1DL6A

Solution structure of human tfiib n-terminal domain
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a (Cys3His) zinc ribbon, a ubiquitous motif in archaeal and eucaryal transcription.
pubmed rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords TRANSCRIPTION FACTOR II B (TFIIB)
total genus 2
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1dl6A00
4A3LI 4A3GI 1K83I 3GTGI 3GKQA 2B63I 4NBGA 2K5RA 3Q87A 3D6WA 1N2FA 5CM2M 4NB8A 5IP7I 3HOWI 1L1OC 3S16I 3I4MI 4NBHA 1PFTA 2F4MA 3S1QI 3H0GI 2JR6A 1Y1VI 3S2HI 4Y52I 4NBFA 3HOZI 5IP9I 3HOXI 1TWCI 1WCMI 1WW9A 2VUMI 3K7AI 2F4OA 1VLAA 4A93I 4A3II 1ZB8A 1X3ZA 1QYPA 2R7ZI 1USPB 5C44I 4NOZA 1ML8A 2HF1A 3PO3I 3VMIA 2DE6A 2R92I 4NBCA 5FLMI 3M4OI 1I50I 3I07A 4A3JI 2E2JI 1X3WA 2KPIA 4BY7I 2JNYA 4BY1I 3GCFA 3GTQI 1SFOI 1DL6A 1Y1VS 1ZB9A 3GTPI 3S1MI 3S1NI 3GTKI 2BJOA 1Y1WI 1RO4A 4A3EI 4BBRI 2PK7A 5C4JI 4NBDA 3HOUI 1LQLA 3GTJI 3M3YI 5C4XI 3S15I 1NUIA 4NBBA 3EERA 4A3DI 4A3CI 1I3QI 4NB9A 4BXXI 4X6AI 4A3KI 3GTLI 2E2II 3S14I 4NBAA 3U50C 3FKII 5C3EI 3RZOI 1R9TI 3GTMI 2NVYI 4MH4A 3I4NI 4A3FI 2JA7I 3VMGA 3ESWA 1I6HI 3LUSA 2JA6I 3GTMS 3VMHA 2R93I 1YUAA 2JA8I 4QTTA 2DE7A 1USPA 4BBSI 3CQZI 1RLYA 3HOYI 2DE5A 3RZDI 2NVTI 4NBEA 1TWGI 2J6AA 1TWHI 3S17I 2P3YA 3S1RI 2JA5I 1TWAI 2YU9I 2JS4A 3PO3S 4QTUA 1TWFI 4A3BI 2RBLA 3PO2I 2NVQI 4Y7NI 3GTOI 4A3MI 1TFIA 2NVXI 2E2HI 3HOVI 3S2DI 4XX2A 3VB9A 3H3VJ 2AKLA
chains in the Genus database with same CATH superfamily
4A3GI 1K83I 1YUKA 2Q51A 2V8KA 2RPRA 3FQMA 5CM2M 1KD11 3HOWI 1YJW1 3I4MI 1PFTA 5LL6f 4Y52I 1W2BY 1K8A2 1K9M2 1YI21 3HOXI 1TWCI 1WW9A 2VUMI 1VLAA 1X3ZA 2QA4Z 1QYPA 2OZKA 2R7ZI 1QF8A 2LIYA 4S1TA 2VPWA 3CCJ1 3CCSZ 4HH4A 2JIRA 3KIHA 4AYBA 3JAMb 2JUBA 1SIWA 3G4S1 2KPIA 3CC7Z 3GTQI 2LEXA 1SFOI 3CCVZ 1Z02A 3S1MI 2VUGA 3S1NI 1RO4A 2JIMA 2RT9A 1KQSZ 4E2XA 1KRLA 1LQLA 2Y0SA 4E2ZA 3TE5B 3M3YI 1M901 2QA41 5FLXb 1NUIA 4NB9A 1NJI1 3GTLI 3S14I 4NFRA 2OTJZ 3RZOI 1QXFA 4MH4A 3I4NI 3NH8A 1VQM1 2V3VA 3ESWA 1I6HI 1NP6A 1VQMZ 3GTMS 3VMHA 3EEDA 1VQ61 1VQ6Z 2JA8I 4QTTA 2O4HA 3CD6Z 2I3CA 4MRIA 1RLYA 3HOYI 3I551 3J80f 2E9HA 2J6AA 2QRDB 1VQ8Z 1TWHI 4E32A 2JA5I 3CMEZ 2JS4A 2RBLA 4DK1A 1K8A1 1VQ71 4Y7NI 1K9M1 5D1OA 3IFUA 3CMAZ 1Y8CA 3S2DI 3CCU1 2GTHA 2AKLA 1YI2Z 2O53A 4NBGA 1M902 3J81f 3D6WA 1RNIA 5T6BA 5T64A 4DGLA 1FDOA 3G6E1 1YJ9Z 1W2BZ 1L1OC 4HGYA 3CCJZ 3CCS1 2F4MA 3H0GI 1KD12 1Q16A 1Z01A 4MD9A 3CC2Z 2F4OA 5D1OB 1ZB8A 2IZ3A 3CD61 1USPB 1RQFA 1ML8A 2HF1A 2V45A 1YJWZ 3PO3I 2R92I 1I50I 1NJI2 2P28A 1X3WA 3CXCY 4BY7I 2WB1A 3IR7A 2OTJ1 3GCFA 4RVHA 3MZKB 2KI7B 1ZB9A 2VPZA 3CCM1 3GTKI 4HGZA 3CCR1 1Q821 1M1K1 5C4JI 3HOUI 2RHBA 1VQP1 2RIQA 4RVGA 3F3FC 1VQ4Z 2H85A 4TNUA 1RO0A 2M48A 4E31A 3EERA 3D2LA 2QEXZ 4X6AI 1YITZ 1S7MA 2K3RA 2VF1A 2WAQA 4MD8A 1QVGY 2JIPA 3GTMI 2NVYI 2R6MA 2JA7I 3LUSA 2VPYA 1QVFZ 2JA6I 2R93I 4BBSI 3CQZI 3MONA 1Q861 2NVTI 3J7A4 1N8R2 1YJ91 2P3YA 3S1RI 1S721 5A2Qf 4RV9A 4CL1A 5D1PA 1QVGZ 4NH1C 1VQK1 4A3MI 3CC4Z 1TFIA 2OTL1 2E2HI 2QKDA 3HOVI 2VPXA 1VQO1 1Q822 2V8IA 3CC41 1VQKZ 3H3VJ 1RO2A 3GTGI 3GKQA 2B63I 3Q87A 5IT9b 1FDIA 1N2FA 5T67A 1VQ9Z 2JIOA 4RS4A 5IP7I 1YJNZ 1YJN1 3CCE1 1Y1VI 3S2HI 1WIIA 1Q7Y2 1YIT1 2QEX1 1YIJ1 3K7AI 4A93I 2OTLZ 3G711 2AYDA 1M1K2 2QRCB 1YIJZ 2YADA 2QLVB 4NOZA 3CPWY 4EWCA 1KC82 2DE6A 4NBCA 5FLMI 2OOYB 4A3JI 1VQ41 2G2KA 2PMZA 4MONA 3CCEZ 1DL6A 3CCRZ 3P5JB 1Y1VS 3I561 2IZ4A 2OOXB 2BJOA 1Y1WI 3I55Z 1Z03A 4BBRI 4NBDA 4E30A 2E7ZA 1YHQZ 1Q862 3NH5A 3S15I 4BXXI 1I3QI 4A3KI 2IV2X 2NAPA 4E2YA 2JMOA 2M6NA 3CCL1 1R9TI 3D9XA 1VQLZ 1Q7Y1 3OW2Y 4A3FI 3VMGA 3FQQA 3CCMZ 2DE7A 1USPA 3CCLZ 3T4NB 1KC81 3NDJA 1TWGI 3S17I 3CCQ1 1N8R1 3CC21 2NVQI 3NH4A 3GTOI 1K732 3CXCZ 1KQSY 3CMA1 3BG1B 3QWUA 1YHQ1 1VQ91 1P9NA 4A3LI 4MXUA 2K5RA 4DQYB 3J80b 3CME1 3JAMf 3I56Z 3IX0A 4NB8A 2EGTA 3S16I 5A2Qb 4NBHA 3G6EZ 3S1QI 2JR6A 4RVDA 1VQ5Z 4NBFA 4RVFA 2W04A 3HOZI 3CCQZ 2PM9A 5IP9I 1X0TA 2HU9A 1WCMI 1VQOZ 1WZNA 4A3II 3J81b 1S72Z 2LFUA 1VQ51 1QVFY 1JWHC 3MZLB 5C44I 4E2WA 3VMIA 3OW2Z 3M4OI 3I07A 5FLXf 1VQ7Z 2JNYA 4BY1I 1VQNZ 3TDHB 3F3PC 1WJ2A 1K731 3KIFA 3NFZA 2GU2A 3G4SZ 1Q811 1VQ81 3GTPI 2ZAEB 4A3EI 2PK7A 3VTNA 5AN9F 3CCUZ 2V8JA 2GTIA 3GTJI 5C4XI 2QR1B 4NBBA 3BG0B 2JIQA 4A3CI 4A3DI 2E2II 4NBAA 3U50C 1JJ2Y 3FKII 5C3EI 1VQPZ 3IF8A 4E33A 3NDIA 1VQL1 2W03A 3CC71 1YUAA 2QREB 3HKZA 3G71Z 2DE5A 3RZDI 2Q4ZA 1ZH1A 4NBEA 3CPWZ 5IT9f 3CCV1 1TWAI 2YU9I 3PO3S 4QTUA 1TWFI 4A3BI 1VQN1 3PO2I 1Q812 4MD7A 2NVXI 1AA6A 1JJ2Z 4XX2A 3VB9A 2E2JI
chains in the Genus database with same CATH topology
4A3GI 1K83I 1YUKA 2Q51A 2V8KA 2RPRA 3FQMA 5CM2M 1KD11 3HOWI 1YJW1 3I4MI 1PFTA 5LL6f 4Y52I 1W2BY 1K8A2 1K9M2 1YI21 3HOXI 1TWCI 1WW9A 2VUMI 1VLAA 1X3ZA 2QA4Z 1QYPA 2OZKA 2R7ZI 1QF8A 2LIYA 4S1TA 3CCJ1 3CCSZ 4HH4A 3KIHA 4AYBA 3JAMb 2JUBA 3G4S1 2KPIA 3CC7Z 3GTQI 1SFOI 3CCVZ 1Z02A 3S1MI 2VUGA 3S1NI 1RO4A 2RT9A 1KQSZ 4E2XA 1KRLA 1LQLA 2Y0SA 4E2ZA 3TE5B 3M3YI 1M901 2QA41 5FLXb 1NUIA 4NB9A 1NJI1 3GTLI 3S14I 4NFRA 2OTJZ 3RZOI 4MH4A 3I4NI 3NH8A 1VQM1 3ESWA 1I6HI 1NP6A 1VQMZ 3GTMS 3VMHA 3EEDA 1VQ61 1VQ6Z 2JA8I 4QTTA 2O4HA 3CD6Z 2I3CA 4MRIA 1RLYA 3HOYI 3I551 3J80f 2E9HA 2J6AA 2QRDB 1VQ8Z 1TWHI 4E32A 2JA5I 3CMEZ 2JS4A 2RBLA 4DK1A 1K8A1 1VQ71 4Y7NI 1K9M1 5D1OA 3IFUA 3CMAZ 3S2DI 3CCU1 2GTHA 2AKLA 1YI2Z 2O53A 4NBGA 1M902 3J81f 3D6WA 1RNIA 5T6BA 5T64A 4DGLA 3G6E1 1YJ9Z 1W2BZ 1L1OC 4HGYA 3CCJZ 3CCS1 2F4MA 3H0GI 1KD12 1Z01A 4MD9A 3CC2Z 2F4OA 5D1OB 1ZB8A 2IZ3A 3CD61 1USPB 1RQFA 1ML8A 2HF1A 1YJWZ 3PO3I 2R92I 1I50I 1NJI2 2P28A 1X3WA 3CXCY 4BY7I 2WB1A 2OTJ1 3GCFA 4RVHA 3MZKB 2KI7B 1ZB9A 3CCM1 3GTKI 4HGZA 3CCR1 1Q821 1M1K1 5C4JI 3HOUI 2RHBA 1VQP1 2RIQA 4RVGA 3F3FC 1VQ4Z 2H85A 4TNUA 1RO0A 2M48A 4E31A 3EERA 2QEXZ 4X6AI 1YITZ 1S7MA 2K3RA 2VF1A 2WAQA 4MD8A 1QVGY 3GTMI 2NVYI 2R6MA 2JA7I 3LUSA 1QVFZ 2JA6I 2R93I 4BBSI 3CQZI 3MONA 1Q861 2NVTI 3J7A4 1N8R2 1YJ91 2P3YA 3S1RI 1S721 5A2Qf 4RV9A 4CL1A 5D1PA 1QVGZ 4NH1C 1VQK1 4A3MI 3CC4Z 1TFIA 2OTL1 2E2HI 2QKDA 3HOVI 1VQO1 1Q822 2V8IA 3CC41 1VQKZ 3H3VJ 1RO2A 3GTGI 3GKQA 2B63I 3Q87A 5IT9b 1N2FA 5T67A 1VQ9Z 4RS4A 5IP7I 1YJNZ 1YJN1 3CCE1 1Y1VI 3S2HI 1WIIA 1Q7Y2 1YIT1 2QEX1 1YIJ1 3K7AI 4A93I 2OTLZ 3G711 1M1K2 2QRCB 1YIJZ 2YADA 2QLVB 4NOZA 3CPWY 4EWCA 1KC82 2DE6A 4NBCA 5FLMI 2OOYB 4A3JI 1VQ41 2G2KA 2PMZA 4MONA 3CCEZ 1DL6A 3CCRZ 3P5JB 1Y1VS 3I561 2IZ4A 2OOXB 2BJOA 1Y1WI 3I55Z 1Z03A 4BBRI 4NBDA 4E30A 1YHQZ 1Q862 3NH5A 3S15I 4BXXI 1I3QI 4A3KI 4E2YA 2JMOA 2M6NA 3CCL1 1R9TI 3D9XA 1VQLZ 1Q7Y1 3OW2Y 4A3FI 3VMGA 3FQQA 3CCMZ 2DE7A 1USPA 3CCLZ 3T4NB 1KC81 3NDJA 1TWGI 3S17I 3CCQ1 1N8R1 3CC21 2NVQI 3NH4A 3GTOI 1K732 3CXCZ 1KQSY 3CMA1 3BG1B 3QWUA 1YHQ1 1VQ91 1P9NA 4A3LI 4MXUA 2K5RA 4DQYB 3J80b 3CME1 3JAMf 3I56Z 3IX0A 4NB8A 2EGTA 3S16I 5A2Qb 4NBHA 3G6EZ 3S1QI 2JR6A 4RVDA 1VQ5Z 4NBFA 4RVFA 2W04A 3HOZI 3CCQZ 2PM9A 5IP9I 1X0TA 2HU9A 1WCMI 1VQOZ 4A3II 3J81b 1S72Z 2LFUA 1VQ51 1QVFY 1JWHC 3MZLB 5C44I 4E2WA 3VMIA 3OW2Z 3M4OI 3I07A 5FLXf 1VQ7Z 2JNYA 4BY1I 1VQNZ 3TDHB 3F3PC 1K731 3KIFA 3NFZA 2GU2A 3G4SZ 1Q811 1VQ81 3GTPI 2ZAEB 4A3EI 2PK7A 3VTNA 5AN9F 3CCUZ 2V8JA 2GTIA 3GTJI 5C4XI 2QR1B 4NBBA 3BG0B 4A3DI 4A3CI 2E2II 4NBAA 3U50C 1JJ2Y 3FKII 5C3EI 1VQPZ 3IF8A 4E33A 3NDIA 1VQL1 2W03A 3CC71 1YUAA 2QREB 3HKZA 3G71Z 2DE5A 3RZDI 2Q4ZA 1ZH1A 4NBEA 3CPWZ 5IT9f 3CCV1 1TWAI 2YU9I 3PO3S 4QTUA 1TWFI 4A3BI 1VQN1 3PO2I 1Q812 4MD7A 2NVXI 1JJ2Z 4XX2A 3VB9A 2E2JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L I;  4A3G I;  1K83 I;  3GTG I;  3GKQ A;  2B63 I;  4NBG A;  2K5R A;  3Q87 A;  3D6W A;  1N2F A;  5CM2 M;  4NB8 A;  5IP7 I;  3HOW I;  1L1O C;  3S16 I;  3I4M I;  4NBH A;  1PFT A;  2F4M A;  3S1Q I;  3H0G I;  2JR6 A;  1Y1V I;  3S2H I;  4Y52 I;  4NBF A;  3HOZ I;  5IP9 I;  3HOX I;  1TWC I;  1WCM I;  1WW9 A;  2VUM I;  3K7A I;  2F4O A;  1VLA A;  4A93 I;  4A3I I;  1ZB8 A;  1X3Z A;  1QYP A;  2R7Z I;  1USP B;  5C44 I;  4NOZ A;  1ML8 A;  2HF1 A;  3PO3 I;  3VMI A;  2DE6 A;  2R92 I;  4NBC A;  5FLM I;  3M4O I;  1I50 I;  3I07 A;  4A3J I;  2E2J I;  1X3W A;  2KPI A;  4BY7 I;  2JNY A;  4BY1 I;  3GCF A;  3GTQ I;  1SFO I;  1DL6 A;  1Y1V S;  1ZB9 A;  3GTP I;  3S1M I;  3S1N I;  3GTK I;  2BJO A;  1Y1W I;  1RO4 A;  4A3E I;  4BBR I;  2PK7 A;  5C4J I;  4NBD A;  3HOU I;  1LQL A;  3GTJ I;  3M3Y I;  5C4X I;  3S15 I;  1NUI A;  4NBB A;  3EER A;  4A3D I;  4A3C I;  1I3Q I;  4NB9 A;  4BXX I;  4X6A I;  4A3K I;  3GTL I;  2E2I I;  3S14 I;  4NBA A;  3U50 C;  3FKI I;  5C3E I;  3RZO I;  1R9T I;  3GTM I;  2NVY I;  4MH4 A;  3I4N I;  4A3F I;  2JA7 I;  3VMG A;  3ESW A;  1I6H I;  3LUS A;  2JA6 I;  3GTM S;  3VMH A;  2R93 I;  1YUA A;  2JA8 I;  4QTT A;  2DE7 A;  1USP A;  4BBS I;  3CQZ I;  1RLY A;  3HOY I;  2DE5 A;  3RZD I;  2NVT I;  4NBE A;  1TWG I;  2J6A A;  1TWH I;  3S17 I;  2P3Y A;  3S1R I;  2JA5 I;  1TWA I;  2YU9 I;  2JS4 A;  3PO3 S;  4QTU A;  1TWF I;  4A3B I;  2RBL A;  3PO2 I;  2NVQ I;  4Y7N I;  3GTO I;  4A3M I;  1TFI A;  2NVX I;  2E2H I;  3HOV I;  3S2D I;  4XX2 A;  3VB9 A;  3H3V J;  2AKL A; 
#chains in the Genus database with same CATH topology
 4A3G I;  1K83 I;  1YUK A;  2Q51 A;  2V8K A;  2RPR A;  3FQM A;  5CM2 M;  1KD1 1;  3HOW I;  1YJW 1;  3I4M I;  1PFT A;  5LL6 f;  4Y52 I;  1W2B Y;  1K8A 2;  1K9M 2;  1YI2 1;  3HOX I;  1TWC I;  1WW9 A;  2VUM I;  1VLA A;  1X3Z A;  2QA4 Z;  1QYP A;  2OZK A;  2R7Z I;  1QF8 A;  2LIY A;  4S1T A;  2VPW A;  3CCJ 1;  3CCS Z;  4HH4 A;  2JIR A;  3KIH A;  4AYB A;  3JAM b;  2JUB A;  1SIW A;  3G4S 1;  2KPI A;  3CC7 Z;  3GTQ I;  2LEX A;  1SFO I;  3CCV Z;  1Z02 A;  3S1M I;  2VUG A;  3S1N I;  1RO4 A;  2JIM A;  2RT9 A;  1KQS Z;  4E2X A;  1KRL A;  1LQL A;  2Y0S A;  4E2Z A;  3TE5 B;  3M3Y I;  1M90 1;  2QA4 1;  5FLX b;  1NUI A;  4NB9 A;  1NJI 1;  3GTL I;  3S14 I;  4NFR A;  2OTJ Z;  3RZO I;  1QXF A;  4MH4 A;  3I4N I;  3NH8 A;  1VQM 1;  2V3V A;  3ESW A;  1I6H I;  1NP6 A;  1VQM Z;  3GTM S;  3VMH A;  3EED A;  1VQ6 1;  1VQ6 Z;  2JA8 I;  4QTT A;  2O4H A;  3CD6 Z;  2I3C A;  4MRI A;  1RLY A;  3HOY I;  3I55 1;  3J80 f;  2E9H A;  2J6A A;  2QRD B;  1VQ8 Z;  1TWH I;  4E32 A;  2JA5 I;  3CME Z;  2JS4 A;  2RBL A;  4DK1 A;  1K8A 1;  1VQ7 1;  4Y7N I;  1K9M 1;  5D1O A;  3IFU A;  3CMA Z;  1Y8C A;  3S2D I;  3CCU 1;  2GTH A;  2AKL A;  1YI2 Z;  2O53 A;  4NBG A;  1M90 2;  3J81 f;  3D6W A;  1RNI A;  5T6B A;  5T64 A;  4DGL A;  1FDO A;  3G6E 1;  1YJ9 Z;  1W2B Z;  1L1O C;  4HGY A;  3CCJ Z;  3CCS 1;  2F4M A;  3H0G I;  1KD1 2;  1Q16 A;  1Z01 A;  4MD9 A;  3CC2 Z;  2F4O A;  5D1O B;  1ZB8 A;  2IZ3 A;  3CD6 1;  1USP B;  1RQF A;  1ML8 A;  2HF1 A;  2V45 A;  1YJW Z;  3PO3 I;  2R92 I;  1I50 I;  1NJI 2;  2P28 A;  1X3W A;  3CXC Y;  4BY7 I;  2WB1 A;  3IR7 A;  2OTJ 1;  3GCF A;  4RVH A;  3MZK B;  2KI7 B;  1ZB9 A;  2VPZ A;  3CCM 1;  3GTK I;  4HGZ A;  3CCR 1;  1Q82 1;  1M1K 1;  5C4J I;  3HOU I;  2RHB A;  1VQP 1;  2RIQ A;  4RVG A;  3F3F C;  1VQ4 Z;  2H85 A;  4TNU A;  1RO0 A;  2M48 A;  4E31 A;  3EER A;  3D2L A;  2QEX Z;  4X6A I;  1YIT Z;  1S7M A;  2K3R A;  2VF1 A;  2WAQ A;  4MD8 A;  1QVG Y;  2JIP A;  3GTM I;  2NVY I;  2R6M A;  2JA7 I;  3LUS A;  2VPY A;  1QVF Z;  2JA6 I;  2R93 I;  4BBS I;  3CQZ I;  3MON A;  1Q86 1;  2NVT I;  3J7A 4;  1N8R 2;  1YJ9 1;  2P3Y A;  3S1R I;  1S72 1;  5A2Q f;  4RV9 A;  4CL1 A;  5D1P A;  1QVG Z;  4NH1 C;  1VQK 1;  4A3M I;  3CC4 Z;  1TFI A;  2OTL 1;  2E2H I;  2QKD A;  3HOV I;  2VPX A;  1VQO 1;  1Q82 2;  2V8I A;  3CC4 1;  1VQK Z;  3H3V J;  1RO2 A;  3GTG I;  3GKQ A;  2B63 I;  3Q87 A;  5IT9 b;  1FDI A;  1N2F A;  5T67 A;  1VQ9 Z;  2JIO A;  4RS4 A;  5IP7 I;  1YJN Z;  1YJN 1;  3CCE 1;  1Y1V I;  3S2H I;  1WII A;  1Q7Y 2;  1YIT 1;  2QEX 1;  1YIJ 1;  3K7A I;  4A93 I;  2OTL Z;  3G71 1;  2AYD A;  1M1K 2;  2QRC B;  1YIJ Z;  2YAD A;  2QLV B;  4NOZ A;  3CPW Y;  4EWC A;  1KC8 2;  2DE6 A;  4NBC A;  5FLM I;  2OOY B;  4A3J I;  1VQ4 1;  2G2K A;  2PMZ A;  4MON A;  3CCE Z;  1DL6 A;  3CCR Z;  3P5J B;  1Y1V S;  3I56 1;  2IZ4 A;  2OOX B;  2BJO A;  1Y1W I;  3I55 Z;  1Z03 A;  4BBR I;  4NBD A;  4E30 A;  2E7Z A;  1YHQ Z;  1Q86 2;  3NH5 A;  3S15 I;  4BXX I;  1I3Q I;  4A3K I;  2IV2 X;  2NAP A;  4E2Y A;  2JMO A;  2M6N A;  3CCL 1;  1R9T I;  3D9X A;  1VQL Z;  1Q7Y 1;  3OW2 Y;  4A3F I;  3VMG A;  3FQQ A;  3CCM Z;  2DE7 A;  1USP A;  3CCL Z;  3T4N B;  1KC8 1;  3NDJ A;  1TWG I;  3S17 I;  3CCQ 1;  1N8R 1;  3CC2 1;  2NVQ I;  3NH4 A;  3GTO I;  1K73 2;  3CXC Z;  1KQS Y;  3CMA 1;  3BG1 B;  3QWU A;  1YHQ 1;  1VQ9 1;  1P9N A;  4A3L I;  4MXU A;  2K5R A;  4DQY B;  3J80 b;  3CME 1;  3JAM f;  3I56 Z;  3IX0 A;  4NB8 A;  2EGT A;  3S16 I;  5A2Q b;  4NBH A;  3G6E Z;  3S1Q I;  2JR6 A;  4RVD A;  1VQ5 Z;  4NBF A;  4RVF A;  2W04 A;  3HOZ I;  3CCQ Z;  2PM9 A;  5IP9 I;  1X0T A;  2HU9 A;  1WCM I;  1VQO Z;  1WZN A;  4A3I I;  3J81 b;  1S72 Z;  2LFU A;  1VQ5 1;  1QVF Y;  1JWH C;  3MZL B;  5C44 I;  4E2W A;  3VMI A;  3OW2 Z;  3M4O I;  3I07 A;  5FLX f;  1VQ7 Z;  2JNY A;  4BY1 I;  1VQN Z;  3TDH B;  3F3P C;  1WJ2 A;  1K73 1;  3KIF A;  3NFZ A;  2GU2 A;  3G4S Z;  1Q81 1;  1VQ8 1;  3GTP I;  2ZAE B;  4A3E I;  2PK7 A;  3VTN A;  5AN9 F;  3CCU Z;  2V8J A;  2GTI A;  3GTJ I;  5C4X I;  2QR1 B;  4NBB A;  3BG0 B;  2JIQ A;  4A3C I;  4A3D I;  2E2I I;  4NBA A;  3U50 C;  1JJ2 Y;  3FKI I;  5C3E I;  1VQP Z;  3IF8 A;  4E33 A;  3NDI A;  1VQL 1;  2W03 A;  3CC7 1;  1YUA A;  2QRE B;  3HKZ A;  3G71 Z;  2DE5 A;  3RZD I;  2Q4Z A;  1ZH1 A;  4NBE A;  3CPW Z;  5IT9 f;  3CCV 1;  1TWA I;  2YU9 I;  3PO3 S;  4QTU A;  1TWF I;  4A3B I;  1VQN 1;  3PO2 I;  1Q81 2;  4MD7 A;  2NVX I;  1AA6 A;  1JJ2 Z;  4XX2 A;  3VB9 A;  2E2J I; 
#chains in the Genus database with same CATH homology
 4A3G I;  1K83 I;  1YUK A;  2Q51 A;  2V8K A;  2RPR A;  3FQM A;  5CM2 M;  1KD1 1;  3HOW I;  1YJW 1;  3I4M I;  1PFT A;  5LL6 f;  4Y52 I;  1W2B Y;  1K8A 2;  1K9M 2;  1YI2 1;  3HOX I;  1TWC I;  1WW9 A;  2VUM I;  1VLA A;  1X3Z A;  2QA4 Z;  1QYP A;  2OZK A;  2R7Z I;  1QF8 A;  2LIY A;  4S1T A;  3CCJ 1;  3CCS Z;  4HH4 A;  3KIH A;  4AYB A;  3JAM b;  2JUB A;  3G4S 1;  2KPI A;  3CC7 Z;  3GTQ I;  1SFO I;  3CCV Z;  1Z02 A;  3S1M I;  2VUG A;  3S1N I;  1RO4 A;  2RT9 A;  1KQS Z;  4E2X A;  1KRL A;  1LQL A;  2Y0S A;  4E2Z A;  3TE5 B;  3M3Y I;  1M90 1;  2QA4 1;  5FLX b;  1NUI A;  4NB9 A;  1NJI 1;  3GTL I;  3S14 I;  4NFR A;  2OTJ Z;  3RZO I;  4MH4 A;  3I4N I;  3NH8 A;  1VQM 1;  3ESW A;  1I6H I;  1NP6 A;  1VQM Z;  3GTM S;  3VMH A;  3EED A;  1VQ6 1;  1VQ6 Z;  2JA8 I;  4QTT A;  2O4H A;  3CD6 Z;  2I3C A;  4MRI A;  1RLY A;  3HOY I;  3I55 1;  3J80 f;  2E9H A;  2J6A A;  2QRD B;  1VQ8 Z;  1TWH I;  4E32 A;  2JA5 I;  3CME Z;  2JS4 A;  2RBL A;  4DK1 A;  1K8A 1;  1VQ7 1;  4Y7N I;  1K9M 1;  5D1O A;  3IFU A;  3CMA Z;  3S2D I;  3CCU 1;  2GTH A;  2AKL A;  1YI2 Z;  2O53 A;  4NBG A;  1M90 2;  3J81 f;  3D6W A;  1RNI A;  5T6B A;  5T64 A;  4DGL A;  3G6E 1;  1YJ9 Z;  1W2B Z;  1L1O C;  4HGY A;  3CCJ Z;  3CCS 1;  2F4M A;  3H0G I;  1KD1 2;  1Z01 A;  4MD9 A;  3CC2 Z;  2F4O A;  5D1O B;  1ZB8 A;  2IZ3 A;  3CD6 1;  1USP B;  1RQF A;  1ML8 A;  2HF1 A;  1YJW Z;  3PO3 I;  2R92 I;  1I50 I;  1NJI 2;  2P28 A;  1X3W A;  3CXC Y;  4BY7 I;  2WB1 A;  2OTJ 1;  3GCF A;  4RVH A;  3MZK B;  2KI7 B;  1ZB9 A;  3CCM 1;  3GTK I;  4HGZ A;  3CCR 1;  1Q82 1;  1M1K 1;  5C4J I;  3HOU I;  2RHB A;  1VQP 1;  2RIQ A;  4RVG A;  3F3F C;  1VQ4 Z;  2H85 A;  4TNU A;  1RO0 A;  2M48 A;  4E31 A;  3EER A;  2QEX Z;  4X6A I;  1YIT Z;  1S7M A;  2K3R A;  2VF1 A;  2WAQ A;  4MD8 A;  1QVG Y;  3GTM I;  2NVY I;  2R6M A;  2JA7 I;  3LUS A;  1QVF Z;  2JA6 I;  2R93 I;  4BBS I;  3CQZ I;  3MON A;  1Q86 1;  2NVT I;  3J7A 4;  1N8R 2;  1YJ9 1;  2P3Y A;  3S1R I;  1S72 1;  5A2Q f;  4RV9 A;  4CL1 A;  5D1P A;  1QVG Z;  4NH1 C;  1VQK 1;  4A3M I;  3CC4 Z;  1TFI A;  2OTL 1;  2E2H I;  2QKD A;  3HOV I;  1VQO 1;  1Q82 2;  2V8I A;  3CC4 1;  1VQK Z;  3H3V J;  1RO2 A;  3GTG I;  3GKQ A;  2B63 I;  3Q87 A;  5IT9 b;  1N2F A;  5T67 A;  1VQ9 Z;  4RS4 A;  5IP7 I;  1YJN Z;  1YJN 1;  3CCE 1;  1Y1V I;  3S2H I;  1WII A;  1Q7Y 2;  1YIT 1;  2QEX 1;  1YIJ 1;  3K7A I;  4A93 I;  2OTL Z;  3G71 1;  1M1K 2;  2QRC B;  1YIJ Z;  2YAD A;  2QLV B;  4NOZ A;  3CPW Y;  4EWC A;  1KC8 2;  2DE6 A;  4NBC A;  5FLM I;  2OOY B;  4A3J I;  1VQ4 1;  2G2K A;  2PMZ A;  4MON A;  3CCE Z;  1DL6 A;  3CCR Z;  3P5J B;  1Y1V S;  3I56 1;  2IZ4 A;  2OOX B;  2BJO A;  1Y1W I;  3I55 Z;  1Z03 A;  4BBR I;  4NBD A;  4E30 A;  1YHQ Z;  1Q86 2;  3NH5 A;  3S15 I;  4BXX I;  1I3Q I;  4A3K I;  4E2Y A;  2JMO A;  2M6N A;  3CCL 1;  1R9T I;  3D9X A;  1VQL Z;  1Q7Y 1;  3OW2 Y;  4A3F I;  3VMG A;  3FQQ A;  3CCM Z;  2DE7 A;  1USP A;  3CCL Z;  3T4N B;  1KC8 1;  3NDJ A;  1TWG I;  3S17 I;  3CCQ 1;  1N8R 1;  3CC2 1;  2NVQ I;  3NH4 A;  3GTO I;  1K73 2;  3CXC Z;  1KQS Y;  3CMA 1;  3BG1 B;  3QWU A;  1YHQ 1;  1VQ9 1;  1P9N A;  4A3L I;  4MXU A;  2K5R A;  4DQY B;  3J80 b;  3CME 1;  3JAM f;  3I56 Z;  3IX0 A;  4NB8 A;  2EGT A;  3S16 I;  5A2Q b;  4NBH A;  3G6E Z;  3S1Q I;  2JR6 A;  4RVD A;  1VQ5 Z;  4NBF A;  4RVF A;  2W04 A;  3HOZ I;  3CCQ Z;  2PM9 A;  5IP9 I;  1X0T A;  2HU9 A;  1WCM I;  1VQO Z;  4A3I I;  3J81 b;  1S72 Z;  2LFU A;  1VQ5 1;  1QVF Y;  1JWH C;  3MZL B;  5C44 I;  4E2W A;  3VMI A;  3OW2 Z;  3M4O I;  3I07 A;  5FLX f;  1VQ7 Z;  2JNY A;  4BY1 I;  1VQN Z;  3TDH B;  3F3P C;  1K73 1;  3KIF A;  3NFZ A;  2GU2 A;  3G4S Z;  1Q81 1;  1VQ8 1;  3GTP I;  2ZAE B;  4A3E I;  2PK7 A;  3VTN A;  5AN9 F;  3CCU Z;  2V8J A;  2GTI A;  3GTJ I;  5C4X I;  2QR1 B;  4NBB A;  3BG0 B;  4A3D I;  4A3C I;  2E2I I;  4NBA A;  3U50 C;  1JJ2 Y;  3FKI I;  5C3E I;  1VQP Z;  3IF8 A;  4E33 A;  3NDI A;  1VQL 1;  2W03 A;  3CC7 1;  1YUA A;  2QRE B;  3HKZ A;  3G71 Z;  2DE5 A;  3RZD I;  2Q4Z A;  1ZH1 A;  4NBE A;  3CPW Z;  5IT9 f;  3CCV 1;  1TWA I;  2YU9 I;  3PO3 S;  4QTU A;  1TWF I;  4A3B I;  1VQN 1;  3PO2 I;  1Q81 2;  4MD7 A;  2NVX I;  1JJ2 Z;  4XX2 A;  3VB9 A;  2E2J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...