1DRSA

Three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
b'RICYNHLGTKPPTTETCQEDSCYKNIWTFDNIIRRGCGCFTPRGDMPGPYCCESDKCNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DENDROASPIN
publication title Three-dimensional structure of the RGD-containing neurotoxin homologue dendroaspin.
pubmed doi rcsb
source organism Dendroaspis jamesoni kaimosae
molecule tags Cell adhesion protein
total genus 12
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1drsA00
2J8BA 1KU6B 1ERAA 1LX5B 3KFDI 4ZQYA 1NTXA 1NORA 2BTXA 1HC9B 3BT1U 4FAOE 1QM7A 1ZADA 1F94A 1FSCA 1KBAA 2CTXA 2LCRA 5IMTD 1TFSA 5EBXA 1JBDA 2NBTA 1TXBA 2MUPA 6EBXA 1NTNA 4BIKB 1ABTA 2JVEA 1ERGA 1CVOA 1VB0A 1REWC 2UWRA 1DRSA 1CODA 2X8BB 1G6MA 1FSSB 1FASA 1CDSA 2L03A 1BXPA 1IDLA 1KXIA 3HH7A 1CDQA 1NXBA 4OM5A 1CTXA 4AEAA 1IQ9A 1MR6A 1CDRA 1I02A 2PJYB 1KS6A 2HLRA 4OM4A 1UG4A 3QB4B 2H62D 2H62C 1RL5A 2H7ZA 2H5FA 2MJ4A 2JQPA 1KC4A 5DO6A 2QJBC 1FRAA 1ONJA 3NDSA 1QKDA 1W6BA 4DO8A 2QJ9C 3BT2U 2ABXA 4BDTB 2MUOA 1IJCA 1LJZA 1QKEA 1CREA 1IK8A 1NEAA 4EY8B 1KBTA 1CHVS 1L4WA 4RUDA 2GOOC 2MJ0A 2QJAC 2N99A 1V6PA 4P7UA 1FF4A 1FFJA 1H0JA 1TXAA 4FAOC 1HOYA 1CDTA 1IDHA 2LA1A 4XJJA 1LXGA 4UY2C 1CB9A 1XT3A 1IDGA 1NYUA 2H7ZB 1ES7B 3FEVA 3PLCA 1CRFA 2QC1A 5IMYC 1KFHA 1KTZB 2K3GA 3EBXA 1M9ZA 3ERAA 1F8UB 3NEQA 1HAAA 1HAJA 3KFDE 2MFAA 1CCQA 1CXNA 1TGXA 2HLQA 1LXHA 1JE9A 2UX2A 1BTEA 2CCXA 3VTSA 1B41B 1HC9A 1IDIA 1PLOA 1S4YA 1KBSA 4IYEA 1LSIA 2CDXA 2MHYA 1CXOA 1JGKA 1RGJA 3EVSC 1IKCA 2GOOB 1MAHF 2I9BE 3U74U 2MJYA 3U73U 2H64C 1YWHA 1COEA 1KL8A 2FD6U 2BHIA 4QTIU 2H8UA 2ERAA 2CRSA 1NYSA 3NH7A 2L5SA 2PJYC 2H64B 2VLWA 5DU1A 2OFSA 2CRTA 3LAQU 4HQPF 5DZ5A 4LFTA
chains in the Genus database with same CATH superfamily
2J8BA 1KU6B 1ERAA 1LX5B 3KFDI 4ZQYA 1NTXA 1NORA 2BTXA 1HC9B 3BT1U 4FAOE 1QM7A 1ZADA 1F94A 1FSCA 1KBAA 2CTXA 2LCRA 5IMTD 1TFSA 5EBXA 1JBDA 2NBTA 1TXBA 2MUPA 6EBXA 1NTNA 4BIKB 1ABTA 2JVEA 1ERGA 1CVOA 1VB0A 1REWC 2UWRA 1DRSA 1CODA 2X8BB 1G6MA 1FSSB 1FASA 1CDSA 2L03A 1BXPA 1IDLA 1KXIA 3HH7A 1CDQA 1NXBA 4OM5A 1CTXA 4KSNA 4AEAA 1IQ9A 1MR6A 1CDRA 1I02A 2PJYB 1KS6A 2HLRA 4OM4A 1UG4A 3QB4B 2H62D 2H62C 1RL5A 2H7ZA 2H5FA 2MJ4A 2JQPA 1KC4A 5DO6A 2QJBC 1FRAA 1ONJA 3NDSA 1QKDA 1W6BA 4DO8A 2QJ9C 3BT2U 2ABXA 4BDTB 2MUOA 1IJCA 1LJZA 1QKEA 1CREA 1IK8A 1NEAA 4EY8B 1KBTA 1CHVS 1L4WA 4RUDA 2GOOC 2MJ0A 2QJAC 2N99A 1V6PA 4P7UA 1FF4A 1FFJA 1H0JA 1TXAA 4FAOC 1HOYA 1CDTA 1IDHA 2LA1A 4XJJA 1LXGA 4UY2C 1CB9A 1XT3A 1IDGA 1NYUA 2H7ZB 1ES7B 3FEVA 3PLCA 1CRFA 2QC1A 5IMYC 1KFHA 1KTZB 2K3GA 3EBXA 1M9ZA 3ERAA 1F8UB 3NEQA 1HAAA 1HAJA 3KFDE 2MFAA 1CCQA 1CXNA 1TGXA 2HLQA 1LXHA 1JE9A 2UX2A 1BTEA 2CCXA 3VTSA 1B41B 1HC9A 1IDIA 1PLOA 1S4YA 1KBSA 4IYEA 1LSIA 2CDXA 2MHYA 1CXOA 1JGKA 1RGJA 3EVSC 1IKCA 2GOOB 1MAHF 2I9BE 3U74U 2MJYA 3U73U 2H64C 1YWHA 1COEA 1KL8A 2FD6U 2BHIA 4QTIU 2H8UA 2ERAA 2CRSA 1NYSA 3NH7A 2L5SA 2PJYC 2H64B 2VLWA 5DU1A 2OFSA 2CRTA 3LAQU 4HQPF 5DZ5A 4LFTA
chains in the Genus database with same CATH topology
2J8BA 1KU6B 1ERAA 1LX5B 3KFDI 4ZQYA 1NTXA 1NORA 2BTXA 1HC9B 3BT1U 4FAOE 1QM7A 1ZADA 1F94A 1FSCA 1KBAA 2CTXA 2LCRA 5IMTD 1TFSA 5EBXA 1JBDA 2NBTA 1TXBA 2MUPA 6EBXA 1NTNA 4BIKB 1ABTA 2JVEA 1ERGA 1CVOA 1VB0A 1REWC 2UWRA 1DRSA 1CODA 2X8BB 1G6MA 1FSSB 1FASA 1CDSA 2L03A 1BXPA 1IDLA 1KXIA 3HH7A 1CDQA 1NXBA 4OM5A 1CTXA 4KSNA 4AEAA 1IQ9A 1MR6A 1CDRA 1I02A 2PJYB 1KS6A 2HLRA 4OM4A 1UG4A 3QB4B 2H62D 2H62C 1RL5A 2H7ZA 2H5FA 2MJ4A 2JQPA 1KC4A 5DO6A 2QJBC 1FRAA 1ONJA 3NDSA 1QKDA 1W6BA 4DO8A 2QJ9C 3BT2U 2ABXA 4BDTB 2MUOA 1IJCA 1LJZA 1QKEA 1CREA 1IK8A 1NEAA 4EY8B 1KBTA 1CHVS 1L4WA 4RUDA 2GOOC 2MJ0A 2QJAC 2N99A 1V6PA 4P7UA 1FF4A 1FFJA 1H0JA 1TXAA 4FAOC 1HOYA 1CDTA 1IDHA 2LA1A 4XJJA 1LXGA 4UY2C 1CB9A 1XT3A 1IDGA 1NYUA 2H7ZB 1ES7B 3FEVA 3PLCA 1CRFA 2QC1A 5IMYC 1KFHA 1KTZB 2K3GA 3EBXA 1M9ZA 3ERAA 1F8UB 3NEQA 1HAAA 1HAJA 3KFDE 2MFAA 1CCQA 1CXNA 1TGXA 2HLQA 1LXHA 1JE9A 2UX2A 1BTEA 2CCXA 3VTSA 1B41B 1HC9A 1IDIA 1PLOA 1S4YA 1KBSA 4IYEA 1LSIA 2CDXA 2MHYA 1CXOA 1JGKA 1RGJA 3EVSC 1IKCA 2GOOB 1MAHF 2I9BE 3U74U 2MJYA 3U73U 2H64C 1YWHA 1COEA 1KL8A 2FD6U 2BHIA 4QTIU 2H8UA 2ERAA 2CRSA 1NYSA 3NH7A 2L5SA 2PJYC 2H64B 2VLWA 5DU1A 2OFSA 2CRTA 3LAQU 4HQPF 5DZ5A 4LFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8B A;  1KU6 B;  1ERA A;  1LX5 B;  3KFD I;  4ZQY A;  1NTX A;  1NOR A;  2BTX A;  1HC9 B;  3BT1 U;  4FAO E;  1QM7 A;  1ZAD A;  1F94 A;  1FSC A;  1KBA A;  2CTX A;  2LCR A;  5IMT D;  1TFS A;  5EBX A;  1JBD A;  2NBT A;  1TXB A;  2MUP A;  6EBX A;  1NTN A;  4BIK B;  1ABT A;  2JVE A;  1ERG A;  1CVO A;  1VB0 A;  1REW C;  2UWR A;  1DRS A;  1COD A;  2X8B B;  1G6M A;  1FSS B;  1FAS A;  1CDS A;  2L03 A;  1BXP A;  1IDL A;  1KXI A;  3HH7 A;  1CDQ A;  1NXB A;  4OM5 A;  1CTX A;  4AEA A;  1IQ9 A;  1MR6 A;  1CDR A;  1I02 A;  2PJY B;  1KS6 A;  2HLR A;  4OM4 A;  1UG4 A;  3QB4 B;  2H62 D;  2H62 C;  1RL5 A;  2H7Z A;  2H5F A;  2MJ4 A;  2JQP A;  1KC4 A;  5DO6 A;  2QJB C;  1FRA A;  1ONJ A;  3NDS A;  1QKD A;  1W6B A;  4DO8 A;  2QJ9 C;  3BT2 U;  2ABX A;  4BDT B;  2MUO A;  1IJC A;  1LJZ A;  1QKE A;  1CRE A;  1IK8 A;  1NEA A;  4EY8 B;  1KBT A;  1CHV S;  1L4W A;  4RUD A;  2GOO C;  2MJ0 A;  2QJA C;  2N99 A;  1V6P A;  4P7U A;  1FF4 A;  1FFJ A;  1H0J A;  1TXA A;  4FAO C;  1HOY A;  1CDT A;  1IDH A;  2LA1 A;  4XJJ A;  1LXG A;  4UY2 C;  1CB9 A;  1XT3 A;  1IDG A;  1NYU A;  2H7Z B;  1ES7 B;  3FEV A;  3PLC A;  1CRF A;  2QC1 A;  5IMY C;  1KFH A;  1KTZ B;  2K3G A;  3EBX A;  1M9Z A;  3ERA A;  1F8U B;  3NEQ A;  1HAA A;  1HAJ A;  3KFD E;  2MFA A;  1CCQ A;  1CXN A;  1TGX A;  2HLQ A;  1LXH A;  1JE9 A;  2UX2 A;  1BTE A;  2CCX A;  3VTS A;  1B41 B;  1HC9 A;  1IDI A;  1PLO A;  1S4Y A;  1KBS A;  4IYE A;  1LSI A;  2CDX A;  2MHY A;  1CXO A;  1JGK A;  1RGJ A;  3EVS C;  1IKC A;  2GOO B;  1MAH F;  2I9B E;  3U74 U;  2MJY A;  3U73 U;  2H64 C;  1YWH A;  1COE A;  1KL8 A;  2FD6 U;  2BHI A;  4QTI U;  2H8U A;  2ERA A;  2CRS A;  1NYS A;  3NH7 A;  2L5S A;  2PJY C;  2H64 B;  2VLW A;  5DU1 A;  2OFS A;  2CRT A;  3LAQ U;  4HQP F;  5DZ5 A;  4LFT A; 
#chains in the Genus database with same CATH topology
 2J8B A;  1KU6 B;  1ERA A;  1LX5 B;  3KFD I;  4ZQY A;  1NTX A;  1NOR A;  2BTX A;  1HC9 B;  3BT1 U;  4FAO E;  1QM7 A;  1ZAD A;  1F94 A;  1FSC A;  1KBA A;  2CTX A;  2LCR A;  5IMT D;  1TFS A;  5EBX A;  1JBD A;  2NBT A;  1TXB A;  2MUP A;  6EBX A;  1NTN A;  4BIK B;  1ABT A;  2JVE A;  1ERG A;  1CVO A;  1VB0 A;  1REW C;  2UWR A;  1DRS A;  1COD A;  2X8B B;  1G6M A;  1FSS B;  1FAS A;  1CDS A;  2L03 A;  1BXP A;  1IDL A;  1KXI A;  3HH7 A;  1CDQ A;  1NXB A;  4OM5 A;  1CTX A;  4KSN A;  4AEA A;  1IQ9 A;  1MR6 A;  1CDR A;  1I02 A;  2PJY B;  1KS6 A;  2HLR A;  4OM4 A;  1UG4 A;  3QB4 B;  2H62 D;  2H62 C;  1RL5 A;  2H7Z A;  2H5F A;  2MJ4 A;  2JQP A;  1KC4 A;  5DO6 A;  2QJB C;  1FRA A;  1ONJ A;  3NDS A;  1QKD A;  1W6B A;  4DO8 A;  2QJ9 C;  3BT2 U;  2ABX A;  4BDT B;  2MUO A;  1IJC A;  1LJZ A;  1QKE A;  1CRE A;  1IK8 A;  1NEA A;  4EY8 B;  1KBT A;  1CHV S;  1L4W A;  4RUD A;  2GOO C;  2MJ0 A;  2QJA C;  2N99 A;  1V6P A;  4P7U A;  1FF4 A;  1FFJ A;  1H0J A;  1TXA A;  4FAO C;  1HOY A;  1CDT A;  1IDH A;  2LA1 A;  4XJJ A;  1LXG A;  4UY2 C;  1CB9 A;  1XT3 A;  1IDG A;  1NYU A;  2H7Z B;  1ES7 B;  3FEV A;  3PLC A;  1CRF A;  2QC1 A;  5IMY C;  1KFH A;  1KTZ B;  2K3G A;  3EBX A;  1M9Z A;  3ERA A;  1F8U B;  3NEQ A;  1HAA A;  1HAJ A;  3KFD E;  2MFA A;  1CCQ A;  1CXN A;  1TGX A;  2HLQ A;  1LXH A;  1JE9 A;  2UX2 A;  1BTE A;  2CCX A;  3VTS A;  1B41 B;  1HC9 A;  1IDI A;  1PLO A;  1S4Y A;  1KBS A;  4IYE A;  1LSI A;  2CDX A;  2MHY A;  1CXO A;  1JGK A;  1RGJ A;  3EVS C;  1IKC A;  2GOO B;  1MAH F;  2I9B E;  3U74 U;  2MJY A;  3U73 U;  2H64 C;  1YWH A;  1COE A;  1KL8 A;  2FD6 U;  2BHI A;  4QTI U;  2H8U A;  2ERA A;  2CRS A;  1NYS A;  3NH7 A;  2L5S A;  2PJY C;  2H64 B;  2VLW A;  5DU1 A;  2OFS A;  2CRT A;  3LAQ U;  4HQP F;  5DZ5 A;  4LFT A; 
#chains in the Genus database with same CATH homology
 2J8B A;  1KU6 B;  1ERA A;  1LX5 B;  3KFD I;  4ZQY A;  1NTX A;  1NOR A;  2BTX A;  1HC9 B;  3BT1 U;  4FAO E;  1QM7 A;  1ZAD A;  1F94 A;  1FSC A;  1KBA A;  2CTX A;  2LCR A;  5IMT D;  1TFS A;  5EBX A;  1JBD A;  2NBT A;  1TXB A;  2MUP A;  6EBX A;  1NTN A;  4BIK B;  1ABT A;  2JVE A;  1ERG A;  1CVO A;  1VB0 A;  1REW C;  2UWR A;  1DRS A;  1COD A;  2X8B B;  1G6M A;  1FSS B;  1FAS A;  1CDS A;  2L03 A;  1BXP A;  1IDL A;  1KXI A;  3HH7 A;  1CDQ A;  1NXB A;  4OM5 A;  1CTX A;  4KSN A;  4AEA A;  1IQ9 A;  1MR6 A;  1CDR A;  1I02 A;  2PJY B;  1KS6 A;  2HLR A;  4OM4 A;  1UG4 A;  3QB4 B;  2H62 D;  2H62 C;  1RL5 A;  2H7Z A;  2H5F A;  2MJ4 A;  2JQP A;  1KC4 A;  5DO6 A;  2QJB C;  1FRA A;  1ONJ A;  3NDS A;  1QKD A;  1W6B A;  4DO8 A;  2QJ9 C;  3BT2 U;  2ABX A;  4BDT B;  2MUO A;  1IJC A;  1LJZ A;  1QKE A;  1CRE A;  1IK8 A;  1NEA A;  4EY8 B;  1KBT A;  1CHV S;  1L4W A;  4RUD A;  2GOO C;  2MJ0 A;  2QJA C;  2N99 A;  1V6P A;  4P7U A;  1FF4 A;  1FFJ A;  1H0J A;  1TXA A;  4FAO C;  1HOY A;  1CDT A;  1IDH A;  2LA1 A;  4XJJ A;  1LXG A;  4UY2 C;  1CB9 A;  1XT3 A;  1IDG A;  1NYU A;  2H7Z B;  1ES7 B;  3FEV A;  3PLC A;  1CRF A;  2QC1 A;  5IMY C;  1KFH A;  1KTZ B;  2K3G A;  3EBX A;  1M9Z A;  3ERA A;  1F8U B;  3NEQ A;  1HAA A;  1HAJ A;  3KFD E;  2MFA A;  1CCQ A;  1CXN A;  1TGX A;  2HLQ A;  1LXH A;  1JE9 A;  2UX2 A;  1BTE A;  2CCX A;  3VTS A;  1B41 B;  1HC9 A;  1IDI A;  1PLO A;  1S4Y A;  1KBS A;  4IYE A;  1LSI A;  2CDX A;  2MHY A;  1CXO A;  1JGK A;  1RGJ A;  3EVS C;  1IKC A;  2GOO B;  1MAH F;  2I9B E;  3U74 U;  2MJY A;  3U73 U;  2H64 C;  1YWH A;  1COE A;  1KL8 A;  2FD6 U;  2BHI A;  4QTI U;  2H8U A;  2ERA A;  2CRS A;  1NYS A;  3NH7 A;  2L5S A;  2PJY C;  2H64 B;  2VLW A;  5DU1 A;  2OFS A;  2CRT A;  3LAQ U;  4HQP F;  5DZ5 A;  4LFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...