1DRSA

Three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
RICYNHLGTKPPTTETCQEDSCYKNIWTFDNIIRRGCGCFTPRGDMPGPYCCESDKCNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the RGD-containing neurotoxin homologue dendroaspin.
pubmed doi rcsb
source organism Dendroaspis jamesoni kaimosae
molecule tags Cell adhesion protein
molecule keywords DENDROASPIN
total genus 12
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1drsA00
1ERGA 4UY2C 4OM5A 1FASA 1LJZA 1CDRA 1CTXA 1L4WA 2H62C 1UG4A 2L03A 3NEQA 1COEA 1ABTA 2BTXA 2CCXA 1KU6B 2PJYB 3U74U 1I02A 5DO6A 1ONJA 1IDLA 1JGKA 2HLRA 1FFJA 1JE9A 5IMTD 4FAOE 1KBTA 1QKEA 1CDQA 1W6BA 1B41B 1IDIA 1HOYA 1REWC 3KFDE 5DU1A 1KC4A 1F94A 1M9ZA 2GOOC 1CXNA 2I9BE 2H7ZB 4OM4A 2MUPA 4IYEA 1TGXA 4AEAA 1CODA 3BT2U 4BIKB 1CREA 2PJYC 2N99A 1CCQA 1HC9B 1KL8A 1FF4A 1KBSA 1HAAA 2UWRA 3HH7A 4EY8B 1JBDA 1IDGA 1S4YA 2CRSA 2UX2A 1LSIA 1IDHA 2H64B 2H7ZA 1BTEA 3EVSC 4P7UA 1CVOA 2MUOA 1NTXA 2CRTA 5DZ5A 1MR6A 2OFSA 4DO8A 1LXGA 1TXBA 2MJ4A 1FSCA 1DRSA 1NXBA 1VB0A 1CRFA 2L5SA 1KS6A 2CTXA 3NDSA 1QM7A 2MFAA 3LAQU 1ERAA 1NTNA 1CHVS 2CDXA 4ZQYA 2QC1A 3U73U 1ES7B 3EBXA 2QJAC 4FAOC 4XJJA 1RL5A 2K3GA 1KTZB 1PLOA 2ERAA 1BXPA 1LX5B 4BDTB 2FD6U 3FEVA 1HC9A 1QKDA 2VLWA 3PLCA 2GOOB 2ABXA 1FSSB 3KFDI 1IJCA 2NBTA 1CDTA 4LFTA 1F8UB 2J8BA 2MHYA 1NYSA 5EBXA 1XT3A 4RUDA 1CB9A 2MJ0A 1TXAA 1CXOA 1H0JA 2JVEA 1CDSA 1HAJA 1KFHA 1YWHA 2H64C 2HLQA 2LCRA 2H8UA 1TFSA 2JQPA 3ERAA 1ZADA 2H5FA 1V6PA 2MJYA 1LXHA 1IK8A 1G6MA 1FRAA 3VTSA 1MAHF 2LA1A 2H62D 1NEAA 1NORA 1KBAA 1NYUA 3BT1U 2BHIA 4QTIU 3QB4B 4HQPF 5IMYC 1IQ9A 2QJ9C 6EBXA 1KXIA 1RGJA 2X8BB 1IKCA 3NH7A 2QJBC
chains in the Genus database with same CATH superfamily
1ERGA 4UY2C 4OM5A 1FASA 1LJZA 1CDRA 1CTXA 1L4WA 2H62C 1UG4A 2L03A 3NEQA 1COEA 1ABTA 2BTXA 2CCXA 1KU6B 2PJYB 3U74U 1I02A 5DO6A 1ONJA 1IDLA 1JGKA 2HLRA 1FFJA 1JE9A 5IMTD 4FAOE 1KBTA 1QKEA 1CDQA 1W6BA 1B41B 1IDIA 1HOYA 1REWC 3KFDE 5DU1A 1KC4A 1F94A 1M9ZA 2GOOC 1CXNA 2I9BE 2H7ZB 4OM4A 2MUPA 4IYEA 1TGXA 4AEAA 1CODA 3BT2U 4BIKB 1CREA 2PJYC 2N99A 1CCQA 1HC9B 1KL8A 1FF4A 1KBSA 1HAAA 2UWRA 3HH7A 4EY8B 1JBDA 1IDGA 1S4YA 2CRSA 2UX2A 1LSIA 1IDHA 2H64B 2H7ZA 1BTEA 3EVSC 4P7UA 1CVOA 2MUOA 1NTXA 2CRTA 5DZ5A 1MR6A 2OFSA 4DO8A 1LXGA 1TXBA 2MJ4A 1FSCA 1DRSA 1NXBA 1VB0A 1CRFA 2L5SA 1KS6A 2CTXA 3NDSA 1QM7A 2MFAA 3LAQU 1ERAA 1NTNA 1CHVS 2CDXA 4ZQYA 2QC1A 3U73U 1ES7B 3EBXA 2QJAC 4FAOC 4XJJA 1RL5A 2K3GA 1KTZB 1PLOA 2ERAA 1BXPA 1LX5B 4BDTB 2FD6U 3FEVA 1HC9A 1QKDA 2VLWA 3PLCA 2GOOB 2ABXA 1FSSB 3KFDI 1IJCA 2NBTA 1CDTA 4LFTA 1F8UB 2J8BA 2MHYA 1NYSA 5EBXA 1XT3A 4RUDA 1CB9A 2MJ0A 1TXAA 1CXOA 1H0JA 2JVEA 1CDSA 1HAJA 1KFHA 1YWHA 2H64C 2HLQA 2LCRA 2H8UA 1TFSA 2JQPA 3ERAA 1ZADA 2H5FA 1V6PA 2MJYA 1LXHA 1IK8A 1G6MA 1FRAA 3VTSA 1MAHF 2LA1A 2H62D 1NEAA 1NORA 1KBAA 1NYUA 3BT1U 2BHIA 4QTIU 3QB4B 4HQPF 5IMYC 1IQ9A 4KSNA 2QJ9C 6EBXA 1KXIA 1RGJA 2X8BB 1IKCA 3NH7A 2QJBC
chains in the Genus database with same CATH topology
1ERGA 4UY2C 4OM5A 1FASA 1LJZA 1CDRA 1CTXA 1L4WA 2H62C 1UG4A 2L03A 3NEQA 1COEA 1ABTA 2BTXA 2CCXA 1KU6B 2PJYB 3U74U 1I02A 5DO6A 1ONJA 1IDLA 1JGKA 2HLRA 1FFJA 1JE9A 5IMTD 4FAOE 1KBTA 1QKEA 1CDQA 1W6BA 1B41B 1IDIA 1HOYA 1REWC 3KFDE 5DU1A 1KC4A 1F94A 1M9ZA 2GOOC 1CXNA 2I9BE 2H7ZB 4OM4A 2MUPA 4IYEA 1TGXA 4AEAA 1CODA 3BT2U 4BIKB 1CREA 2PJYC 2N99A 1CCQA 1HC9B 1KL8A 1FF4A 1KBSA 1HAAA 2UWRA 3HH7A 4EY8B 1JBDA 1IDGA 1S4YA 2CRSA 2UX2A 1LSIA 1IDHA 2H64B 2H7ZA 1BTEA 3EVSC 4P7UA 1CVOA 2MUOA 1NTXA 2CRTA 5DZ5A 1MR6A 2OFSA 4DO8A 1LXGA 1TXBA 2MJ4A 1FSCA 1DRSA 1NXBA 1VB0A 1CRFA 2L5SA 1KS6A 2CTXA 3NDSA 1QM7A 2MFAA 3LAQU 1ERAA 1NTNA 1CHVS 2CDXA 4ZQYA 2QC1A 3U73U 1ES7B 3EBXA 2QJAC 4FAOC 4XJJA 1RL5A 2K3GA 1KTZB 1PLOA 2ERAA 1BXPA 1LX5B 4BDTB 2FD6U 3FEVA 1HC9A 1QKDA 2VLWA 3PLCA 2GOOB 2ABXA 1FSSB 3KFDI 1IJCA 2NBTA 1CDTA 4LFTA 1F8UB 2J8BA 2MHYA 1NYSA 5EBXA 1XT3A 4RUDA 1CB9A 2MJ0A 1TXAA 1CXOA 1H0JA 2JVEA 1CDSA 1HAJA 1KFHA 1YWHA 2H64C 2HLQA 2LCRA 2H8UA 1TFSA 2JQPA 3ERAA 1ZADA 2H5FA 1V6PA 2MJYA 1LXHA 1IK8A 1G6MA 1FRAA 3VTSA 1MAHF 2LA1A 2H62D 1NEAA 1NORA 1KBAA 1NYUA 3BT1U 2BHIA 4QTIU 3QB4B 4HQPF 5IMYC 1IQ9A 4KSNA 2QJ9C 6EBXA 1KXIA 1RGJA 2X8BB 1IKCA 3NH7A 2QJBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERG A;  4UY2 C;  4OM5 A;  1FAS A;  1LJZ A;  1CDR A;  1CTX A;  1L4W A;  2H62 C;  1UG4 A;  2L03 A;  3NEQ A;  1COE A;  1ABT A;  2BTX A;  2CCX A;  1KU6 B;  2PJY B;  3U74 U;  1I02 A;  5DO6 A;  1ONJ A;  1IDL A;  1JGK A;  2HLR A;  1FFJ A;  1JE9 A;  5IMT D;  4FAO E;  1KBT A;  1QKE A;  1CDQ A;  1W6B A;  1B41 B;  1IDI A;  1HOY A;  1REW C;  3KFD E;  5DU1 A;  1KC4 A;  1F94 A;  1M9Z A;  2GOO C;  1CXN A;  2I9B E;  2H7Z B;  4OM4 A;  2MUP A;  4IYE A;  1TGX A;  4AEA A;  1COD A;  3BT2 U;  4BIK B;  1CRE A;  2PJY C;  2N99 A;  1CCQ A;  1HC9 B;  1KL8 A;  1FF4 A;  1KBS A;  1HAA A;  2UWR A;  3HH7 A;  4EY8 B;  1JBD A;  1IDG A;  1S4Y A;  2CRS A;  2UX2 A;  1LSI A;  1IDH A;  2H64 B;  2H7Z A;  1BTE A;  3EVS C;  4P7U A;  1CVO A;  2MUO A;  1NTX A;  2CRT A;  5DZ5 A;  1MR6 A;  2OFS A;  4DO8 A;  1LXG A;  1TXB A;  2MJ4 A;  1FSC A;  1DRS A;  1NXB A;  1VB0 A;  1CRF A;  2L5S A;  1KS6 A;  2CTX A;  3NDS A;  1QM7 A;  2MFA A;  3LAQ U;  1ERA A;  1NTN A;  1CHV S;  2CDX A;  4ZQY A;  2QC1 A;  3U73 U;  1ES7 B;  3EBX A;  2QJA C;  4FAO C;  4XJJ A;  1RL5 A;  2K3G A;  1KTZ B;  1PLO A;  2ERA A;  1BXP A;  1LX5 B;  4BDT B;  2FD6 U;  3FEV A;  1HC9 A;  1QKD A;  2VLW A;  3PLC A;  2GOO B;  2ABX A;  1FSS B;  3KFD I;  1IJC A;  2NBT A;  1CDT A;  4LFT A;  1F8U B;  2J8B A;  2MHY A;  1NYS A;  5EBX A;  1XT3 A;  4RUD A;  1CB9 A;  2MJ0 A;  1TXA A;  1CXO A;  1H0J A;  2JVE A;  1CDS A;  1HAJ A;  1KFH A;  1YWH A;  2H64 C;  2HLQ A;  2LCR A;  2H8U A;  1TFS A;  2JQP A;  3ERA A;  1ZAD A;  2H5F A;  1V6P A;  2MJY A;  1LXH A;  1IK8 A;  1G6M A;  1FRA A;  3VTS A;  1MAH F;  2LA1 A;  2H62 D;  1NEA A;  1NOR A;  1KBA A;  1NYU A;  3BT1 U;  2BHI A;  4QTI U;  3QB4 B;  4HQP F;  5IMY C;  1IQ9 A;  2QJ9 C;  6EBX A;  1KXI A;  1RGJ A;  2X8B B;  1IKC A;  3NH7 A;  2QJB C; 
#chains in the Genus database with same CATH topology
 1ERG A;  4UY2 C;  4OM5 A;  1FAS A;  1LJZ A;  1CDR A;  1CTX A;  1L4W A;  2H62 C;  1UG4 A;  2L03 A;  3NEQ A;  1COE A;  1ABT A;  2BTX A;  2CCX A;  1KU6 B;  2PJY B;  3U74 U;  1I02 A;  5DO6 A;  1ONJ A;  1IDL A;  1JGK A;  2HLR A;  1FFJ A;  1JE9 A;  5IMT D;  4FAO E;  1KBT A;  1QKE A;  1CDQ A;  1W6B A;  1B41 B;  1IDI A;  1HOY A;  1REW C;  3KFD E;  5DU1 A;  1KC4 A;  1F94 A;  1M9Z A;  2GOO C;  1CXN A;  2I9B E;  2H7Z B;  4OM4 A;  2MUP A;  4IYE A;  1TGX A;  4AEA A;  1COD A;  3BT2 U;  4BIK B;  1CRE A;  2PJY C;  2N99 A;  1CCQ A;  1HC9 B;  1KL8 A;  1FF4 A;  1KBS A;  1HAA A;  2UWR A;  3HH7 A;  4EY8 B;  1JBD A;  1IDG A;  1S4Y A;  2CRS A;  2UX2 A;  1LSI A;  1IDH A;  2H64 B;  2H7Z A;  1BTE A;  3EVS C;  4P7U A;  1CVO A;  2MUO A;  1NTX A;  2CRT A;  5DZ5 A;  1MR6 A;  2OFS A;  4DO8 A;  1LXG A;  1TXB A;  2MJ4 A;  1FSC A;  1DRS A;  1NXB A;  1VB0 A;  1CRF A;  2L5S A;  1KS6 A;  2CTX A;  3NDS A;  1QM7 A;  2MFA A;  3LAQ U;  1ERA A;  1NTN A;  1CHV S;  2CDX A;  4ZQY A;  2QC1 A;  3U73 U;  1ES7 B;  3EBX A;  2QJA C;  4FAO C;  4XJJ A;  1RL5 A;  2K3G A;  1KTZ B;  1PLO A;  2ERA A;  1BXP A;  1LX5 B;  4BDT B;  2FD6 U;  3FEV A;  1HC9 A;  1QKD A;  2VLW A;  3PLC A;  2GOO B;  2ABX A;  1FSS B;  3KFD I;  1IJC A;  2NBT A;  1CDT A;  4LFT A;  1F8U B;  2J8B A;  2MHY A;  1NYS A;  5EBX A;  1XT3 A;  4RUD A;  1CB9 A;  2MJ0 A;  1TXA A;  1CXO A;  1H0J A;  2JVE A;  1CDS A;  1HAJ A;  1KFH A;  1YWH A;  2H64 C;  2HLQ A;  2LCR A;  2H8U A;  1TFS A;  2JQP A;  3ERA A;  1ZAD A;  2H5F A;  1V6P A;  2MJY A;  1LXH A;  1IK8 A;  1G6M A;  1FRA A;  3VTS A;  1MAH F;  2LA1 A;  2H62 D;  1NEA A;  1NOR A;  1KBA A;  1NYU A;  3BT1 U;  2BHI A;  4QTI U;  3QB4 B;  4HQP F;  5IMY C;  1IQ9 A;  4KSN A;  2QJ9 C;  6EBX A;  1KXI A;  1RGJ A;  2X8B B;  1IKC A;  3NH7 A;  2QJB C; 
#chains in the Genus database with same CATH homology
 1ERG A;  4UY2 C;  4OM5 A;  1FAS A;  1LJZ A;  1CDR A;  1CTX A;  1L4W A;  2H62 C;  1UG4 A;  2L03 A;  3NEQ A;  1COE A;  1ABT A;  2BTX A;  2CCX A;  1KU6 B;  2PJY B;  3U74 U;  1I02 A;  5DO6 A;  1ONJ A;  1IDL A;  1JGK A;  2HLR A;  1FFJ A;  1JE9 A;  5IMT D;  4FAO E;  1KBT A;  1QKE A;  1CDQ A;  1W6B A;  1B41 B;  1IDI A;  1HOY A;  1REW C;  3KFD E;  5DU1 A;  1KC4 A;  1F94 A;  1M9Z A;  2GOO C;  1CXN A;  2I9B E;  2H7Z B;  4OM4 A;  2MUP A;  4IYE A;  1TGX A;  4AEA A;  1COD A;  3BT2 U;  4BIK B;  1CRE A;  2PJY C;  2N99 A;  1CCQ A;  1HC9 B;  1KL8 A;  1FF4 A;  1KBS A;  1HAA A;  2UWR A;  3HH7 A;  4EY8 B;  1JBD A;  1IDG A;  1S4Y A;  2CRS A;  2UX2 A;  1LSI A;  1IDH A;  2H64 B;  2H7Z A;  1BTE A;  3EVS C;  4P7U A;  1CVO A;  2MUO A;  1NTX A;  2CRT A;  5DZ5 A;  1MR6 A;  2OFS A;  4DO8 A;  1LXG A;  1TXB A;  2MJ4 A;  1FSC A;  1DRS A;  1NXB A;  1VB0 A;  1CRF A;  2L5S A;  1KS6 A;  2CTX A;  3NDS A;  1QM7 A;  2MFA A;  3LAQ U;  1ERA A;  1NTN A;  1CHV S;  2CDX A;  4ZQY A;  2QC1 A;  3U73 U;  1ES7 B;  3EBX A;  2QJA C;  4FAO C;  4XJJ A;  1RL5 A;  2K3G A;  1KTZ B;  1PLO A;  2ERA A;  1BXP A;  1LX5 B;  4BDT B;  2FD6 U;  3FEV A;  1HC9 A;  1QKD A;  2VLW A;  3PLC A;  2GOO B;  2ABX A;  1FSS B;  3KFD I;  1IJC A;  2NBT A;  1CDT A;  4LFT A;  1F8U B;  2J8B A;  2MHY A;  1NYS A;  5EBX A;  1XT3 A;  4RUD A;  1CB9 A;  2MJ0 A;  1TXA A;  1CXO A;  1H0J A;  2JVE A;  1CDS A;  1HAJ A;  1KFH A;  1YWH A;  2H64 C;  2HLQ A;  2LCR A;  2H8U A;  1TFS A;  2JQP A;  3ERA A;  1ZAD A;  2H5F A;  1V6P A;  2MJY A;  1LXH A;  1IK8 A;  1G6M A;  1FRA A;  3VTS A;  1MAH F;  2LA1 A;  2H62 D;  1NEA A;  1NOR A;  1KBA A;  1NYU A;  3BT1 U;  2BHI A;  4QTI U;  3QB4 B;  4HQP F;  5IMY C;  1IQ9 A;  4KSN A;  2QJ9 C;  6EBX A;  1KXI A;  1RGJ A;  2X8B B;  1IKC A;  3NH7 A;  2QJB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...