC9A 3IBNA 1KWQA 3TMJA 3ZNCA 3OY0A 4QJXA 1CIMA 1CCUA 4JS6A 4CACA 3T5ZA 4PZHA 4RUZA 1CALA 2X7SA 3OIMA 3S75B 2POUA 2X7TA 5E5UA 4ZX1A 5CA2A 1ZSAA 2FOQA 4ITOA 5HPJA 7CA2A 3DC3A 3PJJA 4QTLA 3HKQA 3M2ZA 3DD8A 3N0NA 3OYQA 3FE4A 3IBUA 1BV3A 1BCDA 5E5RA 4FU5A 5SZ5A 3OKUA 5JEGB 5BRVA 5BYIA 3OYSA 1YDCA 1RJ6A 5FL4A 4Q87A 4QJMA 5FL5A 1UGEA 4K0TA 3S73B 1CRMA 4Q99A 3U45X 5JGSB 1TEQX 1G52A 1LZVA 1ZSCA 2GEHA 4YVYA 4Q0LA 4LU3A 3S8XA 5CLUA 4CQ0A 3KOIA 1BNNA 5JEPB 5JQ0A 1TE3X 5FNLA 4E5QA 1J9WA 5L6KA 3NB5A 4M2VA 3MZCA 3K34A 1XEGA 3P4VA 5DOHA 3V3HB 1ZNCA 4Q6EA 4IWZA 1BNWA 1RJ5A 2NWZA 4LHIA 5EIJA 1CNKA 4PXXA 2F14A 1RZBA 1UGCA 1OKNA 2FNMA 4Q7PA 1UGFA 4QSAA 4RIUA 3RZ5A 1RZEA 4YYTA 2FOUA 3NI5A 3OIKA 4HT0A 2FOYA 1YDAA 1CAJA 3JXFA 1HVAA 2CBBA 4MLXA 5BRUA 3RZ1B 1Z97A 3MMFA 3EFTA 4WUQA 4HBAA 4KNNA 3D93A 1CVFA 1ZSBA 5EHEA 1CVDA 3F7UA 3HLJA 4KV0A 1AM6A 5SZ4A 1KOQA 4WR7A 4E9OX 3P55A 1TG9A 1I8ZA 4Z1JA 3S97A 3S9TA 2CBCA 4KUYA 1IF8A 5E2SA 4C3TA 1I90A 5SZ6A 3MNKA 3F7BA 3MHIA 3M98A 3ML2A 2NN7A 3OILA 4R5AA 4Q90A 9CA2A 3M04A 4JSWA 2VVAX 1I91A 1CNIA 3M14A 1FSNA 2HD6A 1TTMA 1CAKA 1ZGEA 3HFPA 4JSAA 4XIXA 5JG5B 4Q06A 2FNNA 3M1QA 2W2JA 2Q1QA 2WD3A 3SAPA 3BL0A 3M1WA 3RYYA 4R59A 5EH5A 3T85A 3F8EA 5JQTA 1CNGA 2WEOA 3NJ9A 1H9QA 4Q7WA 4QSJA 3S71B 3P5AA 2NNOA 4FVNA 1CVBA 4QSIA 1KWRA 5DSLA 1YO0A 2H15A 3KIGA 4QK2A 1TEUX 5G0CA 1ZFQA 3M96A 1HEDA 4K1QA 3V3JA 6CA2A 1CNJA 3M5SA 4HU1A 1UGAA 5CJFA 1TH9A 4BF6A 1CRAA 1DCBA 4N16A 1I9OA 1CVAA 3OKVA 3MNUA 1FR4A 1YDDA 3R17B 5FNJA 4HEWA 1UGGA 5EKHA 3B4FA 1RZDA 2VVBX 3PO6A 3MHCA 5A25A 1I9PA 5EKMA 3C7PA 2POVA 4ITPA 1I9NA 3M2YA 2CA2A 3SBIA 1ZE8A 1IF7A 3M40A 1H4NA 3FW3A 2QO8A 4YXIA 4UOVA 1CANA 1RAZA 1HCBA 3Q31A 5DSMA 1ZGFA 5E28A 1CCTA 1HUHA 4XZ5A 3S78B 1BN3A 4PYXA 3V3FA 1CNXA 4Q07A 4R5BA 3M5TA 4CNVA 4M2WA 3DCSA 2POWA 1UGDA 3MDZA 5FDCA 1Y7WA 5FLRA 2FMGA 4CNRA 3D92A 3RZ8A 3KONA 1CAYA 1G3ZA 1CNYA 3BL1A 4ZX0A 3CAJA 5E2NA 4YHAA 3DA2A 2HFWA 2H4NA 5FLTA 4QK1A 1CAZA 4QY3A 3PYKA 1HEBA 4QSBA 4ILXA 3RYVB 4ZWYA 1BICA 3HKUA 3B1BA 5E2MA 1G53A 4RH2A 1OKMA 3RYZA 3IBIA 1FQRA 4BF1A 1XEVA 4E49A 4TWMA 3TVNX 4LP6A 4L5UA 4RIVA 4YGKA 5JESB 1BNQA 1G48A 3DVDA 3JXHC 1RZCA 1G0EA 1FQMA 1FQNA 3EFIA 2NWOA 3IGPA 1AZMA 3DV7A 4YGLA 4Q78A 5DOGA 1IF6A 3GZ0A 4WUPA 5SZ0A 3S74B 4IDRX 1HUGA 3MHLA 5FLQA 4KNJA 3MNIA 3T5UA 5FNMA 4KNIA 3R16A 3DVBA 2Q1BA 3N4BA 5SZ1A 1I9LA 3LXEA 1CVEA 3RGEA 1DMXA 4E4AA 5C8IA 3DCCA 1G4OA 1YDBA 5JGTB 1YO2A 4Z0QA 1HCAA 3DCWA 3MNHA 4KUVA 2NWPA 5FLSA 1DCAA 2OSFA 4XIWA 5DVXA 1UGBA 1F2WA 4YXUA 2NNGA 4CNWA 2IT4A 4Q8XA 4KUWA 2FMZA 4N0XB 1BNUA 5E2KA 4QK3A 1Z9YA 2WEJA 3L14A 4YWPA 5EZTX 5AMGA 4Z1NA 1ZH9A 1AVNA 4G7AA 4YGJA 1CNHA 1CCSA 2CABA 4L5WA 5FL6A 4XE1A 5L3OA 3W6IA 4COQA 5E2RA 5BNLA 1LG6A 3HKTA 3IEOA 3KOKA 3SAXA 1JV0A 5G03A 1MUAA 4HF3A 5A6HA 1KOPA 2NN1A 5DSNA 5EKJA 3RJ7A 4Q9YA 4JSZA 5DSKA 3KKXA 1I9MA 5IPZA 4Z1EA 3UYNA 3D8WA 1HECA 3HS4A 1I9QA 1YO1A 2EZ7A 1XPZA 1HEAA 4GL1X 1JCZA 1FSRA 1TB0X 4Z1KA 1BN1A 3RG3A 4YGNA 3MHMA 4WL4A 4ZWXA 2FOVA 2ABEA 3MNAA 4Q7SA
chains in the Genus database with same CATH topology
1OKLA 1LGDA 5FNKA 2OSMA 4Q81A 3IAIA 4FVOA 4Q83A 1LUGA 4JSSA 1EOUA 2GD8A 5DSOA 1OQ5A 3RYJB 1FR7A 4MLTA 1KEQA 4WW8A 3KWAA 2WEHA 3RZ7A 4Q09A 2HNCA 4MDMA 2HL4A 3KS3A 3K7KA 5DSQA 2NNSA 3F4XA 3QYKA 5FDIA 2ZNCA 2HKKA 4MTYA 3BETA 3M3XA 1G1DA 3U3AX 4YGFA 4MDGA 2NNVA 5G01A 5DSIA 3M1KA 1G45A 3M2XA 3T83A 4PQ7A 5BRWA 3DAZA 3KLDB 4RUXA 4FPTA 1A42A 4K13A 4TWLA 3M5EA 1CA3A 5J8ZA 4M2UA 4RUYA 1JD0A 4E3FA 4QJ0A 2X7UA 3JXGA 1DMYA 4Y0JA 2ILIA 3DBUA 3K2FA 1CAOA 3VBDA 2NXSA 3IBLA 5DSRA 5AMLA 5LMDA 1MOOA 1CAHA 3M67A 3RZ0B 3W6HA 4FIKA 3CA2A 4M2RA 1IF9A 4ETQC 2FNKA 4QJPA 3P5LA 1G54A 2NWYA 3MYQA 1FSQA 4Q6DA 3P58A 5G0BA 1CVHA 1CZMA 4Q7VA 3V5GA 2NXTA 1CILA 5JEHB 3U47A 3ZP9A 1FLJA 1BN4A 4FL7A 3UYQA 4QIYA 4QIZA 3KNEA 2QOAA 3V2MA 1BZMA 1TBTX 1URTA 3T82A 1CNCA 3P44A 3ML5A 3D0NA 5EHVA 4KNMA 4E3HA 3CZVA 4CNXA 5CACA 4Q08A 3MWOA 1V9EA 4X5SA 3U7CA 4BCWA 3DD0A 5FNIA 2EU2A 3V3IB 2Q38A 5DSPA 3FFPX 3T84A 3N2PA 4Q49A 4QJWA 3MNJA 5SZ3A 1FQLA 1T9NA 3RYXB 3V7XA 5EH7A 1LG5A 1RAYA 4HEYA 1G46A 1G6VA 1RZAA 1V9IC 4HEZA 2HOCA 4DZ7A 5JDVB 1G0FA 4CA2A 1BNTA 2CBAA 2AW1A 4WW6A 4QEFA 3RLDA 4PYYA 12CAA 3S77B 1BNMA 3TVOX 4ZWZA 1BNVA 5FNGA 4RN4A 5AMDA 4DZ9A 2CBDA 2WEGA 4MDLA 3CYUA 5FLPA 2NXRA 4K0SA 5EHWA 5EOIA 1CA2A 2CBEA 4E3GA 4Q8YA 4YXOA 1THKA 4K0ZA 1H9NA 3V2JA 3SBHA 2AX2A 4ZAOA 4KAPA 5EH8A 5FLOA 5SZ7A 2WD2A 2FW4A 1G4JA 1CVCA 5SZ2A 3M1JA 4KP8A 2O4ZA 4ZWIA 4KP5A 5FNHA 4QJOA 3D9ZA 4G0CA 4Q8ZA 2QP6A 5JG3B 3MHOA 5DRSA 1XQ0A 4XFWA 1ZFKA 8CA2A 3S76A 4HT2A 5DSJA 2NMXA 1CNWA 3N3JA 3DVCA 4YX4A 1CAMA 1CAIA 4MO8A 1IF4A 3HKNA 4RFCA 4E3DA 1CINA 4RFDA 1Z93A 3P3JA 3RG4A 3S72B 4FRCA 3M2NA 2FOSA 1TG3A 3V3GB 3P3HA 2EU3A 4L5VA 1IF5A 1CNBA 3DC9A 3IBNA 1KWQA 3TMJA 3ZNCA 3OY0A 4QJXA 1CIMA 1CCUA 4JS6A 4CACA 3T5ZA 4PZHA 4RUZA 1CALA 2X7SA 3OIMA 3S75B 2POUA 2X7TA 5E5UA 4ZX1A 5CA2A 1ZSAA 2FOQA 4ITOA 5HPJA 7CA2A 3DC3A 3PJJA 4QTLA 3HKQA 3M2ZA 3DD8A 3N0NA 3OYQA 3FE4A 3IBUA 1BV3A 1BCDA 5E5RA 4FU5A 5SZ5A 3OKUA 5JEGB 5BRVA 5BYIA 3OYSA 1YDCA 1RJ6A 5FL4A 4Q87A 4QJMA 5FL5A 1UGEA 4K0TA 3S73B 1CRMA 4Q99A 3U45X 5JGSB 1TEQX 1G52A 1LZVA 1ZSCA 2GEHA 4YVYA 4Q0LA 4LU3A 3S8XA 5CLUA 4CQ0A 3KOIA 1BNNA 5JEPB 5JQ0A 1TE3X 5FNLA 4E5QA 1J9WA 5L6KA 3NB5A 4M2VA 3MZCA 3K34A 1XEGA 3P4VA 5DOHA 3V3HB 1ZNCA 4Q6EA 4IWZA 1BNWA 1RJ5A 2NWZA 4LHIA 5EIJA 1CNKA 4PXXA 2F14A 1RZBA 1UGCA 1OKNA 2FNMA 4Q7PA 1UGFA 4QSAA 4RIUA 3RZ5A 1RZEA 4YYTA 2FOUA 3NI5A 3OIKA 4HT0A 2FOYA 1YDAA 1CAJA 3JXFA 1HVAA 2CBBA 4MLXA 5BRUA 3RZ1B 1Z97A 3MMFA 3EFTA 4WUQA 4HBAA 4KNNA 3D93A 1CVFA 1ZSBA 5EHEA 1CVDA 3F7UA 3HLJA 4KV0A 1AM6A 5SZ4A 1KOQA 4WR7A 4E9OX 3P55A 1TG9A 1I8ZA 4Z1JA 3S97A 3S9TA 2CBCA 4KUYA 1IF8A 5E2SA 4C3TA 1I90A 5SZ6A 3MNKA 3F7BA 3MHIA 3M98A 3ML2A 2NN7A 3OILA 4R5AA 4Q90A 9CA2A 3M04A 4JSWA 2VVAX 1I91A 1CNIA 3M14A 1FSNA 2HD6A 1TTMA 1CAKA 1ZGEA 3HFPA 4JSAA 4XIXA 5JG5B 4Q06A 2FNNA 3M1QA 2W2JA 2Q1QA 2WD3A 3SAPA 3BL0A 3M1WA 3RYYA 4R59A 5EH5A 3T85A 3F8EA 5JQTA 1CNGA 2WEOA 3NJ9A 1H9QA 4Q7WA 4QSJA 3S71B 3P5AA 2NNOA 4FVNA 1CVBA 4QSIA 1KWRA 5DSLA 1YO0A 2H15A 3KIGA 4QK2A 1TEUX 5G0CA 1ZFQA 3M96A 1HEDA 4K1QA 3V3JA 6CA2A 1CNJA 3M5SA 4HU1A 1UGAA 5CJFA 1TH9A 4BF6A 1CRAA 1DCBA 4N16A 1I9OA 1CVAA 3OKVA 3MNUA 1FR4A 1YDDA 3R17B 5FNJA 4HEWA 1UGGA 5EKHA 3B4FA 1RZDA 2VVBX 3PO6A 3MHCA 5A25A 1I9PA 5EKMA 3C7PA 2POVA 4ITPA 1I9NA 3M2YA 2CA2A 3SBIA 1ZE8A 1IF7A 3M40A 1H4NA 3FW3A 2QO8A 4YXIA 4UOVA 1CANA 1RAZA 1HCBA 3Q31A 5DSMA 1ZGFA 5E28A 1CCTA 1HUHA 4XZ5A 3S78B 1BN3A 4PYXA 3V3FA 1CNXA 4Q07A 4R5BA 3M5TA 4CNVA 4M2WA 3DCSA 2POWA 1UGDA 3MDZA 5FDCA 1Y7WA 5FLRA 2FMGA 4CNRA 3D92A 3RZ8A 3KONA 1CAYA 1G3ZA 1CNYA 3BL1A 4ZX0A 3CAJA 5E2NA 4YHAA 3DA2A 2HFWA 2H4NA 5FLTA 4QK1A 1CAZA 4QY3A 3PYKA 1HEBA 4QSBA 4ILXA 3RYVB 4ZWYA 1BICA 3HKUA 3B1BA 5E2MA 1G53A 4RH2A 1OKMA 3RYZA 3IBIA 1FQRA 4BF1A 1XEVA 4E49A 4TWMA 3TVNX 4LP6A 4L5UA 4RIVA 4YGKA 5JESB 1BNQA 1G48A 3DVDA 3JXHC 1RZCA 1G0EA 1FQMA 1FQNA 3EFIA 2NWOA 3IGPA 1AZMA 3DV7A 4YGLA 4Q78A 5DOGA 1IF6A 3GZ0A 4WUPA 5SZ0A 3S74B 4IDRX 1HUGA 3MHLA 5FLQA 4KNJA 3MNIA 3T5UA 5FNMA 4KNIA 3R16A 3DVBA 2Q1BA 3N4BA 5SZ1A 1I9LA 3LXEA 1CVEA 3RGEA 1DMXA 4E4AA 5C8IA 3DCCA 1G4OA 1YDBA 5JGTB 1YO2A 4Z0QA 1HCAA 3DCWA 3MNHA 4KUVA 2NWPA 5FLSA 1DCAA 2OSFA 4XIWA 5DVXA 1UGBA 1F2WA 4YXUA 2NNGA 4CNWA 2IT4A 4Q8XA 4KUWA 2FMZA 4N0XB 1BNUA 5E2KA 4QK3A 1Z9YA 2WEJA 3L14A 4YWPA 5EZTX 5AMGA 4Z1NA 1ZH9A 1AVNA 4G7AA 4YGJA 1CNHA 1CCSA 2CABA 4L5WA 5FL6A 4XE1A 5L3OA 3W6IA 4COQA 5E2RA 5BNLA 1LG6A 3HKTA 3IEOA 3KOKA 3SAXA 1JV0A 5G03A 1MUAA 4HF3A 5A6HA 1KOPA 2NN1A 5DSNA 5EKJA 3RJ7A 4Q9YA 4JSZA 5DSKA 3KKXA 1I9MA 5IPZA 4Z1EA 3UYNA 3D8WA 1HECA 3HS4A 1I9QA 1YO1A 2EZ7A 1XPZA 1HEAA 4GL1X 1JCZA 1FSRA 1TB0X 4Z1KA 1BN1A 3RG3A 4YGNA 3MHMA 4WL4A 4ZWXA 2FOVA 2ABEA 3MNAA 4Q7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKL A;  1LGD A;  5FNK A;  2OSM A;  4Q81 A;  3IAI A;  4FVO A;  4Q83 A;  1LUG A;  4JSS A;  1EOU A;  2GD8 A;  5DSO A;  1OQ5 A;  3RYJ B;  1FR7 A;  4MLT A;  1KEQ A;  4WW8 A;  3KWA A;  2WEH A;  3RZ7 A;  4Q09 A;  2HNC A;  4MDM A;  2HL4 A;  3KS3 A;  3K7K A;  5DSQ A;  2NNS A;  3F4X A;  3QYK A;  5FDI A;  2ZNC A;  2HKK A;  4MTY A;  3BET A;  3M3X A;  1G1D A;  3U3A X;  4YGF A;  4MDG A;  2NNV A;  5G01 A;  5DSI A;  3M1K A;  1G45 A;  3M2X A;  3T83 A;  4PQ7 A;  5BRW A;  3DAZ A;  3KLD B;  4RUX A;  4FPT A;  1A42 A;  4K13 A;  4TWL A;  3M5E A;  1CA3 A;  5J8Z A;  4M2U A;  4RUY A;  1JD0 A;  4E3F A;  4QJ0 A;  2X7U A;  3JXG A;  1DMY A;  4Y0J A;  2ILI A;  3DBU A;  3K2F A;  1CAO A;  3VBD A;  2NXS A;  3IBL A;  5DSR A;  5AML A;  5LMD A;  1MOO A;  1CAH A;  3M67 A;  3RZ0 B;  3W6H A;  4FIK A;  3CA2 A;  4M2R A;  1IF9 A;  4ETQ C;  2FNK A;  4QJP A;  3P5L A;  1G54 A;  2NWY A;  3MYQ A;  1FSQ A;  4Q6D A;  3P58 A;  5G0B A;  1CVH A;  1CZM A;  4Q7V A;  3V5G A;  2NXT A;  1CIL A;  5JEH B;  3U47 A;  3ZP9 A;  1FLJ A;  1BN4 A;  4FL7 A;  3UYQ A;  4QIY A;  4QIZ A;  3KNE A;  2QOA A;  3V2M A;  1BZM A;  1TBT X;  1URT A;  3T82 A;  1CNC A;  3P44 A;  3ML5 A;  3D0N A;  5EHV A;  4KNM A;  4E3H A;  3CZV A;  4CNX A;  5CAC A;  4Q08 A;  3MWO A;  1V9E A;  4X5S A;  3U7C A;  4BCW A;  3DD0 A;  5FNI A;  2EU2 A;  3V3I B;  2Q38 A;  5DSP A;  3FFP X;  3T84 A;  3N2P A;  4Q49 A;  4QJW A;  3MNJ A;  5SZ3 A;  1FQL A;  1T9N A;  3RYX B;  3V7X A;  5EH7 A;  1LG5 A;  1RAY A;  4HEY A;  1G46 A;  1G6V A;  1RZA A;  1V9I C;  4HEZ A;  2HOC A;  4DZ7 A;  5JDV B;  1G0F A;  4CA2 A;  1BNT A;  2CBA A;  2AW1 A;  4WW6 A;  4QEF A;  3RLD A;  4PYY A;  12CA A;  3S77 B;  1BNM A;  3TVO X;  4ZWZ A;  1BNV A;  5FNG A;  4RN4 A;  5AMD A;  4DZ9 A;  2CBD A;  2WEG A;  4MDL A;  3CYU A;  5FLP A;  2NXR A;  4K0S A;  5EHW A;  5EOI A;  1CA2 A;  2CBE A;  4E3G A;  4Q8Y A;  4YXO A;  1THK A;  4K0Z A;  1H9N A;  3V2J A;  3SBH A;  2AX2 A;  4ZAO A;  4KAP A;  5EH8 A;  5FLO A;  5SZ7 A;  2WD2 A;  2FW4 A;  1G4J A;  1CVC A;  5SZ2 A;  3M1J A;  4KP8 A;  2O4Z A;  4ZWI A;  4KP5 A;  5FNH A;  4QJO A;  3D9Z A;  4G0C A;  4Q8Z A;  2QP6 A;  5JG3 B;  3MHO A;  5DRS A;  1XQ0 A;  4XFW A;  1ZFK A;  8CA2 A;  3S76 A;  4HT2 A;  5DSJ A;  2NMX A;  1CNW A;  3N3J A;  3DVC A;  4YX4 A;  1CAM A;  1CAI A;  4MO8 A;  1IF4 A;  3HKN A;  4RFC A;  4E3D A;  1CIN A;  4RFD A;  1Z93 A;  3P3J A;  3RG4 A;  3S72 B;  4FRC A;  3M2N A;  2FOS A;  1TG3 A;  3V3G B;  3P3H A;  2EU3 A;  4L5V A;  1IF5 A;  1CNB A;  3DC9 A;  3IBN A;  1KWQ A;  3TMJ A;  3ZNC A;  3OY0 A;  4QJX A;  1CIM A;  1CCU A;  4JS6 A;  4CAC A;  3T5Z A;  4PZH A;  4RUZ A;  1CAL A;  2X7S A;  3OIM A;  3S75 B;  2POU A;  2X7T A;  5E5U A;  4ZX1 A;  5CA2 A;  1ZSA A;  2FOQ A;  4ITO A;  5HPJ A;  7CA2 A;  3DC3 A;  3PJJ A;  4QTL A;  3HKQ A;  3M2Z A;  3DD8 A;  3N0N A;  3OYQ A;  3FE4 A;  3IBU A;  1BV3 A;  1BCD A;  5E5R A;  4FU5 A;  5SZ5 A;  3OKU A;  5JEG B;  5BRV A;  5BYI A;  3OYS A;  1YDC A;  1RJ6 A;  5FL4 A;  4Q87 A;  4QJM A;  5FL5 A;  1UGE A;  4K0T A;  3S73 B;  1CRM A;  4Q99 A;  3U45 X;  5JGS B;  1TEQ X;  1G52 A;  1LZV A;  1ZSC A;  2GEH A;  4YVY A;  4Q0L A;  4LU3 A;  3S8X A;  5CLU A;  4CQ0 A;  3KOI A;  1BNN A;  5JEP B;  5JQ0 A;  1TE3 X;  5FNL A;  4E5Q A;  1J9W A;  5L6K A;  3NB5 A;  4M2V A;  3MZC A;  3K34 A;  1XEG A;  3P4V A;  5DOH A;  3V3H B;  1ZNC A;  4Q6E A;  4IWZ A;  1BNW A;  1RJ5 A;  2NWZ A;  4LHI A;  5EIJ A;  1CNK A;  4PXX A;  2F14 A;  1RZB A;  1UGC A;  1OKN A;  2FNM A;  4Q7P A;  1UGF A;  4QSA A;  4RIU A;  3RZ5 A;  1RZE A;  4YYT A;  2FOU A;  3NI5 A;  3OIK A;  4HT0 A;  2FOY A;  1YDA A;  1CAJ A;  3JXF A;  1HVA A;  2CBB A;  4MLX A;  5BRU A;  3RZ1 B;  1Z97 A;  3MMF A;  3EFT A;  4WUQ A;  4HBA A;  4KNN A;  3D93 A;  1CVF A;  1ZSB A;  5EHE A;  1CVD A;  3F7U A;  3HLJ A;  4KV0 A;  1AM6 A;  5SZ4 A;  1KOQ A;  4WR7 A;  4E9O X;  3P55 A;  1TG9 A;  1I8Z A;  4Z1J A;  3S97 A;  3S9T A;  2CBC A;  4KUY A;  1IF8 A;  5E2S A;  4C3T A;  1I90 A;  5SZ6 A;  3MNK A;  3F7B A;  3MHI A;  3M98 A;  3ML2 A;  2NN7 A;  3OIL A;  4R5A A;  4Q90 A;  9CA2 A;  3M04 A;  4JSW A;  2VVA X;  1I91 A;  1CNI A;  3M14 A;  1FSN A;  2HD6 A;  1TTM A;  1CAK A;  1ZGE A;  3HFP A;  4JSA A;  4XIX A;  5JG5 B;  4Q06 A;  2FNN A;  3M1Q A;  2W2J A;  2Q1Q A;  2WD3 A;  3SAP A;  3BL0 A;  3M1W A;  3RYY A;  4R59 A;  5EH5 A;  3T85 A;  3F8E A;  5JQT A;  1CNG A;  2WEO A;  3NJ9 A;  1H9Q A;  4Q7W A;  4QSJ A;  3S71 B;  3P5A A;  2NNO A;  4FVN A;  1CVB A;  4QSI A;  1KWR A;  5DSL A;  1YO0 A;  2H15 A;  3KIG A;  4QK2 A;  1TEU X;  5G0C A;  1ZFQ A;  3M96 A;  1HED A;  4K1Q A;  3V3J A;  6CA2 A;  1CNJ A;  3M5S A;  4HU1 A;  1UGA A;  5CJF A;  1TH9 A;  4BF6 A;  1CRA A;  1DCB A;  4N16 A;  1I9O A;  1CVA A;  3OKV A;  3MNU A;  1FR4 A;  1YDD A;  3R17 B;  5FNJ A;  4HEW A;  1UGG A;  5EKH A;  3B4F A;  1RZD A;  2VVB X;  3PO6 A;  3MHC A;  5A25 A;  1I9P A;  5EKM A;  3C7P A;  2POV A;  4ITP A;  1I9N A;  3M2Y A;  2CA2 A;  3SBI A;  1ZE8 A;  1IF7 A;  3M40 A;  1H4N A;  3FW3 A;  2QO8 A;  4YXI A;  4UOV A;  1CAN A;  1RAZ A;  1HCB A;  3Q31 A;  5DSM A;  1ZGF A;  5E28 A;  1CCT A;  1HUH A;  4XZ5 A;  3S78 B;  1BN3 A;  4PYX A;  3V3F A;  1CNX A;  4Q07 A;  4R5B A;  3M5T A;  4CNV A;  4M2W A;  3DCS A;  2POW A;  1UGD A;  3MDZ A;  5FDC A;  1Y7W A;  5FLR A;  2FMG A;  4CNR A;  3D92 A;  3RZ8 A;  3KON A;  1CAY A;  1G3Z A;  1CNY A;  3BL1 A;  4ZX0 A;  3CAJ A;  5E2N A;  4YHA A;  3DA2 A;  2HFW A;  2H4N A;  5FLT A;  4QK1 A;  1CAZ A;  4QY3 A;  3PYK A;  1HEB A;  4QSB A;  4ILX A;  3RYV B;  4ZWY A;  1BIC A;  3HKU A;  3B1B A;  5E2M A;  1G53 A;  4RH2 A;  1OKM A;  3RYZ A;  3IBI A;  1FQR A;  4BF1 A;  1XEV A;  4E49 A;  4TWM A;  3TVN X;  4LP6 A;  4L5U A;  4RIV A;  4YGK A;  5JES B;  1BNQ A;  1G48 A;  3DVD A;  3JXH C;  1RZC A;  1G0E A;  1FQM A;  1FQN A;  3EFI A;  2NWO A;  3IGP A;  1AZM A;  3DV7 A;  4YGL A;  4Q78 A;  5DOG A;  1IF6 A;  3GZ0 A;  4WUP A;  5SZ0 A;  3S74 B;  4IDR X;  1HUG A;  3MHL A;  5FLQ A;  4KNJ A;  3MNI A;  3T5U A;  5FNM A;  4KNI A;  3R16 A;  3DVB A;  2Q1B A;  3N4B A;  5SZ1 A;  1I9L A;  3LXE A;  1CVE A;  3RGE A;  1DMX A;  4E4A A;  5C8I A;  3DCC A;  1G4O A;  1YDB A;  5JGT B;  1YO2 A;  4Z0Q A;  1HCA A;  3DCW A;  3MNH A;  4KUV A;  2NWP A;  5FLS A;  1DCA A;  2OSF A;  4XIW A;  5DVX A;  1UGB A;  1F2W A;  4YXU A;  2NNG A;  4CNW A;  2IT4 A;  4Q8X A;  4KUW A;  2FMZ A;  4N0X B;  1BNU A;  5E2K A;  4QK3 A;  1Z9Y A;  2WEJ A;  3L14 A;  4YWP A;  5EZT X;  5AMG A;  4Z1N A;  1ZH9 A;  1AVN A;  4G7A A;  4YGJ A;  1CNH A;  1CCS A;  2CAB A;  4L5W A;  5FL6 A;  4XE1 A;  5L3O A;  3W6I A;  4COQ A;  5E2R A;  5BNL A;  1LG6 A;  3HKT A;  3IEO A;  3KOK A;  3SAX A;  1JV0 A;  5G03 A;  1MUA A;  4HF3 A;  5A6H A;  1KOP A;  2NN1 A;  5DSN A;  5EKJ A;  3RJ7 A;  4Q9Y A;  4JSZ A;  5DSK A;  3KKX A;  1I9M A;  5IPZ A;  4Z1E A;  3UYN A;  3D8W A;  1HEC A;  3HS4 A;  1I9Q A;  1YO1 A;  2EZ7 A;  1XPZ A;  1HEA A;  4GL1 X;  1JCZ A;  1FSR A;  1TB0 X;  4Z1K A;  1BN1 A;  3RG3 A;  4YGN A;  3MHM A;  4WL4 A;  4ZWX A;  2FOV A;  2ABE A;  3MNA A;  4Q7S A; 
#chains in the Genus database with same CATH topology
 1OKL A;  1LGD A;  5FNK A;  2OSM A;  4Q81 A;  3IAI A;  4FVO A;  4Q83 A;  1LUG A;  4JSS A;  1EOU A;  2GD8 A;  5DSO A;  1OQ5 A;  3RYJ B;  1FR7 A;  4MLT A;  1KEQ A;  4WW8 A;  3KWA A;  2WEH A;  3RZ7 A;  4Q09 A;  2HNC A;  4MDM A;  2HL4 A;  3KS3 A;  3K7K A;  5DSQ A;  2NNS A;  3F4X A;  3QYK A;  5FDI A;  2ZNC A;  2HKK A;  4MTY A;  3BET A;  3M3X A;  1G1D A;  3U3A X;  4YGF A;  4MDG A;  2NNV A;  5G01 A;  5DSI A;  3M1K A;  1G45 A;  3M2X A;  3T83 A;  4PQ7 A;  5BRW A;  3DAZ A;  3KLD B;  4RUX A;  4FPT A;  1A42 A;  4K13 A;  4TWL A;  3M5E A;  1CA3 A;  5J8Z A;  4M2U A;  4RUY A;  1JD0 A;  4E3F A;  4QJ0 A;  2X7U A;  3JXG A;  1DMY A;  4Y0J A;  2ILI A;  3DBU A;  3K2F A;  1CAO A;  3VBD A;  2NXS A;  3IBL A;  5DSR A;  5AML A;  5LMD A;  1MOO A;  1CAH A;  3M67 A;  3RZ0 B;  3W6H A;  4FIK A;  3CA2 A;  4M2R A;  1IF9 A;  4ETQ C;  2FNK A;  4QJP A;  3P5L A;  1G54 A;  2NWY A;  3MYQ A;  1FSQ A;  4Q6D A;  3P58 A;  5G0B A;  1CVH A;  1CZM A;  4Q7V A;  3V5G A;  2NXT A;  1CIL A;  5JEH B;  3U47 A;  3ZP9 A;  1FLJ A;  1BN4 A;  4FL7 A;  3UYQ A;  4QIY A;  4QIZ A;  3KNE A;  2QOA A;  3V2M A;  1BZM A;  1TBT X;  1URT A;  3T82 A;  1CNC A;  3P44 A;  3ML5 A;  3D0N A;  5EHV A;  4KNM A;  4E3H A;  3CZV A;  4CNX A;  5CAC A;  4Q08 A;  3MWO A;  1V9E A;  4X5S A;  3U7C A;  4BCW A;  3DD0 A;  5FNI A;  2EU2 A;  3V3I B;  2Q38 A;  5DSP A;  3FFP X;  3T84 A;  3N2P A;  4Q49 A;  4QJW A;  3MNJ A;  5SZ3 A;  1FQL A;  1T9N A;  3RYX B;  3V7X A;  5EH7 A;  1LG5 A;  1RAY A;  4HEY A;  1G46 A;  1G6V A;  1RZA A;  1V9I C;  4HEZ A;  2HOC A;  4DZ7 A;  5JDV B;  1G0F A;  4CA2 A;  1BNT A;  2CBA A;  2AW1 A;  4WW6 A;  4QEF A;  3RLD A;  4PYY A;  12CA A;  3S77 B;  1BNM A;  3TVO X;  4ZWZ A;  1BNV A;  5FNG A;  4RN4 A;  5AMD A;  4DZ9 A;  2CBD A;  2WEG A;  4MDL A;  3CYU A;  5FLP A;  2NXR A;  4K0S A;  5EHW A;  5EOI A;  1CA2 A;  2CBE A;  4E3G A;  4Q8Y A;  4YXO A;  1THK A;  4K0Z A;  1H9N A;  3V2J A;  3SBH A;  2AX2 A;  4ZAO A;  4KAP A;  5EH8 A;  5FLO A;  5SZ7 A;  2WD2 A;  2FW4 A;  1G4J A;  1CVC A;  5SZ2 A;  3M1J A;  4KP8 A;  2O4Z A;  4ZWI A;  4KP5 A;  5FNH A;  4QJO A;  3D9Z A;  4G0C A;  4Q8Z A;  2QP6 A;  5JG3 B;  3MHO A;  5DRS A;  1XQ0 A;  4XFW A;  1ZFK A;  8CA2 A;  3S76 A;  4HT2 A;  5DSJ A;  2NMX A;  1CNW A;  3N3J A;  3DVC A;  4YX4 A;  1CAM A;  1CAI A;  4MO8 A;  1IF4 A;  3HKN A;  4RFC A;  4E3D A;  1CIN A;  4RFD A;  1Z93 A;  3P3J A;  3RG4 A;  3S72 B;  4FRC A;  3M2N A;  2FOS A;  1TG3 A;  3V3G B;  3P3H A;  2EU3 A;  4L5V A;  1IF5 A;  1CNB A;  3DC9 A;  3IBN A;  1KWQ A;  3TMJ A;  3ZNC A;  3OY0 A;  4QJX A;  1CIM A;  1CCU A;  4JS6 A;  4CAC A;  3T5Z A;  4PZH A;  4RUZ A;  1CAL A;  2X7S A;  3OIM A;  3S75 B;  2POU A;  2X7T A;  5E5U A;  4ZX1 A;  5CA2 A;  1ZSA A;  2FOQ A;  4ITO A;  5HPJ A;  7CA2 A;  3DC3 A;  3PJJ A;  4QTL A;  3HKQ A;  3M2Z A;  3DD8 A;  3N0N A;  3OYQ A;  3FE4 A;  3IBU A;  1BV3 A;  1BCD A;  5E5R A;  4FU5 A;  5SZ5 A;  3OKU A;  5JEG B;  5BRV A;  5BYI A;  3OYS A;  1YDC A;  1RJ6 A;  5FL4 A;  4Q87 A;  4QJM A;  5FL5 A;  1UGE A;  4K0T A;  3S73 B;  1CRM A;  4Q99 A;  3U45 X;  5JGS B;  1TEQ X;  1G52 A;  1LZV A;  1ZSC A;  2GEH A;  4YVY A;  4Q0L A;  4LU3 A;  3S8X A;  5CLU A;  4CQ0 A;  3KOI A;  1BNN A;  5JEP B;  5JQ0 A;  1TE3 X;  5FNL A;  4E5Q A;  1J9W A;  5L6K A;  3NB5 A;  4M2V A;  3MZC A;  3K34 A;  1XEG A;  3P4V A;  5DOH A;  3V3H B;  1ZNC A;  4Q6E A;  4IWZ A;  1BNW A;  1RJ5 A;  2NWZ A;  4LHI A;  5EIJ A;  1CNK A;  4PXX A;  2F14 A;  1RZB A;  1UGC A;  1OKN A;  2FNM A;  4Q7P A;  1UGF A;  4QSA A;  4RIU A;  3RZ5 A;  1RZE A;  4YYT A;  2FOU A;  3NI5 A;  3OIK A;  4HT0 A;  2FOY A;  1YDA A;  1CAJ A;  3JXF A;  1HVA A;  2CBB A;  4MLX A;  5BRU A;  3RZ1 B;  1Z97 A;  3MMF A;  3EFT A;  4WUQ A;  4HBA A;  4KNN A;  3D93 A;  1CVF A;  1ZSB A;  5EHE A;  1CVD A;  3F7U A;  3HLJ A;  4KV0 A;  1AM6 A;  5SZ4 A;  1KOQ A;  4WR7 A;  4E9O X;  3P55 A;  1TG9 A;  1I8Z A;  4Z1J A;  3S97 A;  3S9T A;  2CBC A;  4KUY A;  1IF8 A;  5E2S A;  4C3T A;  1I90 A;  5SZ6 A;  3MNK A;  3F7B A;  3MHI A;  3M98 A;  3ML2 A;  2NN7 A;  3OIL A;  4R5A A;  4Q90 A;  9CA2 A;  3M04 A;  4JSW A;  2VVA X;  1I91 A;  1CNI A;  3M14 A;  1FSN A;  2HD6 A;  1TTM A;  1CAK A;  1ZGE A;  3HFP A;  4JSA A;  4XIX A;  5JG5 B;  4Q06 A;  2FNN A;  3M1Q A;  2W2J A;  2Q1Q A;  2WD3 A;  3SAP A;  3BL0 A;  3M1W A;  3RYY A;  4R59 A;  5EH5 A;  3T85 A;  3F8E A;  5JQT A;  1CNG A;  2WEO A;  3NJ9 A;  1H9Q A;  4Q7W A;  4QSJ A;  3S71 B;  3P5A A;  2NNO A;  4FVN A;  1CVB A;  4QSI A;  1KWR A;  5DSL A;  1YO0 A;  2H15 A;  3KIG A;  4QK2 A;  1TEU X;  5G0C A;  1ZFQ A;  3M96 A;  1HED A;  4K1Q A;  3V3J A;  6CA2 A;  1CNJ A;  3M5S A;  4HU1 A;  1UGA A;  5CJF A;  1TH9 A;  4BF6 A;  1CRA A;  1DCB A;  4N16 A;  1I9O A;  1CVA A;  3OKV A;  3MNU A;  1FR4 A;  1YDD A;  3R17 B;  5FNJ A;  4HEW A;  1UGG A;  5EKH A;  3B4F A;  1RZD A;  2VVB X;  3PO6 A;  3MHC A;  5A25 A;  1I9P A;  5EKM A;  3C7P A;  2POV A;  4ITP A;  1I9N A;  3M2Y A;  2CA2 A;  3SBI A;  1ZE8 A;  1IF7 A;  3M40 A;  1H4N A;  3FW3 A;  2QO8 A;  4YXI A;  4UOV A;  1CAN A;  1RAZ A;  1HCB A;  3Q31 A;  5DSM A;  1ZGF A;  5E28 A;  1CCT A;  1HUH A;  4XZ5 A;  3S78 B;  1BN3 A;  4PYX A;  3V3F A;  1CNX A;  4Q07 A;  4R5B A;  3M5T A;  4CNV A;  4M2W A;  3DCS A;  2POW A;  1UGD A;  3MDZ A;  5FDC A;  1Y7W A;  5FLR A;  2FMG A;  4CNR A;  3D92 A;  3RZ8 A;  3KON A;  1CAY A;  1G3Z A;  1CNY A;  3BL1 A;  4ZX0 A;  3CAJ A;  5E2N A;  4YHA A;  3DA2 A;  2HFW A;  2H4N A;  5FLT A;  4QK1 A;  1CAZ A;  4QY3 A;  3PYK A;  1HEB A;  4QSB A;  4ILX A;  3RYV B;  4ZWY A;  1BIC A;  3HKU A;  3B1B A;  5E2M A;  1G53 A;  4RH2 A;  1OKM A;  3RYZ A;  3IBI A;  1FQR A;  4BF1 A;  1XEV A;  4E49 A;  4TWM A;  3TVN X;  4LP6 A;  4L5U A;  4RIV A;  4YGK A;  5JES B;  1BNQ A;  1G48 A;  3DVD A;  3JXH C;  1RZC A;  1G0E A;  1FQM A;  1FQN A;  3EFI A;  2NWO A;  3IGP A;  1AZM A;  3DV7 A;  4YGL A;  4Q78 A;  5DOG A;  1IF6 A;  3GZ0 A;  4WUP A;  5SZ0 A;  3S74 B;  4IDR X;  1HUG A;  3MHL A;  5FLQ A;  4KNJ A;  3MNI A;  3T5U A;  5FNM A;  4KNI A;  3R16 A;  3DVB A;  2Q1B A;  3N4B A;  5SZ1 A;  1I9L A;  3LXE A;  1CVE A;  3RGE A;  1DMX A;  4E4A A;  5C8I A;  3DCC A;  1G4O A;  1YDB A;  5JGT B;  1YO2 A;  4Z0Q A;  1HCA A;  3DCW A;  3MNH A;  4KUV A;  2NWP A;  5FLS A;  1DCA A;  2OSF A;  4XIW A;  5DVX A;  1UGB A;  1F2W A;  4YXU A;  2NNG A;  4CNW A;  2IT4 A;  4Q8X A;  4KUW A;  2FMZ A;  4N0X B;  1BNU A;  5E2K A;  4QK3 A;  1Z9Y A;  2WEJ A;  3L14 A;  4YWP A;  5EZT X;  5AMG A;  4Z1N A;  1ZH9 A;  1AVN A;  4G7A A;  4YGJ A;  1CNH A;  1CCS A;  2CAB A;  4L5W A;  5FL6 A;  4XE1 A;  5L3O A;  3W6I A;  4COQ A;  5E2R A;  5BNL A;  1LG6 A;  3HKT A;  3IEO A;  3KOK A;  3SAX A;  1JV0 A;  5G03 A;  1MUA A;  4HF3 A;  5A6H A;  1KOP A;  2NN1 A;  5DSN A;  5EKJ A;  3RJ7 A;  4Q9Y A;  4JSZ A;  5DSK A;  3KKX A;  1I9M A;  5IPZ A;  4Z1E A;  3UYN A;  3D8W A;  1HEC A;  3HS4 A;  1I9Q A;  1YO1 A;  2EZ7 A;  1XPZ A;  1HEA A;  4GL1 X;  1JCZ A;  1FSR A;  1TB0 X;  4Z1K A;  1BN1 A;  3RG3 A;  4YGN A;  3MHM A;  4WL4 A;  4ZWX A;  2FOV A;  2ABE A;  3MNA A;  4Q7S A; 
#chains in the Genus database with same CATH homology
 1OKL A;  1LGD A;  5FNK A;  2OSM A;  4Q81 A;  3IAI A;  4FVO A;  4Q83 A;  1LUG A;  4JSS A;  1EOU A;  2GD8 A;  5DSO A;  1OQ5 A;  3RYJ B;  1FR7 A;  4MLT A;  1KEQ A;  4WW8 A;  3KWA A;  2WEH A;  3RZ7 A;  4Q09 A;  2HNC A;  4MDM A;  2HL4 A;  3KS3 A;  3K7K A;  5DSQ A;  2NNS A;  3F4X A;  3QYK A;  5FDI A;  2ZNC A;  2HKK A;  4MTY A;  3BET A;  3M3X A;  1G1D A;  3U3A X;  4YGF A;  4MDG A;  2NNV A;  5G01 A;  5DSI A;  3M1K A;  1G45 A;  3M2X A;  3T83 A;  4PQ7 A;  5BRW A;  3DAZ A;  3KLD B;  4RUX A;  4FPT A;  1A42 A;  4K13 A;  4TWL A;  3M5E A;  1CA3 A;  5J8Z A;  4M2U A;  4RUY A;  1JD0 A;  4E3F A;  4QJ0 A;  2X7U A;  3JXG A;  1DMY A;  4Y0J A;  2ILI A;  3DBU A;  3K2F A;  1CAO A;  3VBD A;  2NXS A;  3IBL A;  5DSR A;  5AML A;  5LMD A;  1MOO A;  1CAH A;  3M67 A;  3RZ0 B;  3W6H A;  4FIK A;  3CA2 A;  4M2R A;  1IF9 A;  4ETQ C;  2FNK A;  4QJP A;  3P5L A;  1G54 A;  2NWY A;  3MYQ A;  1FSQ A;  4Q6D A;  3P58 A;  5G0B A;  1CVH A;  1CZM A;  4Q7V A;  3V5G A;  2NXT A;  1CIL A;  5JEH B;  3U47 A;  3ZP9 A;  1FLJ A;  1BN4 A;  4FL7 A;  3UYQ A;  4QIY A;  4QIZ A;  3KNE A;  2QOA A;  3V2M A;  1BZM A;  1TBT X;  1URT A;  3T82 A;  1CNC A;  3P44 A;  3ML5 A;  3D0N A;  5EHV A;  4KNM A;  4E3H A;  3CZV A;  4CNX A;  5CAC A;  4Q08 A;  3MWO A;  1V9E A;  4X5S A;  3U7C A;  4BCW A;  3DD0 A;  5FNI A;  2EU2 A;  3V3I B;  2Q38 A;  5DSP A;  3FFP X;  3T84 A;  3N2P A;  4Q49 A;  4QJW A;  3MNJ A;  5SZ3 A;  1FQL A;  1T9N A;  3RYX B;  3V7X A;  5EH7 A;  1LG5 A;  1RAY A;  4HEY A;  1G46 A;  1G6V A;  1RZA A;  1V9I C;  4HEZ A;  2HOC A;  4DZ7 A;  5JDV B;  1G0F A;  4CA2 A;  1BNT A;  2CBA A;  2AW1 A;  4WW6 A;  4QEF A;  3RLD A;  4PYY A;  12CA A;  3S77 B;  1BNM A;  3TVO X;  4ZWZ A;  1BNV A;  5FNG A;  4RN4 A;  5AMD A;  4DZ9 A;  2CBD A;  2WEG A;  4MDL A;  3CYU A;  5FLP A;  2NXR A;  4K0S A;  5EHW A;  5EOI A;  1CA2 A;  2CBE A;  4E3G A;  4Q8Y A;  4YXO A;  1THK A;  4K0Z A;  1H9N A;  3V2J A;  3SBH A;  2AX2 A;  4ZAO A;  4KAP A;  5EH8 A;  5FLO A;  5SZ7 A;  2WD2 A;  2FW4 A;  1G4J A;  1CVC A;  5SZ2 A;  3M1J A;  4KP8 A;  2O4Z A;  4ZWI A;  4KP5 A;  5FNH A;  4QJO A;  3D9Z A;  4G0C A;  4Q8Z A;  2QP6 A;  5JG3 B;  3MHO A;  5DRS A;  1XQ0 A;  4XFW A;  1ZFK A;  8CA2 A;  3S76 A;  4HT2 A;  5DSJ A;  2NMX A;  1CNW A;  3N3J A;  3DVC A;  4YX4 A;  1CAM A;  1CAI A;  4MO8 A;  1IF4 A;  3HKN A;  4RFC A;  4E3D A;  1CIN A;  4RFD A;  1Z93 A;  3P3J A;  3RG4 A;  3S72 B;  4FRC A;  3M2N A;  2FOS A;  1TG3 A;  3V3G B;  3P3H A;  2EU3 A;  4L5V A;  1IF5 A;  1CNB A;  3DC9 A;  3IBN A;  1KWQ A;  3TMJ A;  3ZNC A;  3OY0 A;  4QJX A;  1CIM A;  1CCU A;  4JS6 A;  4CAC A;  3T5Z A;  4PZH A;  4RUZ A;  1CAL A;  2X7S A;  3OIM A;  3S75 B;  2POU A;  2X7T A;  5E5U A;  4ZX1 A;  5CA2 A;  1ZSA A;  2FOQ A;  4ITO A;  5HPJ A;  7CA2 A;  3DC3 A;  3PJJ A;  4QTL A;  3HKQ A;  3M2Z A;  3DD8 A;  3N0N A;  3OYQ A;  3FE4 A;  3IBU A;  1BV3 A;  1BCD A;  5E5R A;  4FU5 A;  5SZ5 A;  3OKU A;  5JEG B;  5BRV A;  5BYI A;  3OYS A;  1YDC A;  1RJ6 A;  5FL4 A;  4Q87 A;  4QJM A;  5FL5 A;  1UGE A;  4K0T A;  3S73 B;  1CRM A;  4Q99 A;  3U45 X;  5JGS B;  1TEQ X;  1G52 A;  1LZV A;  1ZSC A;  2GEH A;  4YVY A;  4Q0L A;  4LU3 A;  3S8X A;  5CLU A;  4CQ0 A;  3KOI A;  1BNN A;  5JEP B;  5JQ0 A;  1TE3 X;  5FNL A;  4E5Q A;  1J9W A;  5L6K A;  3NB5 A;  4M2V A;  3MZC A;  3K34 A;  1XEG A;  3P4V A;  5DOH A;  3V3H B;  1ZNC A;  4Q6E A;  4IWZ A;  1BNW A;  1RJ5 A;  2NWZ A;  4LHI A;  5EIJ A;  1CNK A;  4PXX A;  2F14 A;  1RZB A;  1UGC A;  1OKN A;  2FNM A;  4Q7P A;  1UGF A;  4QSA A;  4RIU A;  3RZ5 A;  1RZE A;  4YYT A;  2FOU A;  3NI5 A;  3OIK A;  4HT0 A;  2FOY A;  1YDA A;  1CAJ A;  3JXF A;  1HVA A;  2CBB A;  4MLX A;  5BRU A;  3RZ1 B;  1Z97 A;  3MMF A;  3EFT A;  4WUQ A;  4HBA A;  4KNN A;  3D93 A;  1CVF A;  1ZSB A;  5EHE A;  1CVD A;  3F7U A;  3HLJ A;  4KV0 A;  1AM6 A;  5SZ4 A;  1KOQ A;  4WR7 A;  4E9O X;  3P55 A;  1TG9 A;  1I8Z A;  4Z1J A;  3S97 A;  3S9T A;  2CBC A;  4KUY A;  1IF8 A;  5E2S A;  4C3T A;  1I90 A;  5SZ6 A;  3MNK A;  3F7B A;  3MHI A;  3M98 A;  3ML2 A;  2NN7 A;  3OIL A;  4R5A A;  4Q90 A;  9CA2 A;  3M04 A;  4JSW A;  2VVA X;  1I91 A;  1CNI A;  3M14 A;  1FSN A;  2HD6 A;  1TTM A;  1CAK A;  1ZGE A;  3HFP A;  4JSA A;  4XIX A;  5JG5 B;  4Q06 A;  2FNN A;  3M1Q A;  2W2J A;  2Q1Q A;  2WD3 A;  3SAP A;  3BL0 A;  3M1W A;  3RYY A;  4R59 A;  5EH5 A;  3T85 A;  3F8E A;  5JQT A;  1CNG A;  2WEO A;  3NJ9 A;  1H9Q A;  4Q7W A;  4QSJ A;  3S71 B;  3P5A A;  2NNO A;  4FVN A;  1CVB A;  4QSI A;  1KWR A;  5DSL A;  1YO0 A;  2H15 A;  3KIG A;  4QK2 A;  1TEU X;  5G0C A;  1ZFQ A;  3M96 A;  1HED A;  4K1Q A;  3V3J A;  6CA2 A;  1CNJ A;  3M5S A;  4HU1 A;  1UGA A;  5CJF A;  1TH9 A;  4BF6 A;  1CRA A;  1DCB A;  4N16 A;  1I9O A;  1CVA A;  3OKV A;  3MNU A;  1FR4 A;  1YDD A;  3R17 B;  5FNJ A;  4HEW A;  1UGG A;  5EKH A;  3B4F A;  1RZD A;  2VVB X;  3PO6 A;  3MHC A;  5A25 A;  1I9P A;  5EKM A;  3C7P A;  2POV A;  4ITP A;  1I9N A;  3M2Y A;  2CA2 A;  3SBI A;  1ZE8 A;  1IF7 A;  3M40 A;  1H4N A;  3FW3 A;  2QO8 A;  4YXI A;  4UOV A;  1CAN A;  1RAZ A;  1HCB A;  3Q31 A;  5DSM A;  1ZGF A;  5E28 A;  1CCT A;  1HUH A;  4XZ5 A;  3S78 B;  1BN3 A;  4PYX A;  3V3F A;  1CNX A;  4Q07 A;  4R5B A;  3M5T A;  4CNV A;  4M2W A;  3DCS A;  2POW A;  1UGD A;  3MDZ A;  5FDC A;  1Y7W A;  5FLR A;  2FMG A;  4CNR A;  3D92 A;  3RZ8 A;  3KON A;  1CAY A;  1G3Z A;  1CNY A;  3BL1 A;  4ZX0 A;  3CAJ A;  5E2N A;  4YHA A;  3DA2 A;  2HFW A;  2H4N A;  5FLT A;  4QK1 A;  1CAZ A;  4QY3 A;  3PYK A;  1HEB A;  4QSB A;  4ILX A;  3RYV B;  4ZWY A;  1BIC A;  3HKU A;  3B1B A;  5E2M A;  1G53 A;  4RH2 A;  1OKM A;  3RYZ A;  3IBI A;  1FQR A;  4BF1 A;  1XEV A;  4E49 A;  4TWM A;  3TVN X;  4LP6 A;  4L5U A;  4RIV A;  4YGK A;  5JES B;  1BNQ A;  1G48 A;  3DVD A;  3JXH C;  1RZC A;  1G0E A;  1FQM A;  1FQN A;  3EFI A;  2NWO A;  3IGP A;  1AZM A;  3DV7 A;  4YGL A;  4Q78 A;  5DOG A;  1IF6 A;  3GZ0 A;  4WUP A;  5SZ0 A;  3S74 B;  4IDR X;  1HUG A;  3MHL A;  5FLQ A;  4KNJ A;  3MNI A;  3T5U A;  5FNM A;  4KNI A;  3R16 A;  3DVB A;  2Q1B A;  3N4B A;  5SZ1 A;  1I9L A;  3LXE A;  1CVE A;  3RGE A;  1DMX A;  4E4A A;  5C8I A;  3DCC A;  1G4O A;  1YDB A;  5JGT B;  1YO2 A;  4Z0Q A;  1HCA A;  3DCW A;  3MNH A;  4KUV A;  2NWP A;  5FLS A;  1DCA A;  2OSF A;  4XIW A;  5DVX A;  1UGB A;  1F2W A;  4YXU A;  2NNG A;  4CNW A;  2IT4 A;  4Q8X A;  4KUW A;  2FMZ A;  4N0X B;  1BNU A;  5E2K A;  4QK3 A;  1Z9Y A;  2WEJ A;  3L14 A;  4YWP A;  5EZT X;  5AMG A;  4Z1N A;  1ZH9 A;  1AVN A;  4G7A A;  4YGJ A;  1CNH A;  1CCS A;  2CAB A;  4L5W A;  5FL6 A;  4XE1 A;  5L3O A;  3W6I A;  4COQ A;  5E2R A;  5BNL A;  1LG6 A;  3HKT A;  3IEO A;  3KOK A;  3SAX A;  1JV0 A;  5G03 A;  1MUA A;  4HF3 A;  5A6H A;  1KOP A;  2NN1 A;  5DSN A;  5EKJ A;  3RJ7 A;  4Q9Y A;  4JSZ A;  5DSK A;  3KKX A;  1I9M A;  5IPZ A;  4Z1E A;  3UYN A;  3D8W A;  1HEC A;  3HS4 A;  1I9Q A;  1YO1 A;  2EZ7 A;  1XPZ A;  1HEA A;  4GL1 X;  1JCZ A;  1FSR A;  1TB0 X;  4Z1K A;  1BN1 A;  3RG3 A;  4YGN A;  3MHM A;  4WL4 A;  4ZWX A;  2FOV A;  2ABE A;  3MNA A;  4Q7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...