1DU2A

Solution structure of the theta subunit of dna polymerase iii
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
76
structure length
76
Chain Sequence
b'MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III
publication title NMR solution structure of the theta subunit of DNA polymerase III from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 7
structure length 76
sequence length 76
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 1du2A00
1SE7A 1DU2A 2XY8B 2AE9A 2IDOB 2AXDS
chains in the Genus database with same CATH superfamily
2VK9A 3RYFE 3WI3A 3EABA 5GONE 5AQFB 2DI4A 3M65A 5H6RB 5CJ5A 5DJQC 3UU5A 3UUNA 3MA9A 2MOZA 1KNZA 3AAAB 1ZP0A 3O9XA 4JI2T 1YXRA 2XQYA 2QGSA 4ERRA 1Z0PA 4TWDA 3HKDE 3LDQB 5IUXA 5AQRB 2K5BB 3HR0A 2Q9QA 5AQPB 2DCFA 1OEDC 4IL4A 1VCTA 3I9WA 4KI0F 1HCIA 4DR3T 2XQ3A 4F6RC 2WSSV 2YU1A 5HYAA 4UEMA 1XDOA 4TV9E 2LE8A 1UX5A 1VOMA 1XDPA 1YD8G 4YSYA 3AB3B 1E7PA 4DV5T 2H89A 2IC9A 1WR6A 2V6YB 4X62T 4YHJA 3LK2B 2WQYA 2LSGA 5C3JA 2FJAA 3K1SA 2HPLA 2YN6A 4JI4T 4QH4A 2UXNB 3TKLB 1YQ3A 3L09A 2C5IT 5LGUB 3FB2A 1U5PA 1W09A 2BVLA 2K9AA 3UFGA 2YDQA 4JI5T 4PJMA 3FZKB 3LK42 3UT5E 4LF6T 2BS2A 3PU8A 3N2OA 3ZT7A 3SS1A 3ZMSB 5E0OA 1S35A 2KSRA 4QH1A 3PUGA 2BZBA 2VL8A 2HN2A 3QK6A 3ZC0A 4LFBT 3N9LA 4OK0A 4CXXA 2XZEA 2I0MA 2M6IA 3E0ZA 4XZCA 3UQ4A 4NIQA 3I1AA 3QC9A 5ABHA 3CVRA 4MALA 1KNRA 1OWAA 1ZOYA 2W0GA 5FKYA 1Y64B 4IE0A 3ZJ1A 4AKRB 2UXXB 3F57A 5LCYA 2XM2A 1ZV4X 4O2AE 4AISA 4IE5A 3P4SA 3MK7C 4B6XA 1MNEA 2XSAA 2ZM8A 1YKEB 3RKGA 3OJAA 3RI5A 2CXDA 4WBOA 3PTRB 2SPCA 3NZPA 1W0BA 2W66A 4JI0T 3UU6A 4PFPA 3D0TA 3AE3A 2H7VC 3K3QC 5JTGA 4QXHB 5AQNB 2ZM2A 2F4VT 1SE7A 2ZM0A 5ABEA 5HAXA 4X1IE 5AQTB 5HCMA 3T1HT 2V7JA 4A98A 1DU2A 5ABFA 4EEDA 5JH7E 5BMVE 5HEOA 4JUYA 4QX8B 3AA0B 4OHFA 1BR1A 3ONJA 2W67A 5JDLA 5JDFA 3CQGB 3RIUA 3AE8A 3O1JA 2C0SA 2ODVA 4PJNA 3BQLA 2JRKA 3QB5K 2HPJA 2BDEA 1NEKA 2XPKA 4GYSA 4WBNE 4UVBB 4IE6A 4E7SA 3EI0A 5F5WA 1H7CA 1T7SA 2V7MA 2CBIA 5M4YA 3UUMA 3ONXA 5JVDE 3KBUA 3P4PA 4GKKT 2C5JA 3VU7H 1HNXT 4ZI3D 3P7IA 3PJAJ 2LLYA 2EHOB 2A3DA 1UUSA 1E2AA 2MAWA 4HFVA 3TLTA 5DQVA 4YT0A 2YK0A 3K3OA 3VHLA 3RX6A 1W0AA 3P4RA 3Q5EA 4CXYA 1KK7A 4EGWA 4KHPT 3FXEB 2PG8A 5L3EB 4KUMB 4I43B 3ZJ2A 4E7ZA 3JCFA 3C51A 2D2SA 1N34T 4AQGA 2UXBT 3AAEB 2Z6EA 5HXHA 4UIGA 2DHRA 5LYJE 2ZLYA 3PU3A 2CHOA 3AAIA 2CCQA 5FNVE 2UXDT 2M6BA 2QRXA 3IF8B 3MKDA 4OFZA 3ZMVB 3VRBA 1WYBA 1XMOT 3F31A 2BBHA 2UUBT 2HHHT 2R6GF 4Z90A 1OXZA 3SFDA 2RA1A 4AIUA 1GQEA 4DV6T 5AQSB 4HWIB 3KV9A 5HCJA 2JMHA 5FY0A 3EDVA 3AA7B 3MXZA 4ZOLE 2KNDA 5L4EA 3S4UA 4QHOA 2UU9T 5JDNA 3C64A 3VR9A 2D0TA 1V9DA 2LOPA 4EV6A 3NRXA 4COFA 1KFYA 3Q5WA 3AVRA 2Q9QB 4IDNA 2G0UA 3FXDB 4L9IA 3NBXX 3CX6B 1AJ3A 2DWKA 2PJQA 5FY7A 3FBLA 4DVDA 2WP9A 1HX8A 3UQ7A 2JIWA 3QNUA 2XQ4A 3UTKA 1MIYA 4UR9A 3PJAA 1BR2A 3A7MA 5CGMA 3SRZA 4BJNA 2LSJA 4GOUA 5KX5E 2LHNA 3EHZA 5FL1A 2BG9E 3CK6A 2UXCT 4YTNA 3A5XA 2DNXA 3ZCJA 2V6XA 1BR0A 2CWOA 2H7OA 2NTYA 2X9XA 2ZM6T 5AQIB 3HL6A 2YINA 4HFBA 5LP6E 4FI5A 4B3ST 4X1KE 4LF4T 2XTLA 4ISSA 4U3CA 2MYSA 3T1YT 2X67A 1HF8A 2XY8B 5AQOB 4AQFC 2LSYA 1IBKT 2X66A 1MIVA 5KDMC 2V5DA 5AQVB 2CBJA 2W4XA 2B76A 3OVUA 4ASKA 4DV1T 1QLBA 2BVMA 3KDSE 3GMIA 5LBMA 1N36T 4TWHA 2K3WA 2WM9A 4HE8A 3KV4A 4YTMA 4XAXB 4A97A 4B3RT 1D0ZA 2E9XA 2VVNA 4DV2T 3ZYKA 2WMOA 4OYJA 3W15B 3KV5A 5L3FB 4AKIA 4CN4A 1IJ6A 2VKHA 4NXNT 5HEJA 2LT3A 4LMKA 4HN9A 2KXPB 4ISTA 3HKCE 2IUBA 4KMCA 2VQFT 1G8XA 1IAPA 3KINB 3LJCA 2OA5A 3AVSA 3PDYA 3KFWX 3OYXA 5FVLA 3JAEA 2FBWA 3PUYF 3HA4A 4AKGA 3KVBA 3CX8B 4PJJA 2Y48B 3UULA 2X0YA 5ABFB 4X64T 4C91A 3N9MA 5LMUT 2MPKA 3BQIA 3N9PA 3P4QA 4YJ2E 5JDMA 4JYAT 4U7IA 2LM2A 5IHYA 3J7Yq 3AE7A 5FXZA 1UK5A 1YKHB 3FHNA 4EYUA 4QXCB 1KF6A 1LVKA 3AE6A 3SWHA 4V1Av 2WDVA 2XJ7A 3Q9DA 4I50E 3CX7B 3LK3B 3AEDA 2MTQA 2P9BA 2AE9A 2BG9A 1D0XA 3UUXB 3HKEE 4MHCA 5HXEA 2HH7A 4NUUA 5EK3A 3ZEFB 3V5SA 5CA1E 2XUEA 5JREA 4EXTA 4X1YE 1MMAA 1LVFA 5LXTE 2EHOD 5L3GB 2WBLA 3FBZA 2A2FX 3TLUA 3CQCB 1HNZT 5EZYE 5AQJB 3ANWA 5J1GA 2BBJA 5FL0A 2B1EA 4TZ4C 3RC3A 4QXBB 2EHOC 4UVAB 4MFRA 4EYYR 1IZNB 3N9NA 2K24A 2CHNA 4YLHA 2IDOB 2YKSA 1I6ZA 4H9PC 2WU2A 2LSIA 3LFMA 3UFEA 2V8SV 1MNDA 4ADZA 3RLFF 2UUCT 4WZXA 5ADXL 4YTPA 3NZQA 5LNKA 3L3PA 5LJNA 2DL1A 2Y8DA 3DJBA 4X66T 2OLTA 3TLVA 4TWFA 4PNIA 5IYZE 5A1LA 5IWAT 3Q2MA 4DMVA 1VCSA 3DTOA 3QB5A 5AQHB 5J0ZA 3JADA 3BK9A 2KINB 2IHR1 1MMNA 2KMFA 5LGTB 5FYMA 3P50A 5LHGB 4EAHA 1OEDE 5JDHA 5AQKB 2BKOA 4H9NC 3ETUA 3PV0F 2YEVC 3C4XA 3ZYMA 2WCAA 3K8PC 4O4IE 2X9YA 4I4TE 1HTJF 4IREA 3RHWA 1M7KA 1FEWA 1SHZC 2UUAT 4N78D 2Q9QD 3C50A 5TAOA 3ESLA 2IMLA 3MZKB 5HEGA 1QUUA 4HTEA 4K0UA 3IHRA 4BAYB 1ZEEA 4A56A 2YOEA 3AE5A 4EZ4A 4CXWA 2L9QA 5CA0E 3CPZA 4HWFA 4JI8T 2WU5A 4JI3T 3N2GE 3G06A 1J5WA 4ZS2A 2V7KA 4MBQA 2LKHA 3RGLA 1KNPA 2OV9A 3EUHA 4OYKA 4DV3T 4ZS3A 4ZEYA 2Q9QC 2LRKA 2XQ8A 2C5KT 3UU8A 3CWZB 5FP3A 1N32T 5ABGA 1XWMA 1N33T 4B3MT 5JR9A 2W00A 2YU2A 3RC8A 3LG7A 4ZZBA 2CE7A 4P1NA 3O1HA 1Y01A 1I94T 1WCRA 1FIOA 4O4JE 1U4QA 2WS3A 3H3MA 1B7TA 2E9XB 3Q5DA 4YSZA 3P8CD 4UF0A 4HWHA 3QOFA 5LG3A 4IGUA 4FJOA 2K48A 4HFEA 1D1BA 4X5TA 4CN1A 2FJBA 3RKOA 1FJGT 3C4ZA 4LF8T 4IHJE 2ES0A 3ZCIA 5HXRA 2WB5A 1LKXA 2ODUA 3ZMUB 1G73A 4YHHT 5F3JA 3ONLC 2ACXA 5LG4A 1L0VA 3I0QA 2D0UA 4GIWA 4H63V 4HFIA 4IDQA 2VB6A 2WDQA 1HX1B 4I55E 4BJMA 2KLQA 3R84B 1NENA 4JI6T 4WNKA 3PUZF 2CMRA 1X9BA 3B57A 1HG5A 5JQGE 5AQQB 1S94A 3N5LA 4EZHA 5LOVE 4DR6T 3MACA 3HKBE 3RQWA 2XHEB 2KZ7B 1MMGA 4HGAA 4PK5A 2PTFA 1NAFA 2A9UA 3AEEA 3LBXB 2X51A 4L5GA 4EEBA 5C8YE 5FMNA 3EVYA 4TV8E 2BG9B 4JI7T 3I0OA 2YDSA 1MIWA 5CFBA 3RIUC 4ZI2D 4K0KT 3A8YC 4ZI7E 3PE0A 2WAUA 4NPPA 2FJEA 2NTXA 2H88A 3GN5A 2RPAA 2CLYB 4H9SE 1CUNA 2CWYA 3KBTA 3O1IA 4I0UA 4GKJT 5L47A 4WW0A 3AE4A 3ANWB 3FZFB 3OPCA 4QKNA 2W61A 3AXJA 1UURA 5L3CB 4TUYE 4ZI2C 3FZLB 2NOXA 1W9RA 2DWGA 3IEEA 1KEYA 1CHUA 2CXFA 3ZSTA 3CKDA 1LRZA 2E2AA 4IL9A 5HXSA 3OKQA 4JEUB 1US7B 5AQLB 5HXCA 4JV5T 1SUMB 4TNVA 2N1GA 2KWIB 4KBMB 3AE2A 4ZZCA 2VKOA 4DIDB 2HN1A 5HEHA 2E5LT 4LMJA 3M3ZB 3AE9A 2A72A 2NW8A 4ILCA 2XAQB 4AKHA 4IIJE 5AFUL 3WAKA 2LRLA 3PUAA 4QWNB 2X0LB 4PFOA 4DV0T 2V7IA 4LFCT 4QX7B 2JMKA 2X9HA 1J1JA 1IBLT 3SOLA 3TLSA 1JNRA 5LMNT 1T8BA 2IC6A 4U2YA 3AEFA 4DBRA 3OYZA 3RYHE 3I9YA 5C2TA 2V5CA 1XMQT 3ZPOA 3RH3A 2WY2A 2J4GA 2LOSA 3DP7A 4O4LE 4UXNB 4IE7A 1O3XA 3K3NA 5DABA 2WWUA 1M62A 2NWBA 3LBXA 4JEHB 5EK2A 1HR0T 3UU3A 2MBGA 2CA5A 1NWMX 3ETVA 4P09A 1UX4A 3B13A 4UV9B 5CB4E 3FZHB 3NVOA 5HWXA 3EAMA 3TLWA 1HFAA 2BKNA 1XZYA 3H37A 4WYVA 4CI3B 2ZMAA 4H63H 2VWAA 2W62A 1X79A 2E5VA 2N2NA 2LM9A 2VVSA 2VQET 2J1DG 4GK0E 4YY3T 4TN7B 4DBQA 4H9RC 2VKDA 4DNDA 4H9OC 2XAFB 5JR9B 1WYCA 3PURA 2IAKA 1VRBA 2XQ7A 2CRBA 2D9DA 3ZT6A 1D1AA 3VR8A 4EOZB 4DUZT 3E22E 4LF7T 4EIWA 3AEGA 1D1CA 3RIFA 2KT9A 4HEAA 3KVAA 3PUQA 3O4XE 2LEHA 2J47A 1T72A 2RP4A 1QSDA 3ZKRA 2WDRA 4UF0B 4HWDA 5DQWA 4X20E 3ZMTB 3RIAA 3Q5XA 5L3DB 2IIUA 4U74A 3R6NA 2E9XD 4KX6A 3RQUA 4HKAA 2QVAA 3L8RA 2BS4A 3ZN1B 3V5UA 2VURA 5AQGB 4B3TT 3JC6D 4DR2T 3N2KE 4AI6A 5FXVA 3AE1A 4P0AA 3VKHA 2XQ5A 2XSBA 3RRCA 2AXDS 5L3BB 3OTOT 2E9XC 2JQKA 3PUVF 4PW8A 2W2UA 2V7LA 4P0BA 1WRDA 1OEDB 1EZ3A 3CMLA 3BQKA 2CEAA 4MLKA 2X9WA 3X1DA 2PBIA 4CI2B 4LFAT 3JC6C 2JQHA 1WLXA 4L0RA 3U3IA 2J62A 4DR7T 3T8OA 4M1PA 4CQIA 4DR4T 3PUWF 5HWYA 4AKLA 4G2AA 3RPUA 4YXDA 2WMNA 3ABVA 5JDQA 3IBPA 2L3LA 4YJ3E 3B5MA 1FMWA 2LSKA 4DR1T 4CI1B 1HNWT 2VASA 4O4HE 4UV8B 2IW5B 3ZN0B 2XAHB 3CIRA 1YQ4A 2XQ6A 2FUPA 3J9X1 3C98B 2Y6XA 3SFEA 2GK9A 3RYIE 4U72A 4U2ZA 3AECA 4CZZB 3RF1A 4AQFA 2I59A 4Q25A 4HFDA 2XASB 2ACZA 4JLEA 2WZIA 4IDOA 4PJLA 4DV7T 1Z8UA 4O8SA 3GN5B 2V6YA 2VL0A 4AQYT 3ZLIA 2NR4A 3N9OA 4BA9A 3AA1B 2V1DB 4HWCA 2I6HA 1UCUA 5ETWA 5LA6E 3AXJB 2BG9C 1MMDA 5FY1A 2FJDA 1HS7A 1SA0E 4TNWA 4DO0A 2CPTA 3OBVE 5J2TE 4ZXLA 4OX9T 2XM1A 2CXLA 3VRAA 4ZI3C 4ANJA 2E8IA 2LHRA 2LKGA 4LF9T 3JAFA 2CLYC 1XNRT 3CQXC 5LB7B 2H3RA 4JI1T 2JPFA 4HFHA 2X0HA 4C90A 3KV6A 1ZHCA 4A5XA 2NW7A 5F8PA 3UUBA 2XQ9A 3L39A 5LGNB 2XAGB 5JRCB 3U78A 4J2CA 4ZHQE 2W63A 2QA7A 3ZT5A 4U31A 1IJ5A 3VKGA 4ILBA 4NXMT 5L4HA 4U7YA 1OEDA 5EK4A 4HFCA 3EDUA 2KWHA 4JBWF 2WWVA 3C4WA 4LF5T 2BS3A 2JQ9A 2CM0A 3AA6B 4KHZF 1WR0A 3UU4A 4GYRA 4ILUA 5AQUB 4DV4T 3IA3A 2PFVA 4YFSA 3P4WA 2JQQA 5JDGA 2N9DA 3PUSA 4O2BE 5KMGP 5H6QB 1D0YA 4IDZA 3H3AA 2YDRA 1YW0A 4U33A 5BR8T 5AQMB 4DUYT 4LMLA 3NRYA 3ZMZB 2XAJB 2DLRA 3RYCE 3AEBA 2NP9A 4IT4A 4EB6E 1FMVA 2WZHA 3ZSSA 3GWHA 1HG2A 4PK4A 4DR5T 4UELA 1UGOA 1XNQT 2QYWA 4G63A 5KXJA 4YSXA 4PAGA 4ILAA 3F2EA 4NUVA 4XBFB 5J2UE 2V26A 4X65T 4PK6A 1ZKEA 4IDPA 2EHOA 5FVKA 4CN6A 2NW9A 4DMWA 5LJMA 1J5ET 5FXWA 4AXPA 5LHIB 4TX5A 4KP3C 4QH5A 1JNZA 3GA8A 4GK5E 3RRWA 2LJLA 4H9QC 5FXXA 5LBQB 3FZMB 2X68A 1IBMT 5JR9C 2JJ9A 2BKPA 5L2LA 4Z91A 3N9QA 4IE4A 4F8HA 2VKJA 2XQAA 2L8KA 1R8IA 3HI2A 1BR4A 3NKZA 3ZYLA 4UVCB 5LHHB 3AEAA 3MJXA 3PUXF 3LSVA 3NWIA 1T98A 3ZC1A 1WFDA 5JRCA 3WAJA 2D5UA 2M67A 3E08A 4Z8XA 5HEUA 3QUJA 1E1HB
chains in the Genus database with same CATH topology
1SE7A 1DU2A 2XY8B 2AE9A 2IDOB 2AXDS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE7 A;  1DU2 A;  2XY8 B;  2AE9 A;  2IDO B;  2AXD S; 
#chains in the Genus database with same CATH topology
 2VK9 A;  3RYF E;  3WI3 A;  3EAB A;  5GON E;  5AQF B;  2DI4 A;  3M65 A;  5H6R B;  5CJ5 A;  5DJQ C;  3UU5 A;  3UUN A;  3MA9 A;  2MOZ A;  1KNZ A;  3AAA B;  1ZP0 A;  3O9X A;  4JI2 T;  1YXR A;  2XQY A;  2QGS A;  4ERR A;  1Z0P A;  4TWD A;  3HKD E;  3LDQ B;  5IUX A;  5AQR B;  2K5B B;  3HR0 A;  2Q9Q A;  5AQP B;  2DCF A;  1OED C;  4IL4 A;  1VCT A;  3I9W A;  4KI0 F;  1HCI A;  4DR3 T;  2XQ3 A;  4F6R C;  2WSS V;  2YU1 A;  5HYA A;  4UEM A;  1XDO A;  4TV9 E;  2LE8 A;  1UX5 A;  1VOM A;  1XDP A;  1YD8 G;  4YSY A;  3AB3 B;  1E7P A;  4DV5 T;  2H89 A;  2IC9 A;  1WR6 A;  2V6Y B;  4X62 T;  4YHJ A;  3LK2 B;  2WQY A;  2LSG A;  5C3J A;  2FJA A;  3K1S A;  2HPL A;  2YN6 A;  4JI4 T;  4QH4 A;  2UXN B;  3TKL B;  1YQ3 A;  3L09 A;  2C5I T;  5LGU B;  3FB2 A;  1U5P A;  1W09 A;  2BVL A;  2K9A A;  3UFG A;  2YDQ A;  4JI5 T;  4PJM A;  3FZK B;  3LK4 2;  3UT5 E;  4LF6 T;  2BS2 A;  3PU8 A;  3N2O A;  3ZT7 A;  3SS1 A;  3ZMS B;  5E0O A;  1S35 A;  2KSR A;  4QH1 A;  3PUG A;  2BZB A;  2VL8 A;  2HN2 A;  3QK6 A;  3ZC0 A;  4LFB T;  3N9L A;  4OK0 A;  4CXX A;  2XZE A;  2I0M A;  2M6I A;  3E0Z A;  4XZC A;  3UQ4 A;  4NIQ A;  3I1A A;  3QC9 A;  5ABH A;  3CVR A;  4MAL A;  1KNR A;  1OWA A;  1ZOY A;  2W0G A;  5FKY A;  1Y64 B;  4IE0 A;  3ZJ1 A;  4AKR B;  2UXX B;  3F57 A;  5LCY A;  2XM2 A;  1ZV4 X;  4O2A E;  4AIS A;  4IE5 A;  3P4S A;  3MK7 C;  4B6X A;  1MNE A;  2XSA A;  2ZM8 A;  1YKE B;  3RKG A;  3OJA A;  3RI5 A;  2CXD A;  4WBO A;  3PTR B;  2SPC A;  3NZP A;  1W0B A;  2W66 A;  4JI0 T;  3UU6 A;  4PFP A;  3D0T A;  3AE3 A;  2H7V C;  3K3Q C;  5JTG A;  4QXH B;  5AQN B;  2ZM2 A;  2F4V T;  1SE7 A;  2ZM0 A;  5ABE A;  5HAX A;  4X1I E;  5AQT B;  5HCM A;  3T1H T;  2V7J A;  4A98 A;  1DU2 A;  5ABF A;  4EED A;  5JH7 E;  5BMV E;  5HEO A;  4JUY A;  4QX8 B;  3AA0 B;  4OHF A;  1BR1 A;  3ONJ A;  2W67 A;  5JDL A;  5JDF A;  3CQG B;  3RIU A;  3AE8 A;  3O1J A;  2C0S A;  2ODV A;  4PJN A;  3BQL A;  2JRK A;  3QB5 K;  2HPJ A;  2BDE A;  1NEK A;  2XPK A;  4GYS A;  4WBN E;  4UVB B;  4IE6 A;  4E7S A;  3EI0 A;  5F5W A;  1H7C A;  1T7S A;  2V7M A;  2CBI A;  5M4Y A;  3UUM A;  3ONX A;  5JVD E;  3KBU A;  3P4P A;  4GKK T;  2C5J A;  3VU7 H;  1HNX T;  4ZI3 D;  3P7I A;  3PJA J;  2LLY A;  2EHO B;  2A3D A;  1UUS A;  1E2A A;  2MAW A;  4HFV A;  3TLT A;  5DQV A;  4YT0 A;  2YK0 A;  3K3O A;  3VHL A;  3RX6 A;  1W0A A;  3P4R A;  3Q5E A;  4CXY A;  1KK7 A;  4EGW A;  4KHP T;  3FXE B;  2PG8 A;  5L3E B;  4KUM B;  4I43 B;  3ZJ2 A;  4E7Z A;  3JCF A;  3C51 A;  2D2S A;  1N34 T;  4AQG A;  2UXB T;  3AAE B;  2Z6E A;  5HXH A;  4UIG A;  2DHR A;  5LYJ E;  2ZLY A;  3PU3 A;  2CHO A;  3AAI A;  2CCQ A;  5FNV E;  2UXD T;  2M6B A;  2QRX A;  3IF8 B;  3MKD A;  4OFZ A;  3ZMV B;  3VRB A;  1WYB A;  1XMO T;  3F31 A;  2BBH A;  2UUB T;  2HHH T;  2R6G F;  4Z90 A;  1OXZ A;  3SFD A;  2RA1 A;  4AIU A;  1GQE A;  4DV6 T;  5AQS B;  4HWI B;  3KV9 A;  5HCJ A;  2JMH A;  5FY0 A;  3EDV A;  3AA7 B;  3MXZ A;  4ZOL E;  2KND A;  5L4E A;  3S4U A;  4QHO A;  2UU9 T;  5JDN A;  3C64 A;  3VR9 A;  2D0T A;  1V9D A;  2LOP A;  4EV6 A;  3NRX A;  4COF A;  1KFY A;  3Q5W A;  3AVR A;  2Q9Q B;  4IDN A;  2G0U A;  3FXD B;  4L9I A;  3NBX X;  3CX6 B;  1AJ3 A;  2DWK A;  2PJQ A;  5FY7 A;  3FBL A;  4DVD A;  2WP9 A;  1HX8 A;  3UQ7 A;  2JIW A;  3QNU A;  2XQ4 A;  3UTK A;  1MIY A;  4UR9 A;  3PJA A;  1BR2 A;  3A7M A;  5CGM A;  3SRZ A;  4BJN A;  2LSJ A;  4GOU A;  5KX5 E;  2LHN A;  3EHZ A;  5FL1 A;  2BG9 E;  3CK6 A;  2UXC T;  4YTN A;  3A5X A;  2DNX A;  3ZCJ A;  2V6X A;  1BR0 A;  2CWO A;  2H7O A;  2NTY A;  2X9X A;  2ZM6 T;  5AQI B;  3HL6 A;  2YIN A;  4HFB A;  5LP6 E;  4FI5 A;  4B3S T;  4X1K E;  4LF4 T;  2XTL A;  4ISS A;  4U3C A;  2MYS A;  3T1Y T;  2X67 A;  1HF8 A;  2XY8 B;  5AQO B;  4AQF C;  2LSY A;  1IBK T;  2X66 A;  1MIV A;  5KDM C;  2V5D A;  5AQV B;  2CBJ A;  2W4X A;  2B76 A;  3OVU A;  4ASK A;  4DV1 T;  1QLB A;  2BVM A;  3KDS E;  3GMI A;  5LBM A;  1N36 T;  4TWH A;  2K3W A;  2WM9 A;  4HE8 A;  3KV4 A;  4YTM A;  4XAX B;  4A97 A;  4B3R T;  1D0Z A;  2E9X A;  2VVN A;  4DV2 T;  3ZYK A;  2WMO A;  4OYJ A;  3W15 B;  3KV5 A;  5L3F B;  4AKI A;  4CN4 A;  1IJ6 A;  2VKH A;  4NXN T;  5HEJ A;  2LT3 A;  4LMK A;  4HN9 A;  2KXP B;  4IST A;  3HKC E;  2IUB A;  4KMC A;  2VQF T;  1G8X A;  1IAP A;  3KIN B;  3LJC A;  2OA5 A;  3AVS A;  3PDY A;  3KFW X;  3OYX A;  5FVL A;  3JAE A;  2FBW A;  3PUY F;  3HA4 A;  4AKG A;  3KVB A;  3CX8 B;  4PJJ A;  2Y48 B;  3UUL A;  2X0Y A;  5ABF B;  4X64 T;  4C91 A;  3N9M A;  5LMU T;  2MPK A;  3BQI A;  3N9P A;  3P4Q A;  4YJ2 E;  5JDM A;  4JYA T;  4U7I A;  2LM2 A;  5IHY A;  3J7Y q;  3AE7 A;  5FXZ A;  1UK5 A;  1YKH B;  3FHN A;  4EYU A;  4QXC B;  1KF6 A;  1LVK A;  3AE6 A;  3SWH A;  4V1A v;  2WDV A;  2XJ7 A;  3Q9D A;  4I50 E;  3CX7 B;  3LK3 B;  3AED A;  2MTQ A;  2P9B A;  2AE9 A;  2BG9 A;  1D0X A;  3UUX B;  3HKE E;  4MHC A;  5HXE A;  2HH7 A;  4NUU A;  5EK3 A;  3ZEF B;  3V5S A;  5CA1 E;  2XUE A;  5JRE A;  4EXT A;  4X1Y E;  1MMA A;  1LVF A;  5LXT E;  2EHO D;  5L3G B;  2WBL A;  3FBZ A;  2A2F X;  3TLU A;  3CQC B;  1HNZ T;  5EZY E;  5AQJ B;  3ANW A;  5J1G A;  2BBJ A;  5FL0 A;  2B1E A;  4TZ4 C;  3RC3 A;  4QXB B;  2EHO C;  4UVA B;  4MFR A;  4EYY R;  1IZN B;  3N9N A;  2K24 A;  2CHN A;  4YLH A;  2IDO B;  2YKS A;  1I6Z A;  4H9P C;  2WU2 A;  2LSI A;  3LFM A;  3UFE A;  2V8S V;  1MND A;  4ADZ A;  3RLF F;  2UUC T;  4WZX A;  5ADX L;  4YTP A;  3NZQ A;  5LNK A;  3L3P A;  5LJN A;  2DL1 A;  2Y8D A;  3DJB A;  4X66 T;  2OLT A;  3TLV A;  4TWF A;  4PNI A;  5IYZ E;  5A1L A;  5IWA T;  3Q2M A;  4DMV A;  1VCS A;  3DTO A;  3QB5 A;  5AQH B;  5J0Z A;  3JAD A;  3BK9 A;  2KIN B;  2IHR 1;  1MMN A;  2KMF A;  5LGT B;  5FYM A;  3P50 A;  5LHG B;  4EAH A;  1OED E;  5JDH A;  5AQK B;  2BKO A;  4H9N C;  3ETU A;  3PV0 F;  2YEV C;  3C4X A;  3ZYM A;  2WCA A;  3K8P C;  4O4I E;  2X9Y A;  4I4T E;  1HTJ F;  4IRE A;  3RHW A;  1M7K A;  1FEW A;  1SHZ C;  2UUA T;  4N78 D;  2Q9Q D;  3C50 A;  5TAO A;  3ESL A;  2IML A;  3MZK B;  5HEG A;  1QUU A;  4HTE A;  4K0U A;  3IHR A;  4BAY B;  1ZEE A;  4A56 A;  2YOE A;  3AE5 A;  4EZ4 A;  4CXW A;  2L9Q A;  5CA0 E;  3CPZ A;  4HWF A;  4JI8 T;  2WU5 A;  4JI3 T;  3N2G E;  3G06 A;  1J5W A;  4ZS2 A;  2V7K A;  4MBQ A;  2LKH A;  3RGL A;  1KNP A;  2OV9 A;  3EUH A;  4OYK A;  4DV3 T;  4ZS3 A;  4ZEY A;  2Q9Q C;  2LRK A;  2XQ8 A;  2C5K T;  3UU8 A;  3CWZ B;  5FP3 A;  1N32 T;  5ABG A;  1XWM A;  1N33 T;  4B3M T;  5JR9 A;  2W00 A;  2YU2 A;  3RC8 A;  3LG7 A;  4ZZB A;  2CE7 A;  4P1N A;  3O1H A;  1Y01 A;  1I94 T;  1WCR A;  1FIO A;  4O4J E;  1U4Q A;  2WS3 A;  3H3M A;  1B7T A;  2E9X B;  3Q5D A;  4YSZ A;  3P8C D;  4UF0 A;  4HWH A;  3QOF A;  5LG3 A;  4IGU A;  4FJO A;  2K48 A;  4HFE A;  1D1B A;  4X5T A;  4CN1 A;  2FJB A;  3RKO A;  1FJG T;  3C4Z A;  4LF8 T;  4IHJ E;  2ES0 A;  3ZCI A;  5HXR A;  2WB5 A;  1LKX A;  2ODU A;  3ZMU B;  1G73 A;  4YHH T;  5F3J A;  3ONL C;  2ACX A;  5LG4 A;  1L0V A;  3I0Q A;  2D0U A;  4GIW A;  4H63 V;  4HFI A;  4IDQ A;  2VB6 A;  2WDQ A;  1HX1 B;  4I55 E;  4BJM A;  2KLQ A;  3R84 B;  1NEN A;  4JI6 T;  4WNK A;  3PUZ F;  2CMR A;  1X9B A;  3B57 A;  1HG5 A;  5JQG E;  5AQQ B;  1S94 A;  3N5L A;  4EZH A;  5LOV E;  4DR6 T;  3MAC A;  3HKB E;  3RQW A;  2XHE B;  2KZ7 B;  1MMG A;  4HGA A;  4PK5 A;  2PTF A;  1NAF A;  2A9U A;  3AEE A;  3LBX B;  2X51 A;  4L5G A;  4EEB A;  5C8Y E;  5FMN A;  3EVY A;  4TV8 E;  2BG9 B;  4JI7 T;  3I0O A;  2YDS A;  1MIW A;  5CFB A;  3RIU C;  4ZI2 D;  4K0K T;  3A8Y C;  4ZI7 E;  3PE0 A;  2WAU A;  4NPP A;  2FJE A;  2NTX A;  2H88 A;  3GN5 A;  2RPA A;  2CLY B;  4H9S E;  1CUN A;  2CWY A;  3KBT A;  3O1I A;  4I0U A;  4GKJ T;  5L47 A;  4WW0 A;  3AE4 A;  3ANW B;  3FZF B;  3OPC A;  4QKN A;  2W61 A;  3AXJ A;  1UUR A;  5L3C B;  4TUY E;  4ZI2 C;  3FZL B;  2NOX A;  1W9R A;  2DWG A;  3IEE A;  1KEY A;  1CHU A;  2CXF A;  3ZST A;  3CKD A;  1LRZ A;  2E2A A;  4IL9 A;  5HXS A;  3OKQ A;  4JEU B;  1US7 B;  5AQL B;  5HXC A;  4JV5 T;  1SUM B;  4TNV A;  2N1G A;  2KWI B;  4KBM B;  3AE2 A;  4ZZC A;  2VKO A;  4DID B;  2HN1 A;  5HEH A;  2E5L T;  4LMJ A;  3M3Z B;  3AE9 A;  2A72 A;  2NW8 A;  4ILC A;  2XAQ B;  4AKH A;  4IIJ E;  5AFU L;  3WAK A;  2LRL A;  3PUA A;  4QWN B;  2X0L B;  4PFO A;  4DV0 T;  2V7I A;  4LFC T;  4QX7 B;  2JMK A;  2X9H A;  1J1J A;  1IBL T;  3SOL A;  3TLS A;  1JNR A;  5LMN T;  1T8B A;  2IC6 A;  4U2Y A;  3AEF A;  4DBR A;  3OYZ A;  3RYH E;  3I9Y A;  5C2T A;  2V5C A;  1XMQ T;  3ZPO A;  3RH3 A;  2WY2 A;  2J4G A;  2LOS A;  3DP7 A;  4O4L E;  4UXN B;  4IE7 A;  1O3X A;  3K3N A;  5DAB A;  2WWU A;  1M62 A;  2NWB A;  3LBX A;  4JEH B;  5EK2 A;  1HR0 T;  3UU3 A;  2MBG A;  2CA5 A;  1NWM X;  3ETV A;  4P09 A;  1UX4 A;  3B13 A;  4UV9 B;  5CB4 E;  3FZH B;  3NVO A;  5HWX A;  3EAM A;  3TLW A;  1HFA A;  2BKN A;  1XZY A;  3H37 A;  4WYV A;  4CI3 B;  2ZMA A;  4H63 H;  2VWA A;  2W62 A;  1X79 A;  2E5V A;  2N2N A;  2LM9 A;  2VVS A;  2VQE T;  2J1D G;  4GK0 E;  4YY3 T;  4TN7 B;  4DBQ A;  4H9R C;  2VKD A;  4DND A;  4H9O C;  2XAF B;  5JR9 B;  1WYC A;  3PUR A;  2IAK A;  1VRB A;  2XQ7 A;  2CRB A;  2D9D A;  3ZT6 A;  1D1A A;  3VR8 A;  4EOZ B;  4DUZ T;  3E22 E;  4LF7 T;  4EIW A;  3AEG A;  1D1C A;  3RIF A;  2KT9 A;  4HEA A;  3KVA A;  3PUQ A;  3O4X E;  2LEH A;  2J47 A;  1T72 A;  2RP4 A;  1QSD A;  3ZKR A;  2WDR A;  4UF0 B;  4HWD A;  5DQW A;  4X20 E;  3ZMT B;  3RIA A;  3Q5X A;  5L3D B;  2IIU A;  4U74 A;  3R6N A;  2E9X D;  4KX6 A;  3RQU A;  4HKA A;  2QVA A;  3L8R A;  2BS4 A;  3ZN1 B;  3V5U A;  2VUR A;  5AQG B;  4B3T T;  3JC6 D;  4DR2 T;  3N2K E;  4AI6 A;  5FXV A;  3AE1 A;  4P0A A;  3VKH A;  2XQ5 A;  2XSB A;  3RRC A;  2AXD S;  5L3B B;  3OTO T;  2E9X C;  2JQK A;  3PUV F;  4PW8 A;  2W2U A;  2V7L A;  4P0B A;  1WRD A;  1OED B;  1EZ3 A;  3CML A;  3BQK A;  2CEA A;  4MLK A;  2X9W A;  3X1D A;  2PBI A;  4CI2 B;  4LFA T;  3JC6 C;  2JQH A;  1WLX A;  4L0R A;  3U3I A;  2J62 A;  4DR7 T;  3T8O A;  4M1P A;  4CQI A;  4DR4 T;  3PUW F;  5HWY A;  4AKL A;  4G2A A;  3RPU A;  4YXD A;  2WMN A;  3ABV A;  5JDQ A;  3IBP A;  2L3L A;  4YJ3 E;  3B5M A;  1FMW A;  2LSK A;  4DR1 T;  4CI1 B;  1HNW T;  2VAS A;  4O4H E;  4UV8 B;  2IW5 B;  3ZN0 B;  2XAH B;  3CIR A;  1YQ4 A;  2XQ6 A;  2FUP A;  3J9X 1;  3C98 B;  2Y6X A;  3SFE A;  2GK9 A;  3RYI E;  4U72 A;  4U2Z A;  3AEC A;  4CZZ B;  3RF1 A;  4AQF A;  2I59 A;  4Q25 A;  4HFD A;  2XAS B;  2ACZ A;  4JLE A;  2WZI A;  4IDO A;  4PJL A;  4DV7 T;  1Z8U A;  4O8S A;  3GN5 B;  2V6Y A;  2VL0 A;  4AQY T;  3ZLI A;  2NR4 A;  3N9O A;  4BA9 A;  3AA1 B;  2V1D B;  4HWC A;  2I6H A;  1UCU A;  5ETW A;  5LA6 E;  3AXJ B;  2BG9 C;  1MMD A;  5FY1 A;  2FJD A;  1HS7 A;  1SA0 E;  4TNW A;  4DO0 A;  2CPT A;  3OBV E;  5J2T E;  4ZXL A;  4OX9 T;  2XM1 A;  2CXL A;  3VRA A;  4ZI3 C;  4ANJ A;  2E8I A;  2LHR A;  2LKG A;  4LF9 T;  3JAF A;  2CLY C;  1XNR T;  3CQX C;  5LB7 B;  2H3R A;  4JI1 T;  2JPF A;  4HFH A;  2X0H A;  4C90 A;  3KV6 A;  1ZHC A;  4A5X A;  2NW7 A;  5F8P A;  3UUB A;  2XQ9 A;  3L39 A;  5LGN B;  2XAG B;  5JRC B;  3U78 A;  4J2C A;  4ZHQ E;  2W63 A;  2QA7 A;  3ZT5 A;  4U31 A;  1IJ5 A;  3VKG A;  4ILB A;  4NXM T;  5L4H A;  4U7Y A;  1OED A;  5EK4 A;  4HFC A;  3EDU A;  2KWH A;  4JBW F;  2WWV A;  3C4W A;  4LF5 T;  2BS3 A;  2JQ9 A;  2CM0 A;  3AA6 B;  4KHZ F;  1WR0 A;  3UU4 A;  4GYR A;  4ILU A;  5AQU B;  4DV4 T;  3IA3 A;  2PFV A;  4YFS A;  3P4W A;  2JQQ A;  5JDG A;  2N9D A;  3PUS A;  4O2B E;  5KMG P;  5H6Q B;  1D0Y A;  4IDZ A;  3H3A A;  2YDR A;  1YW0 A;  4U33 A;  5BR8 T;  5AQM B;  4DUY T;  4LML A;  3NRY A;  3ZMZ B;  2XAJ B;  2DLR A;  3RYC E;  3AEB A;  2NP9 A;  4IT4 A;  4EB6 E;  1FMV A;  2WZH A;  3ZSS A;  3GWH A;  1HG2 A;  4PK4 A;  4DR5 T;  4UEL A;  1UGO A;  1XNQ T;  2QYW A;  4G63 A;  5KXJ A;  4YSX A;  4PAG A;  4ILA A;  3F2E A;  4NUV A;  4XBF B;  5J2U E;  2V26 A;  4X65 T;  4PK6 A;  1ZKE A;  4IDP A;  2EHO A;  5FVK A;  4CN6 A;  2NW9 A;  4DMW A;  5LJM A;  1J5E T;  5FXW A;  4AXP A;  5LHI B;  4TX5 A;  4KP3 C;  4QH5 A;  1JNZ A;  3GA8 A;  4GK5 E;  3RRW A;  2LJL A;  4H9Q C;  5FXX A;  5LBQ B;  3FZM B;  2X68 A;  1IBM T;  5JR9 C;  2JJ9 A;  2BKP A;  5L2L A;  4Z91 A;  3N9Q A;  4IE4 A;  4F8H A;  2VKJ A;  2XQA A;  2L8K A;  1R8I A;  3HI2 A;  1BR4 A;  3NKZ A;  3ZYL A;  4UVC B;  5LHH B;  3AEA A;  3MJX A;  3PUX F;  3LSV A;  3NWI A;  1T98 A;  3ZC1 A;  1WFD A;  5JRC A;  3WAJ A;  2D5U A;  2M67 A;  3E08 A;  4Z8X A;  5HEU A;  3QUJ A;  1E1H B; 
#chains in the Genus database with same CATH homology
 1SE7 A;  1DU2 A;  2XY8 B;  2AE9 A;  2IDO B;  2AXD S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...