1E0ZA

[2fe-2s]-ferredoxin from halobacterium salinarum
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
128
structure length
127
Chain Sequence
b'PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAHLDYLQNRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e0zA00
1V97A 1PDXA 1SF0A 1NYRA 3FAHA 2KMMA 4YSXB 1N5XA 4ZOHC 1ZOYB 4KX6B 5GXGB 3NS1A 2BS3B 2DWQA 1RFKA 3HVZA 1QLBB 3BIID 1J7AA 1KF6B 5G5GA 1E7PB 2W54A 1TYGB 2CU3A 1XLOA 1V8CA 2KAJA 3VR8B 2BS2B 3P63A 1I7HA 2BS4B 1YJJA 1E0ZA 1WYGA 1WRIA 2FBWB 2L83A 1UWMA 2W55A 4IDIA 3VRBB 3P4QB 4C80A 1XO3A 1QF6A 2WU2B 1NYQA 3AE8B 2DBYA 1QOAA 2WDRB 3P4SB 4LTUA 2K22A 5EE9A 1WWTA 4YTNB 2JX5A 2H89B 5AUKA 1DGJA 2BT6A 4P6VF 5EE3A 3AE7B 4US8A 1RYJA 1KFYB 2CJOA 3NVWA 5EE0A 1E9MA 3ETRA 4YT0B 3AV8A 3P1MA 1JWAD 2LEKA 1FO4A 1ZUD2 1FXIA 4US9A 2E3TA 1YQ3B 2W3SA 1E10A 1A70A 2G1EA 3LB8C 1VJKA 2CJNA 2MJDA 1ZXIA 4YTPB 1JWBD 1E6EB 1JROA 3AH7A 5AUIA 1T3QA 3ABVB 1JQ4A 3P4PB 2WDQB 3NVYA 2B76B 1ROEA 4JWSC 1YJIA 2QJLA 3VR9B 2M19A 3AE5B 3AE9B 4FXCA 1L5PA 1L6VA 3DWMA 4N6EB 1DOIA 1FFUA 1F0ZA 2OHFA 2L52A 3NVZA 1WXQA 3AE2B 1SIJA 2H88B 3CWIA 3LXFA 1PFDA 4JX1C 3SFEB 4WWMA 4A9AA 2W3RA 3AM9A 4C7YA 1SB3C 1L0VB 1B9RA 5MPOA 1AYFA 2WQYB 3AEEB 2EKIA 1NVID 2WU5B 1OQRA 1TKYA 1NEKB 4YSYB 4HROA 3ZYYX 4YTMB 1RM6C 1DOXA 3FC4A 3NRZA 3AE4B 2HTME 1FIQA 2PVGC 1ZP0B 2WS3B 1FMAD 1KRHA 2WP9B 2PVOD 1N60A 1TJEA 1OQQA 5G5HA 3WCQA 1VLBA 2Y5CA 3AEDB 3B2GA 2K9XA 3AMZA 5H8YE 2MH7A 2M56B 1NENB 2PKOA 1L6UA 1JW9D 3AE3B 4USAA 5EE1A 3KWLA 1XLPA 3RPFC 3SFDB 3SR6A 5C2TB 4ZHPA 4YSZB 3AEFB 1FM0D 1JALA 2MJEA 3B9JA 1QOGA 4N59A 1N61A 3AEAB 1DOYA 2MJ3A 4ITKA 2QIEB 2N0SB 1CZPA 1XLNA 2JQRB 3L4PA 3W5UB 2Q5WD 3AB5A 1GPXA 1VDVA 1FFVA 1N62A 1TKGA 2WDVB 3CIRB 3NVVA 4N58A 1J7BA 3AE1B 4WQMA 3P4RB 1OFFA 4YXDB 5C3JB 2WLBA 1QOBA 1FXAA 2AX5A 1RWSA 2PIAA 1N63A 1XLQA 1R7SA 3AEBB 3W9CB 1QOFA 3HUIA 1NI3A 1JRPA 3DWGC 2ACZB 1J7CA 3AEGB 3PO0A 1QT9A 1WGKA 4HRSA 4C7ZA 4ZHOA 1GAQB 1EWYC 4JWUC 3B2FA 1AWDA 5H92C 3AE6B 3AN1A 1FRRA 3VRAB 2K5PA 1N5WA 1TKEA 3EUB2 1PUTA 3HRDD 1YQ4B 3W5VB 1CJEA 1FRDA 1IUEA 3AECB
chains in the Genus database with same CATH superfamily
1UF0A 1AW7A 1UD7A 1C9FA 1V80A 1XCTL 3AULA 1RFKA 2V0GA 3BIID 1WX8A 2AYOB 1UNSA 4RH6A 3HM6X 1YJJA 2D2QA 2FBWB 1UGJA 2L83A 2N7DA 1KOTA 3P4QB 1PGXA 4IG7B 3VUWA 1WXAA 5IAAC 2EMTA 4TSSA 1WR1A 4YTNB 2FNJB 2LVOA 3B0AA 4US8A 4TV3A 1TZOA 1D3ZA 2N9XA 3PZ7A 5D94A 2Z0EB 2V1YA 2KC2A 3PHXB 2V4LA 4LDTB 1GB1A 1P7FA 2PW9A 4S0RA 2D3BA 2GLSA 3I63C 1HZ6A 3J9CA 4B6WA 1V49A 1WM2A 4WURA 3UQAA 2L05A 5CHVC 4YSYB 1NEKB 1GG3A 3B08A 3R7RA 5LNK1 1WE6A 1ZP0B 3K9PB 4O1NA 2KK8A 4PK1A 2EKEC 3ZTCA 1V5TA 2QILA 2PKOA 4GSWA 1VRAB 3M3JA 1L2NA 4F1SA 2LJIA 4K7SA 2M8SA 4A6QA 1LXDA 1EO6A 4L23A 2ASQA 2X8XX 3ZGZA 4JE3B 1J19A 5IOIA 2AX5A 2PIAA 2GBKA 2A4ZA 3PPAA 1F2RI 3DWGC 3GS2A 3O13A 2FCMA 3AE6B 4ARIA 1F52A 3EUB2 1WGYA 1CJEA 1R4MB 1T6BX 1FRDA 4ANVA 3ZXVA 2D10A 1N5XA 1YX6B 1CK1A 4ZRQA 1KF6B 2WXOA 4DXFA 4P1CC 4PS8A 2WHIA 2LXCA 2LI5A 3Q3NC 3DVNU 1GJZA 3PRZA 1WMHA 4DHZE 3KLSX 4C4VA 3DBLB 2ZVNA 3JSVB 1C77A 1E90A 2Y5PA 3ETRA 1P3QU 3Q2AC 1L7YA 1WJNA 4DHZB 5AZFA 3GE3C 2I1JA 3PVLA 2KN5A 1JWBD 3A9KA 5D6JB 1JQ4A 4FN2A 3P4PB 1ROEA 2L3ZA 3DWMA 1KLUD 4AP4C 2PPHA 3NJTA 3IBEA 2H88B 5IKCM 1PQSA 2IPKD 4RNAA 4KGRA 3PS6A 1XD3B 5JHAA 4HEA1 2N9KA 3NRZA 4NPNA 1QKZA 1KRHA 1WGGA 3JYUA 3RCZA 2E6XA 3B2GA 1SXTA 2WX1A 3V62A 2LRWA 5H8YE 2MH7A 1L6UA 4ZHPA 3L08A 2MJEA 2NS5A 4D2KA 3RN9C 3QA8A 3E56A 1JWUD 2J42A 4EEWA 2V3SA 2IJ0A 4W9FA 3A33B 1QT9A 3L17A 4C7ZA 2GB1A 1EWYC 4F8CB 3MTNB 1N5WA 1TKEA 2KMAA 4ZRJA 4A3OA 1IUEA 2G45B 3UQBA 1Z5SB 3BVMA 2DWQA 4BAXA 3V3XA 2JY6A 1SE9A 1WSPA 4LNKA 2WXMA 2KDBA 3IT6B 3PT2B 3NS8A 2M4NA 2IGDA 1TGZB 5J18A 2MBBB 3VH3B 4IUMB 5EE3A 2CHXA 5LLIA 1WJUA 2BBCA 4HPLB 4OZBA 4DQOC 1WYWB 2LXAA 5HG2A 1R4NI 4OVZA 1EU4A 1OEYA 5L83A 1E8ZA 5AEKB 1C76A 3MC0B 1V86A 4RMAA 3FILB 3RUIB 1WZ3A 3BK2A 3BVGA 3AM9A 4ACFA 2KDEB 4WWNA 3EA6A 2NPTB 3DBSA 2PEAA 3ENEA 2AEHA 1TJEA 3LDZE 4PYZA 4KKJA 1RRBA 1UH6A 1K51A 2QEJC 1MJDA 4HLEA 3U52E 3AE3B 2JT4B 4K7WA 3ZNID 2AL6A 5T8IA 4G3XB 2RMMA 4M02A 3RYTA 4A20A 4BBNF 3QIJA 3OJ4B 1LGRA 3AU5A 4AQ7A 3KUCB 3RZFA 2WGSA 3U7DA 3PO0A 2KNBA 2DYOA 3KVFB 2BKRB 3HM3A 4IM3A 2C5LC 4LJPB 4JGHB 3VUXA 3DVGX 2LGIA 1KJTA 4MGIE 2KKCA 4YSXB 1PYWD 2LGXA 4HJGE 1ZOYB 5GXGB 3IG3A 1KLVA 2IDYA 2K6DB 4K7UA 1G6JA 3SD5A 2BS4B 3A1QB 1UBQA 3RMKC 3DDCB 1WZ0A 3MHSD 4II2B 1Q1OA 4W9LA 1SIFA 2WXPA 2RDGA 2KMCA 3PRPB 4WWOA 4GDLB 4NQKE 2R61A 1RAXA 4MSMB 1TTNA 3PSEB 4NAMA 3HHMA 4FHKA 1U4AA 4MGYE 1A70A 3UIPB 1JROA 2KWUB 3AH7A 3VAWA 2LUMA 3NVYA 2BTEA 3VH4B 3RT3B 2AWTA 1L5PA 4N6EB 2UYZB 1S3SG 2K25A 4LJOB 4BKTA 1RM6C 3FC4A 1YQBA 4MM3B 4GGQA 4WJQA 4KV2A 2DYBA 2Y5CA 2C7NB 2K9XA 3AMZA 2ZCCA 1P0RA 1ET6A 3UIOB 2JSVX 2MW5A 4MDKE 2NBVB 1MG8A 3GZNI 1DOYA 2MX2A 4ZYSA 4WAFA 2JXTA 4OVVA 1GUAB 3C8YA 4E3CA 4RM8A 1OFFA 2FCQA 1FXAA 1XQQA 4LCDE 4W9CA 3A9JB 3W9CB 1VR9A 2WYQA 3V61A 3B2FA 1LFDA 2EMSA 3DHIC 1DYQA 2KX0A 3FILA 1PDXA 1MVKA 2WXKA 4IM2A 3H8HA 2NPTA 3Q8FA 4KX6B 4BFRA 1WH3A 4HCNB 5G5GA 4RF0A 1ZGUB 4ICUA 1WRDB 2JRIB 5BYSA 1F77A 2FAZA 2LHDA 3ZXRA 3OLMD 1HE8A 4ASWC 3WALA 3BYYB 4HXDA 3AE7B 2K1FA 5J17A 4YT0B 1ZE3D 2M17A 1JWAD 2V9HA 3U30A 4B95A 2INPE 1E7VA 1V5OA 2XN9C 2Y3AA 3N9YC 2B76B 3SDLC 2G4DB 2N9LA 1P98A 3N1YC 3OAWA 4KSLC 1FCLA 3KW5B 1TZ1A 1PFDA 2IYDB 3QQ8B 2YEPF 2KXJA 1AYFA 4W9HA 4YTMB 2J7QB 1I42A 2PVOD 2MA9B 3A1QA 3WCQA 1VZ6A 2M0XA 1IBXA 1T0SC 4II3B 2OJWA 2KDIA 2MBQA 1PGAA 3HIZA 1H8CA 1GC6A 1TKGA 2FIFA 3N3KB 4WJNA 4DHJB 2RDHA 3P4RB 1MG4A 1WJ4A 4ANXA 2LVPA 2GBMA 2HTHA 2KOXA 1AWDA 3WIMA 4A3PA 3W5VB 4HKZE 4M01A 2J53A 1K52A 3A4SC 4BZAA 3ZW3A 4A55A 3ZJUA 3E9SA 1T0YA 4MM3A 1XLOA 4HPPA 4NY0A 5FKAC 5HFYA 1I4XA 1WYGA 4DK5A 3ZRCA 2PMVA 1WGDA 1B1ZA 2YEPB 4KVGB 2WU2B 4PS3A 5HHDG 5AUKA 4P6VF 1JRUA 1KFYB 3IVFA 1ZKHA 2KWCA 4KIKB 1E9MA 3IT4B 2LEKA 4GDKB 1FXIA 3RNCC 1GC7A 3A9JA 5C23A 4DXGA 1T3QA 3KUDB 4B0MA 5E6NA 3RULA 2KD0A 2YVCA 2QCZA 2GMIC 2EELA 5GMVA 3NVZA 3BVZA 2KLCA 3N20C 3LXFA 2O6VB 4M8NA 1EF1A 2L8JA 2IBIB 3LYYA 3ZKJC 4LNNA 1DOXA 1ZDXA 2WS3B 1FMAD 2WP9B 4JIOU 3R2TA 1ESFA 3W1YA 4JLCA 2WWZA 4K81A 2ZW0A 3DBRI 3V6CB 4G11A 3KH0A 1N61A 2FE8A 3EC8A 4AS1A 1WR6E 3MJ5A 2JQRB 1ZW7A 3VVWB 4WQMA 4YXDB 4GMVA 1XLQA 1WGHA 1VD2A 2NBWB 2KTRB 1P7EA 4JWUC 2RDBC 3VFKA 3WA0A 2BF8B 2G4SA 2BGFA 4EZLA 3HK0A 1D5XC 4ZOHC 4BKSA 4URKA 3PLUA 4MH8A 4W9EA 1L4DB 2ZJDA 5CHFA 2W54A 1OTRB 2KZRA 5IO9A 3P63A 4K3BA 2NCNA 3TSSA 2KFJA 1UWMA 1STEA 2ZNVC 3BK1A 2NTSA 3RI7C 3P4SB 1NBFC 2LD9A 2IO2B 1WWTA 1EUVB 4OHJA 2MWSB 1RYJA 3QK0A 1LQBA 2CJOA 2M0AA 2YLMA 2KQ7A 4IWPA 2RR9A 2KJ6A 3NZUA 5KHOA 1QZEA 1SE2A 4M0WA 5AUIA 1XF5L 1E8XA 1YMHE 2DX5B 2QJLA 3AE5B 2D3AA 3R2IA 1F0ZA 2NR2A 3NG0A 2W3RA 1L0VB 3ML8A 3AEEB 2EKIA 2FCNA 2PLPA 4AUQC 3PV1A 4TQ0A 1OQQA 5G5HA 4B9KA 3WAMA 2LGYA 4LNFA 3I9V1 5EE1A 3ZNHB 3SR6A 4C00A 1GPXA 3L4PA 4GDKA 3AE1B 2KVZA 2LJ5A 1SE3A 1QOBA 3X23A 1RWSA 2BKFA 3T3OA 2Z0DB 1NI3A 3ZNZB 1E7UA 3URYA 2DYMA 2K8HA 4RGNA 1LO5D 2J0MA 2K5PA 3HRDD 3QCAA 3UI3A 4FJZA 4NJCA 3RNFC 5JH5C 1N6ZA 4RFBA 3OJ3A 3BINA 3PZDA 4XE0A 4MJSB 2WXIA 2INCC 1E7PB 4JL9A 3VR8B 5BO4B 1T0RC 3TEXA 4BOSC 1MPEA 3CSTA 4CHKA 1P9DU 2W55A 1MFWA 4LTUA 3IAM1 3L0WB 4RGOS 3ZO5B 3KQ4A 1TS5A 3NVWA 3GP7A 2HJ8A 2MLBA 4XDCA 1YQ3B 3ZRFA 2G1EA 2IY1B 2CJNA 2DZMA 4HPMB 2J0JA 3PTFC 1Z2MA 2KTRA 2L00B 4KSKC 2QHOA 4FULA 1FFUA 4FJVB 1PGBA 1EU3A 4NZLB 4CYEA 2WNMA 3M63B 2PJHA 3APFA 1BUIC 3ALBA 2C9WB 2HTME 2MP2B 1IP9A 2ZPNA 2M56B 1WXMA 1XLPA 2Y5BB 2LASA 4LLGM 4YSZB 1FM0D 4N59A 2AQ2B 3W1SA 2DHZA 4TQ1A 2JWUA 3Q8CA 3WAPA 2WDVB 3QWZB 2RSUA 3Q3MC 2MSED 2SAKA 5IN7A 2ACZB 1XXGA 1GAQB 3H7PB 1D4BA 1J0GA 4ANWA 2GRIA 1I4HA 3GE8C 2KT7A 3AN1A 2L0TA 1FNWA 2KYWA 2LRUA 2XK5B 2JXXA 4USAA 3X0WA 2KACA 3JSVA 1YX5B 3H9DA 5BMGA 1V9JA 3HVZA 1ZPSA 2N7EA 3DVNV 4ZRPA 3PHWB 2KO3A 1V8CA 3ZLZA 1QQRA 4GOCA 3SEBA 3BZDB 1D5ZC 1IYFA 4NAWB 3Q8BA 4IOIE 4P1BC 1QOAA 1S1QB 4S17A 2K22A 1Q10A 5FR3A 2N9PC 3CF6E 2FCSA 4E71A 2BT6A 1YN5A 1YNTE 2RPQA 4MH0E 5D3DA 3Q6BA 4I6PA 3AV8A 4EZKA 4US9A 3N1XC 1TY0A 3C0RB 3K9OB 3VHTC 2WDQB 2DZJA 2DAJA 3TL5A 2RPVA 1OGWA 1DOIA 5JXVA 4XDDA 4LNIA 2C60A 2VZKB 2LVQA 4RGMA 3M95A 1HQRD 4RCOA 1SB3C 4J3OD 3I57A 2WU5B 4FHJA 4MJSA 4MELA 2IY0B 2IO0B 5EDSA 5E6OA 2VH1A 1WIAA 3EHVA 3SFDB 2IGHA 3QAQA 3VTWA 1K50A 1R4MI 4FJYA 4C56C 3AEAB 3V05A 3DPDA 1KLGD 4B0EA 3VDZA 3NY5A 4IWOA 3DCGA 3Q8AA 1Y8RC 1VDVA 2KDFB 1J7BA 3UINB 5HKHA 3P2BA 3AEBB 1QOFA 2N9EB 4KGTA 1WGKA 2GBJA 2K8CA 3A4RA 4HDQA 4ZRKA 4MT5A 1TT5B 4KGSA 3AECB 1KH0A 1JMLA 2WXNA 3WANA 2L32A 2BVCA 3PRMB 1C78A 4IM0A 4W9DA 2QSDA 2K3UA 4TMAB 2AL3A 2INDC 1J8CA 1M4VA 1HXYD 3KYDD 3TUOA 1XO3A 2V4IB 1NYQA 2UWQA 3AE8B 2WDRB 2HD5B 5CHWA 3N1ZC 1WX7A 3P1MA 1FO4A 2W3SA 2KDMA 3LB8C 3R7QA 2GI9A 5JHBA 2MQJA 1V1OA 3H7PA 3Q69A 4BVUC 1YJIA 2N7JA 4DDGD 4FXCA 3SHQA 4NNJB 2N4FA 2XK5A 2LGSA 3AI5A 3ZJTA 2BYTA 2JZ3B 4WWMA 3ZYYX 1OQRA 4PS7A 4NJ6A 1ZDVA 4XWWA 2SEBD 3RZWC 2XBBC 2KLGA 1I35A 2WXJA 3ZQ4A 2R2QA 1JALA 3AB5A 3C19A 3EFUA 2JUOA 4BBNC 1EM7A 3KYCD 3AEGB 1J7CA 4ZHOA 1V6EA 4GXBA 3W2DA 1FRRA 2QDFA 1WXSA 3L13A 2JX5A 4GDLA 2KANA 1SF0A 2KMMA 3JVZX 1FCCC 3ZJVA 2D07B 1QLBB 4ARCA 1RLFA 2JF5A 4ZYNA 1TYGB 2WXFA 2BS2B 3TCAA 1Q5WB 2IGGA 3NZ3A 4EOYA 1WY8A 3GOEA 5LXIB 3VRBB 3WAOA 3Q8EA 4A8XC 3H7SA 1TS3A 5I4DA 2KWVB 4AOFA 2N1VA 3QHTA 3RNAC 4GB9A 2DENB 1ZUD2 3H1UA 1E10A 1ET9A 1XEEA 4K3CA 4FBJB 4FADA 4WWPA 1L6VA 1YIWA 4UDUC 3NHEB 2OHFA 4C4VB 1WXQA 4DXAB 4ICVA 3CWIA 4JX1C 1MI0A 2FIDA 1WM3A 4A9AA 1I4QA 4HROA 1KTKA 1GOZA 3Q3FA 4LDTD 3BY4B 1R4NB 2OJRA 3N30A 3L10B 4OW0A 1VLBA 4YL8A 2KFKB 3LJ3A 1C4PA 2DLBA 2MRPA 3KWLA 3RPFC 5BYRA 5C2TB 3U4EG 2L1AA 4XWTA 2NBUA 2MHJA 2MJ3A 3RNGC 1XCQL 1XLNA 3PZ8A 5CTRC 2CHZA 2JYEA 2G9HD 5FR6A 3DHHC 5C3JB 2IO1B 1C4CA 3CSFA 4R3DA 1JRPA 2IO3B 4I6LB 2D3CA 1HEZE 3VRAB 4OZAA 4EE2A 1WGRA 3M62B 2HE7A 2FUG1 4TKNA 1V97A 4IKGA 4QAYA 1HZ5A 2V3PA 4NQLB 3V60A 2PTLA 2ONQA 4PYUA 4XYCA 3D32A 1L0XB 3VTUA 2ICIA 4AJWA 2WX0A 4MEMA 2PE9A 1YJ1A 2BWES 3ZVVA 1QF6A 5EE9A 2J0KA 4KDLB 2WXGA 5EE0A 1EWCA 4KZCA 3T3NA 4GN1A 2LHEA 1X1MA 3ONSA 3R8BA 5BMIA 2CR5A 3B1LX 3L54A 3TEWA 1ZXIA 4G0NB 1Y56A 2JPHA 2RD0A 1WFYA 2G3QB 4PT5A 5BYQA 3DBHI 3APDA 3SFEB 2BPSA 3NUHB 2N1WA 1K53A 1RFAA 2VH2A 4W9IA 1V2YA 1V81A 4GU2A 4EKUA 3H6NA 2I2YA 4FLHA 4EFOA 3O65B 1NENB 1JW9D 4X57B 2WXHA 3TEYA 3Q3JA 3B9JA 1KM7A 1T5XD 3AU4A 2BYVE 4ZDVA 2N0SB 3VUYA 1AN8A 1N62A 1WI0A 3NVVA 3Q3OC 1TS2A 1NDDA 4P16A 1EF5A 4JPSA 1UZXB 3R66C 1R7SA 4MGZE 1P1AA 3IXSA 1GB4A 2GBNA 4HWIB 5H92C 1HA5A 2QMTA 5IP4D 2O2VB 2WXRA 2BWFA 1ENFA 3GZNB 4KIKA 4EZJA 1E8WA 1J7AA 4RGTA 4WH4A 2IZVB 4M8MA 1E0ZA 3I5JC 2BW2A 2KFKA 1WRIA 2MBOA 2DZIA 2KJRA 4IDIA 2KHWB 4E74A 5D2MB 5E6PA 1I4PA 1VCBA 2H89B 2KQSA 2O6VA 3OWEB 3ZTDA 2L7RA 1QILA 2PE6B 4IWQA 2HJ1A 3NOBA 1BXTA 2E3TA 2WXQA 4FA6A 3ABVB 4J6IA 4H2AA 4XZ4A 2WDTB 3VR9B 4CO7A 2W82A 2Z59B 1E8YA 1YOVB 5FK9C 2OOBB 4KZ0A 5MPOA 2OEDA 3GB1A 1T0QC 3PREA 1SJED 1D6EC 2AQ3B 3P42A 2VRRB 1FIQA 2TSSA 3KWVA 2ZCBA 5G2NA 3QARA 1WE7A 1C3TA 2L0FA 3W1SC 1TBEA 5DCNA 1L4ZB 1K8RB 3ZNGC 5DPRA 1YN3A 2GOWA 3TEZA 5CX3A 3W5UB 3DOWA 2JU6X 1VZ7A 2WLBA 1N63A 1FNUA 2D5GA 2V3NA 3OG5A 2WXLA 1H4RA 2REXA 4YWGG 2M1MA 1PUTA 5TSSA 1WXVA 1AARA 4YTPB 2ZEQA 1NYRA 3IAS1 4BKGA 1WX9A 2ZW1A 2JZPA 4M00A 4EUTA 2BYFA 2KAJA 1F1HA 2DAFA 2BYEA 2K6QA 1I7HA 1FPYA 1XT9B 3QX1A 2LUEA 3QJZA 2LGDA 3MFGA 2KTFA 5IA7A 1YD8U 1D5MC 1C1YB 4HK2A 4HDOA 4LNOA 2LWPA 1IPGA 1SGHA 2MJDA 3SU8X 2D11A 3ZIMA 2CHWA 2VZKD 2O2VA 2NVUI 1BT0A 1HTOA 1OEYJ 2QC8A 5BMHA 5L95C 3U7ZA 2ZZPB 5LXHA 4C7YA 1UGMA 4CQNA 4HKQA 1B9RA 4XX5A 2DZKA 4W9GA 2GBRA 1WJ6A 5G55A 2B3AA 1SSNA 1I4GA 1HTQA 2K0PA 4P7IA 2KQ4X 1N60A 3DQVA 5JZEB 3IHPC 3AEDB 5C1ZA 3TIXA 2CKHB 3ECIA 1OQYA 2ZVOA 3T9LA 2LMCA 3VXWA 3UF8A 2JZZA 2BB5A 1SBBB 2NMQA 3CMMB 4N9F4 1A5RA 2MBEA 1UBIA 5J2RA 1CZPA 1MHXA 2D3GA 1FFVA 3CIRB 3DVGY 4MACA 1SJHD 3MC9A 4ANUA 2K39A 3ML9A 1JWSD 3EFCA 1LM8B 2BB6A 4LK0M 1IBXB 4XGAB 3ZDTA 2KN4A 3IFWB 2LZ6A 2MCNB 3EECA 1SE4A 2KX3A 4I6NB 3DBRB 1ZXHA 1M94A 3U8ZA 2KJHB 4KKIA 3FAHA 2CS4A 1CQVA 2KC1A 1SEBD 3NS1A 4WJPA 5AZHA 1GNUA 3HVDA 3N32A 2CU3A 2L76A 2JRHA 3RFZB 3MP9A 3T8MA 1BMLC 3DBLI 1DGJA 4DDID 3PGEA 3ZUNA 1JCKB 3VTVA 2K8BA 4IC7B 2J4XA 1VJKA 2MP2A 4WQOB 3I3TB 2I1KA 5DPTA 4W9KA 2AQ1B 2HDEA 4AJYB 3DBHB 1C4AA 1V1PB 3AE2B 4DBGA 2ON8A 1SIJA 3EGRA 3DHGC 2KWDA 4KDIC 4WAAA 1NVID 4GLSC 2XNAC 5D7GA 5DPWA 1MHHE 2MEKA 5KHQA 4REZA 3V6EB 4NJ7A 3RD2A 3Q14C 2C7HA 3AEFB 4AWJA 4BKSD 4ITKA 3NZSA 2R2OA 2JWZA 2NTTA 3S2AA 2Q5WD 3MJWA 1VZ8A 4N58A 5D3IB 3VQIA 1NI2A 5HI1A 1WF9A 4HJKA 4L2YA 2ZPYA 4NAWA 4TUUA 1JWMD 3ZDMC 1FD6A 4RM9A 3QC8B 2KVRA 3UGBB 2FUHB 4HCPB 1YQ4B 4JWSC 4K1RB 4DHJD 4Q2JA 1FXTB 3JW0X 1F9JA 2LFIA 2BS3B 3TMPB 1IGDA 2BQQA 4JQWC 4HVBA 3KUZA 1FNVA 4C80A 2DBYA 4OVUA 1E5WA 2XEWA 4MGKE 3AXCA 2JYTA 4G50A 4L1BA 3BWUD 2INNE 2RGFA 1E6EB 1IGCA 2JVCA 1TY2A 4GIVA 2M19A 2MBHA 3AE9B 3RNBC 5TR5A 4BOZB 2CU1A 3APCA 2L52A 3MC8A 3MHZA 4XC2A 5AZGA 4IW0A 1I4RA 2UU7A 1UELA 2J52A 1FEHA 3R3MA 1F2RC 2WQYB 1TKYA 3AE4B 1L0YB 2PVGC 2X38A 3U2SC 1Q0WB 5DPSA 4M0WB 1YN4A 3RNEC 4ZRIA 5E6JA 3BYTB 4WJOA 2O6VD 3TJPA 1WMHB 4WIPA 1ISNA 4F7ZA 1QOGA 1UUPA 3L16A 2I38A 2QIEB 4RF1A 3FKYA 3PLVA 2ZNVB 4DWFA 1ACCA 2C7MB 3TBLD 1CMXB 1TIFA 1C79A 3HUIA 2A5UA 4HRSA 3A9KB 1TS4A 2DNFA 1UWXA 4OZCA 4W9JA 1V1PA 4A90A 2Z8LA 2W9NA 4MSQB
chains in the Genus database with same CATH topology
1PDXA 1MVKA 2KACA 2WXKA 1AW7A 3H8HA 1C9FA 1XCTL 3Q8FA 4KX6B 5BMGA 1RFKA 3HVZA 1ZPSA 3BIID 2V0GA 1J7AA 4ZRPA 4RGTA 5G5GA 1V8CA 1UNSA 4RH6A 4WH4A 1QQRA 3SEBA 3BZDB 4RF0A 1D5ZC 1YJJA 1E0ZA 2BW2A 4NAWB 1WRIA 3Q8BA 2FBWB 5BYSA 1F77A 1UGJA 2L83A 4IOIE 4IDIA 3P4QB 1PGXA 2LHDA 1QOAA 2K22A 4TSSA 1Q10A 5FR3A 1I4PA 4YTNB 2H89B 3OWEB 3BYYB 2BT6A 1QILA 3AE7B 4US8A 1YN5A 1TZOA 1YNTE 3PZ7A 5D3DA 4YT0B 3AV8A 1ZE3D 1JWAD 1BXTA 4US9A 2E3TA 2WXQA 1TY0A 2INPE 3ABVB 2WDQB 4H2AA 1P7FA 2XN9C 2PW9A 2B76B 2Y3AA 3N9YC 1GB1A 3VR9B 2N9LA 2RPVA 2W82A 1DOIA 5JXVA 1HZ6A 3J9CA 4XDDA 1FCLA 5FK9C 2VZKB 1PFDA 4RGMA 1HQRD 4WURA 4RCOA 1SB3C 2YEPF 3I57A 4J3OD 5MPOA 1AYFA 2OEDA 3GB1A 2WU5B 4YSYB 1NEKB 4YTMB 1SJED 1D6EC 2AQ3B 3P42A 5LNK1 1FIQA 1ZP0B 2TSSA 3KWVA 4O1NA 2PVOD 3WCQA 1VZ6A 2QILA 2PKOA 1L4ZB 1IBXA 1VRAB 3SFDB 2IGHA 1YN3A 2LJIA 1K50A 4A6QA 3TEZA 1PGAA 4C56C 4L23A 3AEAB 3V05A 1KLGD 4B0EA 3W5UB 3Q8AA 1VDVA 2JU6X 1TKGA 3ZGZA 4JE3B 1J7BA 1VZ7A 2RDHA 3P4RB 2WLBA 2AX5A 2PIAA 1N63A 1FNUA 2D5GA 2V3NA 3AEBB 1QOFA 1F2RI 4KGTA 3DWGC 1WGKA 3GS2A 2WXLA 3O13A 1AWDA 3AE6B 4MT5A 4ARIA 4YWGG 3EUB2 1PUTA 5TSSA 4KGSA 3W5VB 1CJEA 1FRDA 1T6BX 4YTPB 3AECB 1KH0A 4HKZE 2J53A 1K52A 1NYRA 3IAS1 1JMLA 2WXNA 1N5XA 2ZW1A 2L32A 4A55A 1CK1A 2JZPA 1C78A 4ZRQA 2QSDA 1KF6B 2K3UA 2WXOA 3E9SA 4DXFA 3ZJUA 1XLOA 2KAJA 4TMAB 5FKAC 1I7HA 5HFYA 1I4XA 1WYGA 2PMVA 1M4VA 1B1ZA 2YEPB 1HXYD 3TUOA 1XO3A 2V4IB 2WU2B 1NYQA 3AE8B 5HHDG 2WDRB 3KLSX 3MFGA 5AUKA 4P6VF 1D5MC 1KFYB 1C77A 2Y5PA 1E9MA 3ETRA 3IT4B 3P1MA 2LEKA 1FO4A 4GDKB 1FXIA 2W3SA 2KDMA 3LB8C 2MJDA 1JWBD 4DXGA 2GI9A 1T3QA 1JQ4A 3P4PB 1V1OA 3Q69A 4B0MA 1ROEA 1YJIA 2N7JA 2VZKD 4FXCA 3DWMA 1KLUD 2EELA 3NVZA 3BVZA 3ZJTA 2H88B 3LXFA 5BMHA 2BYTA 3U7ZA 2IPKD 4RNAA 4WWMA 4KGRA 4C7YA 4CQNA 1B9RA 4HKQA 3ZYYX 1OQRA 3LYYA 4HEA1 2N9KA 1DOXA 1ZDXA 3NRZA 1SSNA 1I4GA 1ZDVA 2WS3B 2K0PA 1FMAD 1QKZA 1KRHA 2WP9B 2KQ4X 1N60A 3R2TA 4XWWA 2E6XA 3AEDB 3B2GA 1SXTA 2SEBD 5H8YE 1ESFA 2MH7A 1L6UA 4ZHPA 2LMCA 2WXJA 3ZQ4A 2BB5A 1SBBB 1JALA 2NMQA 2ZW0A 2MJEA 1N61A 2FE8A 4D2KA 4AS1A 3E56A 1CZPA 1JWUD 1MHXA 2J42A 2JQRB 3MJ5A 3AB5A 1FFVA 3CIRB 4MACA 1SJHD 4WQMA 1EM7A 4YXDB 2IJ0A 1XLQA 1JWSD 3AEGB 1J7CA 4ZHOA 1QT9A 4C7ZA 2BB6A 2GB1A 1EWYC 1P7EA 4JWUC 4LK0M 1IBXB 2KN4A 3W2DA 1FRRA 1N5WA 1TKEA 1SE4A 2JX5A 1ZXHA 1IUEA 1SF0A 4KKIA 3FAHA 2KMMA 1CQVA 1FCCC 1SEBD 1D5XC 3BVMA 4ZOHC 3ZJVA 3NS1A 2DWQA 4MH8A 1QLBB 4ARCA 1L4DB 3V3XA 3HVDA 2W54A 1TYGB 2CU3A 2WXFA 2BS2B 3P63A 1WSPA 2WXMA 3IT6B 2IGGA 3NZ3A 2IGDA 3RFZB 3TSSA 1UWMA 3VRBB 4A8XC 3MP9A 3Q8EA 1STEA 3BK1A 2NTSA 3P4SB 1WWTA 1BMLC 1TS3A 1DGJA 5EE3A 4OHJA 5I4DA 1RYJA 1JCKB 2CJOA 2M0AA 2BBCA 2J4XA 4OZBA 1ZUD2 4DQOC 1E10A 1ET9A 5HG2A 4OVZA 1EU4A 1VJKA 1SE2A 1XEEA 4M0WA 5AUIA 1XF5L 1YMHE 2QJLA 1C76A 3MC0B 3AE5B 2AQ1B 2HDEA 1L6VA 3R2IA 4UDUC 1F0ZA 2OHFA 1C4AA 1V1PB 1WXQA 3AE2B 2ON8A 1SIJA 3CWIA 3FILB 3EGRA 1MI0A 4JX1C 3BK2A 3BVGA 4A9AA 2W3RA 3AM9A 1L0VB 2KWDA 3AEEB 3EA6A 2EKIA 1NVID 1I4QA 4GLSC 1KTKA 4HROA 2PLPA 1GOZA 2XNAC 5D7GA 1TJEA 4OW0A 4TQ0A 1OQQA 1MHHE 4KKJA 5G5HA 2MEKA 1VLBA 4REZA 2QEJC 1K51A 3U52E 1C4PA 3AE3B 3I9V1 5EE1A 2DLBA 3KWLA 3RPFC 3SR6A 5BYRA 5C2TB 3U4EG 5T8IA 2L1AA 3AEFB 4XWTA 2MJ3A 4ITKA 2RMMA 2NTTA 1GPXA 1XCQL 1XLNA 3L4PA 3PZ8A 2Q5WD 1VZ8A 4N58A 5D3IB 2JYEA 3AE1B 2G9HD 3VQIA 5HI1A 1SE3A 5C3JB 1QOBA 4AQ7A 1RWSA 3T3OA 1C4CA 4R3DA 4L2YA 1NI3A 1JRPA 3PO0A 3URYA 2DYMA 1JWMD 2DYOA 1FD6A 4RGNA 1LO5D 1HEZE 3VRAB 2K5PA 4OZAA 3HRDD 4EE2A 1YQ4B 4JWSC 2FUG1 1V97A 2LGIA 4NJCA 4IKGA 3UI3A 4Q2JA 4YSXB 1HZ5A 1PYWD 2V3PA 4RFBA 4HJGE 1ZOYB 2LFIA 5GXGB 2BS3B 2PTLA 1IGDA 2ONQA 4XE0A 2IDYA 1L0XB 2WXIA 1E7PB 3VR8B 3TEXA 2ICIA 1MPEA 2BS4B 1FNVA 2W55A 1QF6A 4C80A 2WXPA 2RDGA 2DBYA 4LTUA 3IAM1 5EE9A 4GDLB 4RGOS 2R61A 3KQ4A 1TS5A 2WXGA 4NAMA 3NVWA 5EE0A 1EWCA 3GP7A 2JYTA 3T3NA 4L1BA 3BWUD 4XDCA 2LHEA 2INNE 1YQ3B 3R8BA 1A70A 2G1EA 5BMIA 3TEWA 2CJNA 1ZXIA 1E6EB 1JROA 1Y56A 3AH7A 2LUMA 3NVYA 1IGCA 2BTEA 4PT5A 1TY2A 2M19A 3AE9B 1L5PA 5BYQA 4N6EB 1FFUA 2L52A 1PGBA 3MHZA 1I4RA 2J52A 3SFEB 1EU3A 1FEHA 3NUHB 4NZLB 1F2RC 1K53A 2WNMA 2WQYB 1TKYA 1RM6C 3FC4A 1BUIC 3AE4B 1L0YB 2HTME 2PVGC 2X38A 3U2SC 4MM3B 1YN4A 2Y5CA 2K9XA 3AMZA 2I2YA 5E6JA 3BYTB 2M56B 1NENB 1JW9D 1XLPA 1ET6A 2WXHA 2JSVX 4WIPA 4LLGM 4YSZB 3TEYA 1FM0D 3B9JA 1QOGA 1UUPA 1T5XD 4N59A 1DOYA 2AQ2B 3W1SA 4TQ1A 2I38A 2JWUA 2QIEB 2JXTA 4RF1A 2N0SB 4WAFA 3Q8CA 4ZYSA 1AN8A 1N62A 2WDVB 3NVVA 4P16A 1TS2A 3C8YA 1ACCA 4JPSA 1OFFA 1FXAA 1R7SA 3W9CB 2SAKA 3HUIA 1C79A 2ACZB 3IXSA 4HRSA 1VR9A 1TS4A 1XXGA 1GAQB 1D4BA 1GB4A 3B2FA 2GRIA 1UWXA 1I4HA 5H92C 4OZCA 1HA5A 2QMTA 3AN1A 1FNWA 1DYQA 1V1PA 4A90A 3FILA 2Z8LA 4USAA 2WXRA 1ENFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  1PDX A;  1SF0 A;  1NYR A;  3FAH A;  2KMM A;  4YSX B;  1N5X A;  4ZOH C;  1ZOY B;  4KX6 B;  5GXG B;  3NS1 A;  2BS3 B;  2DWQ A;  1RFK A;  3HVZ A;  1QLB B;  3BII D;  1J7A A;  1KF6 B;  5G5G A;  1E7P B;  2W54 A;  1TYG B;  2CU3 A;  1XLO A;  1V8C A;  2KAJ A;  3VR8 B;  2BS2 B;  3P63 A;  1I7H A;  2BS4 B;  1YJJ A;  1E0Z A;  1WYG A;  1WRI A;  2FBW B;  2L83 A;  1UWM A;  2W55 A;  4IDI A;  3VRB B;  3P4Q B;  4C80 A;  1XO3 A;  1QF6 A;  2WU2 B;  1NYQ A;  3AE8 B;  2DBY A;  1QOA A;  2WDR B;  3P4S B;  4LTU A;  2K22 A;  5EE9 A;  1WWT A;  4YTN B;  2JX5 A;  2H89 B;  5AUK A;  1DGJ A;  2BT6 A;  4P6V F;  5EE3 A;  3AE7 B;  4US8 A;  1RYJ A;  1KFY B;  2CJO A;  3NVW A;  5EE0 A;  1E9M A;  3ETR A;  4YT0 B;  3AV8 A;  3P1M A;  1JWA D;  2LEK A;  1FO4 A;  1ZUD 2;  1FXI A;  4US9 A;  2E3T A;  1YQ3 B;  2W3S A;  1E10 A;  1A70 A;  2G1E A;  3LB8 C;  1VJK A;  2CJN A;  2MJD A;  1ZXI A;  4YTP B;  1JWB D;  1E6E B;  1JRO A;  3AH7 A;  5AUI A;  1T3Q A;  3ABV B;  1JQ4 A;  3P4P B;  2WDQ B;  3NVY A;  2B76 B;  1ROE A;  4JWS C;  1YJI A;  2QJL A;  3VR9 B;  2M19 A;  3AE5 B;  3AE9 B;  4FXC A;  1L5P A;  1L6V A;  3DWM A;  4N6E B;  1DOI A;  1FFU A;  1F0Z A;  2OHF A;  2L52 A;  3NVZ A;  1WXQ A;  3AE2 B;  1SIJ A;  2H88 B;  3CWI A;  3LXF A;  1PFD A;  4JX1 C;  3SFE B;  4WWM A;  4A9A A;  2W3R A;  3AM9 A;  4C7Y A;  1SB3 C;  1L0V B;  1B9R A;  5MPO A;  1AYF A;  2WQY B;  3AEE B;  2EKI A;  1NVI D;  2WU5 B;  1OQR A;  1TKY A;  1NEK B;  4YSY B;  4HRO A;  3ZYY X;  4YTM B;  1RM6 C;  1DOX A;  3FC4 A;  3NRZ A;  3AE4 B;  2HTM E;  1FIQ A;  2PVG C;  1ZP0 B;  2WS3 B;  1FMA D;  1KRH A;  2WP9 B;  2PVO D;  1N60 A;  1TJE A;  1OQQ A;  5G5H A;  3WCQ A;  1VLB A;  2Y5C A;  3AED B;  3B2G A;  2K9X A;  3AMZ A;  5H8Y E;  2MH7 A;  2M56 B;  1NEN B;  2PKO A;  1L6U A;  1JW9 D;  3AE3 B;  4USA A;  5EE1 A;  3KWL A;  1XLP A;  3RPF C;  3SFD B;  3SR6 A;  5C2T B;  4ZHP A;  4YSZ B;  3AEF B;  1FM0 D;  1JAL A;  2MJE A;  3B9J A;  1QOG A;  4N59 A;  1N61 A;  3AEA B;  1DOY A;  2MJ3 A;  4ITK A;  2QIE B;  2N0S B;  1CZP A;  1XLN A;  2JQR B;  3L4P A;  3W5U B;  2Q5W D;  3AB5 A;  1GPX A;  1VDV A;  1FFV A;  1N62 A;  1TKG A;  2WDV B;  3CIR B;  3NVV A;  4N58 A;  1J7B A;  3AE1 B;  4WQM A;  3P4R B;  1OFF A;  4YXD B;  5C3J B;  2WLB A;  1QOB A;  1FXA A;  2AX5 A;  1RWS A;  2PIA A;  1N63 A;  1XLQ A;  1R7S A;  3AEB B;  3W9C B;  1QOF A;  3HUI A;  1NI3 A;  1JRP A;  3DWG C;  2ACZ B;  1J7C A;  3AEG B;  3PO0 A;  1QT9 A;  1WGK A;  4HRS A;  4C7Z A;  4ZHO A;  1GAQ B;  1EWY C;  4JWU C;  3B2F A;  1AWD A;  5H92 C;  3AE6 B;  3AN1 A;  1FRR A;  3VRA B;  2K5P A;  1N5W A;  1TKE A;  3EUB 2;  1PUT A;  3HRD D;  1YQ4 B;  3W5V B;  1CJE A;  1FRD A;  1IUE A;  3AEC B; 
#chains in the Genus database with same CATH topology
 1UF0 A;  1AW7 A;  1UD7 A;  1C9F A;  1V80 A;  1XCT L;  3AUL A;  1RFK A;  2V0G A;  3BII D;  1WX8 A;  2AYO B;  1UNS A;  4RH6 A;  3HM6 X;  1YJJ A;  2D2Q A;  2FBW B;  1UGJ A;  2L83 A;  2N7D A;  1KOT A;  3P4Q B;  1PGX A;  4IG7 B;  3VUW A;  1WXA A;  5IAA C;  2EMT A;  4TSS A;  1WR1 A;  4YTN B;  2FNJ B;  2LVO A;  3B0A A;  4US8 A;  4TV3 A;  1TZO A;  1D3Z A;  2N9X A;  3PZ7 A;  5D94 A;  2Z0E B;  2V1Y A;  2KC2 A;  3PHX B;  2V4L A;  4LDT B;  1GB1 A;  1P7F A;  2PW9 A;  4S0R A;  2D3B A;  2GLS A;  3I63 C;  1HZ6 A;  3J9C A;  4B6W A;  1V49 A;  1WM2 A;  4WUR A;  3UQA A;  2L05 A;  5CHV C;  4YSY B;  1NEK B;  1GG3 A;  3B08 A;  3R7R A;  5LNK 1;  1WE6 A;  1ZP0 B;  3K9P B;  4O1N A;  2KK8 A;  4PK1 A;  2EKE C;  3ZTC A;  1V5T A;  2QIL A;  2PKO A;  4GSW A;  1VRA B;  3M3J A;  1L2N A;  4F1S A;  2LJI A;  4K7S A;  2M8S A;  4A6Q A;  1LXD A;  1EO6 A;  4L23 A;  2ASQ A;  2X8X X;  3ZGZ A;  4JE3 B;  1J19 A;  5IOI A;  2AX5 A;  2PIA A;  2GBK A;  2A4Z A;  3PPA A;  1F2R I;  3DWG C;  3GS2 A;  3O13 A;  2FCM A;  3AE6 B;  4ARI A;  1F52 A;  3EUB 2;  1WGY A;  1CJE A;  1R4M B;  1T6B X;  1FRD A;  4ANV A;  3ZXV A;  2D10 A;  1N5X A;  1YX6 B;  1CK1 A;  4ZRQ A;  1KF6 B;  2WXO A;  4DXF A;  4P1C C;  4PS8 A;  2WHI A;  2LXC A;  2LI5 A;  3Q3N C;  3DVN U;  1GJZ A;  3PRZ A;  1WMH A;  4DHZ E;  3KLS X;  4C4V A;  3DBL B;  2ZVN A;  3JSV B;  1C77 A;  1E90 A;  2Y5P A;  3ETR A;  1P3Q U;  3Q2A C;  1L7Y A;  1WJN A;  4DHZ B;  5AZF A;  3GE3 C;  2I1J A;  3PVL A;  2KN5 A;  1JWB D;  3A9K A;  5D6J B;  1JQ4 A;  4FN2 A;  3P4P B;  1ROE A;  2L3Z A;  3DWM A;  1KLU D;  4AP4 C;  2PPH A;  3NJT A;  3IBE A;  2H88 B;  5IKC M;  1PQS A;  2IPK D;  4RNA A;  4KGR A;  3PS6 A;  1XD3 B;  5JHA A;  4HEA 1;  2N9K A;  3NRZ A;  4NPN A;  1QKZ A;  1KRH A;  1WGG A;  3JYU A;  3RCZ A;  2E6X A;  3B2G A;  1SXT A;  2WX1 A;  3V62 A;  2LRW A;  5H8Y E;  2MH7 A;  1L6U A;  4ZHP A;  3L08 A;  2MJE A;  2NS5 A;  4D2K A;  3RN9 C;  3QA8 A;  3E56 A;  1JWU D;  2J42 A;  4EEW A;  2V3S A;  2IJ0 A;  4W9F A;  3A33 B;  1QT9 A;  3L17 A;  4C7Z A;  2GB1 A;  1EWY C;  4F8C B;  3MTN B;  1N5W A;  1TKE A;  2KMA A;  4ZRJ A;  4A3O A;  1IUE A;  2G45 B;  3UQB A;  1Z5S B;  3BVM A;  2DWQ A;  4BAX A;  3V3X A;  2JY6 A;  1SE9 A;  1WSP A;  4LNK A;  2WXM A;  2KDB A;  3IT6 B;  3PT2 B;  3NS8 A;  2M4N A;  2IGD A;  1TGZ B;  5J18 A;  2MBB B;  3VH3 B;  4IUM B;  5EE3 A;  2CHX A;  5LLI A;  1WJU A;  2BBC A;  4HPL B;  4OZB A;  4DQO C;  1WYW B;  2LXA A;  5HG2 A;  1R4N I;  4OVZ A;  1EU4 A;  1OEY A;  5L83 A;  1E8Z A;  5AEK B;  1C76 A;  3MC0 B;  1V86 A;  4RMA A;  3FIL B;  3RUI B;  1WZ3 A;  3BK2 A;  3BVG A;  3AM9 A;  4ACF A;  2KDE B;  4WWN A;  3EA6 A;  2NPT B;  3DBS A;  2PEA A;  3ENE A;  2AEH A;  1TJE A;  3LDZ E;  4PYZ A;  4KKJ A;  1RRB A;  1UH6 A;  1K51 A;  2QEJ C;  1MJD A;  4HLE A;  3U52 E;  3AE3 B;  2JT4 B;  4K7W A;  3ZNI D;  2AL6 A;  5T8I A;  4G3X B;  2RMM A;  4M02 A;  3RYT A;  4A20 A;  4BBN F;  3QIJ A;  3OJ4 B;  1LGR A;  3AU5 A;  4AQ7 A;  3KUC B;  3RZF A;  2WGS A;  3U7D A;  3PO0 A;  2KNB A;  2DYO A;  3KVF B;  2BKR B;  3HM3 A;  4IM3 A;  2C5L C;  4LJP B;  4JGH B;  3VUX A;  3DVG X;  2LGI A;  1KJT A;  4MGI E;  2KKC A;  4YSX B;  1PYW D;  2LGX A;  4HJG E;  1ZOY B;  5GXG B;  3IG3 A;  1KLV A;  2IDY A;  2K6D B;  4K7U A;  1G6J A;  3SD5 A;  2BS4 B;  3A1Q B;  1UBQ A;  3RMK C;  3DDC B;  1WZ0 A;  3MHS D;  4II2 B;  1Q1O A;  4W9L A;  1SIF A;  2WXP A;  2RDG A;  2KMC A;  3PRP B;  4WWO A;  4GDL B;  4NQK E;  2R61 A;  1RAX A;  4MSM B;  1TTN A;  3PSE B;  4NAM A;  3HHM A;  4FHK A;  1U4A A;  4MGY E;  1A70 A;  3UIP B;  1JRO A;  2KWU B;  3AH7 A;  3VAW A;  2LUM A;  3NVY A;  2BTE A;  3VH4 B;  3RT3 B;  2AWT A;  1L5P A;  4N6E B;  2UYZ B;  1S3S G;  2K25 A;  4LJO B;  4BKT A;  1RM6 C;  3FC4 A;  1YQB A;  4MM3 B;  4GGQ A;  4WJQ A;  4KV2 A;  2DYB A;  2Y5C A;  2C7N B;  2K9X A;  3AMZ A;  2ZCC A;  1P0R A;  1ET6 A;  3UIO B;  2JSV X;  2MW5 A;  4MDK E;  2NBV B;  1MG8 A;  3GZN I;  1DOY A;  2MX2 A;  4ZYS A;  4WAF A;  2JXT A;  4OVV A;  1GUA B;  3C8Y A;  4E3C A;  4RM8 A;  1OFF A;  2FCQ A;  1FXA A;  1XQQ A;  4LCD E;  4W9C A;  3A9J B;  3W9C B;  1VR9 A;  2WYQ A;  3V61 A;  3B2F A;  1LFD A;  2EMS A;  3DHI C;  1DYQ A;  2KX0 A;  3FIL A;  1PDX A;  1MVK A;  2WXK A;  4IM2 A;  3H8H A;  2NPT A;  3Q8F A;  4KX6 B;  4BFR A;  1WH3 A;  4HCN B;  5G5G A;  4RF0 A;  1ZGU B;  4ICU A;  1WRD B;  2JRI B;  5BYS A;  1F77 A;  2FAZ A;  2LHD A;  3ZXR A;  3OLM D;  1HE8 A;  4ASW C;  3WAL A;  3BYY B;  4HXD A;  3AE7 B;  2K1F A;  5J17 A;  4YT0 B;  1ZE3 D;  2M17 A;  1JWA D;  2V9H A;  3U30 A;  4B95 A;  2INP E;  1E7V A;  1V5O A;  2XN9 C;  2Y3A A;  3N9Y C;  2B76 B;  3SDL C;  2G4D B;  2N9L A;  1P98 A;  3N1Y C;  3OAW A;  4KSL C;  1FCL A;  3KW5 B;  1TZ1 A;  1PFD A;  2IYD B;  3QQ8 B;  2YEP F;  2KXJ A;  1AYF A;  4W9H A;  4YTM B;  2J7Q B;  1I42 A;  2PVO D;  2MA9 B;  3A1Q A;  3WCQ A;  1VZ6 A;  2M0X A;  1IBX A;  1T0S C;  4II3 B;  2OJW A;  2KDI A;  2MBQ A;  1PGA A;  3HIZ A;  1H8C A;  1GC6 A;  1TKG A;  2FIF A;  3N3K B;  4WJN A;  4DHJ B;  2RDH A;  3P4R B;  1MG4 A;  1WJ4 A;  4ANX A;  2LVP A;  2GBM A;  2HTH A;  2KOX A;  1AWD A;  3WIM A;  4A3P A;  3W5V B;  4HKZ E;  4M01 A;  2J53 A;  1K52 A;  3A4S C;  4BZA A;  3ZW3 A;  4A55 A;  3ZJU A;  3E9S A;  1T0Y A;  4MM3 A;  1XLO A;  4HPP A;  4NY0 A;  5FKA C;  5HFY A;  1I4X A;  1WYG A;  4DK5 A;  3ZRC A;  2PMV A;  1WGD A;  1B1Z A;  2YEP B;  4KVG B;  2WU2 B;  4PS3 A;  5HHD G;  5AUK A;  4P6V F;  1JRU A;  1KFY B;  3IVF A;  1ZKH A;  2KWC A;  4KIK B;  1E9M A;  3IT4 B;  2LEK A;  4GDK B;  1FXI A;  3RNC C;  1GC7 A;  3A9J A;  5C23 A;  4DXG A;  1T3Q A;  3KUD B;  4B0M A;  5E6N A;  3RUL A;  2KD0 A;  2YVC A;  2QCZ A;  2GMI C;  2EEL A;  5GMV A;  3NVZ A;  3BVZ A;  2KLC A;  3N20 C;  3LXF A;  2O6V B;  4M8N A;  1EF1 A;  2L8J A;  2IBI B;  3LYY A;  3ZKJ C;  4LNN A;  1DOX A;  1ZDX A;  2WS3 B;  1FMA D;  2WP9 B;  4JIO U;  3R2T A;  1ESF A;  3W1Y A;  4JLC A;  2WWZ A;  4K81 A;  2ZW0 A;  3DBR I;  3V6C B;  4G11 A;  3KH0 A;  1N61 A;  2FE8 A;  3EC8 A;  4AS1 A;  1WR6 E;  3MJ5 A;  2JQR B;  1ZW7 A;  3VVW B;  4WQM A;  4YXD B;  4GMV A;  1XLQ A;  1WGH A;  1VD2 A;  2NBW B;  2KTR B;  1P7E A;  4JWU C;  2RDB C;  3VFK A;  3WA0 A;  2BF8 B;  2G4S A;  2BGF A;  4EZL A;  3HK0 A;  1D5X C;  4ZOH C;  4BKS A;  4URK A;  3PLU A;  4MH8 A;  4W9E A;  1L4D B;  2ZJD A;  5CHF A;  2W54 A;  1OTR B;  2KZR A;  5IO9 A;  3P63 A;  4K3B A;  2NCN A;  3TSS A;  2KFJ A;  1UWM A;  1STE A;  2ZNV C;  3BK1 A;  2NTS A;  3RI7 C;  3P4S B;  1NBF C;  2LD9 A;  2IO2 B;  1WWT A;  1EUV B;  4OHJ A;  2MWS B;  1RYJ A;  3QK0 A;  1LQB A;  2CJO A;  2M0A A;  2YLM A;  2KQ7 A;  4IWP A;  2RR9 A;  2KJ6 A;  3NZU A;  5KHO A;  1QZE A;  1SE2 A;  4M0W A;  5AUI A;  1XF5 L;  1E8X A;  1YMH E;  2DX5 B;  2QJL A;  3AE5 B;  2D3A A;  3R2I A;  1F0Z A;  2NR2 A;  3NG0 A;  2W3R A;  1L0V B;  3ML8 A;  3AEE B;  2EKI A;  2FCN A;  2PLP A;  4AUQ C;  3PV1 A;  4TQ0 A;  1OQQ A;  5G5H A;  4B9K A;  3WAM A;  2LGY A;  4LNF A;  3I9V 1;  5EE1 A;  3ZNH B;  3SR6 A;  4C00 A;  1GPX A;  3L4P A;  4GDK A;  3AE1 B;  2KVZ A;  2LJ5 A;  1SE3 A;  1QOB A;  3X23 A;  1RWS A;  2BKF A;  3T3O A;  2Z0D B;  1NI3 A;  3ZNZ B;  1E7U A;  3URY A;  2DYM A;  2K8H A;  4RGN A;  1LO5 D;  2J0M A;  2K5P A;  3HRD D;  3QCA A;  3UI3 A;  4FJZ A;  4NJC A;  3RNF C;  5JH5 C;  1N6Z A;  4RFB A;  3OJ3 A;  3BIN A;  3PZD A;  4XE0 A;  4MJS B;  2WXI A;  2INC C;  1E7P B;  4JL9 A;  3VR8 B;  5BO4 B;  1T0R C;  3TEX A;  4BOS C;  1MPE A;  3CST A;  4CHK A;  1P9D U;  2W55 A;  1MFW A;  4LTU A;  3IAM 1;  3L0W B;  4RGO S;  3ZO5 B;  3KQ4 A;  1TS5 A;  3NVW A;  3GP7 A;  2HJ8 A;  2MLB A;  4XDC A;  1YQ3 B;  3ZRF A;  2G1E A;  2IY1 B;  2CJN A;  2DZM A;  4HPM B;  2J0J A;  3PTF C;  1Z2M A;  2KTR A;  2L00 B;  4KSK C;  2QHO A;  4FUL A;  1FFU A;  4FJV B;  1PGB A;  1EU3 A;  4NZL B;  4CYE A;  2WNM A;  3M63 B;  2PJH A;  3APF A;  1BUI C;  3ALB A;  2C9W B;  2HTM E;  2MP2 B;  1IP9 A;  2ZPN A;  2M56 B;  1WXM A;  1XLP A;  2Y5B B;  2LAS A;  4LLG M;  4YSZ B;  1FM0 D;  4N59 A;  2AQ2 B;  3W1S A;  2DHZ A;  4TQ1 A;  2JWU A;  3Q8C A;  3WAP A;  2WDV B;  3QWZ B;  2RSU A;  3Q3M C;  2MSE D;  2SAK A;  5IN7 A;  2ACZ B;  1XXG A;  1GAQ B;  3H7P B;  1D4B A;  1J0G A;  4ANW A;  2GRI A;  1I4H A;  3GE8 C;  2KT7 A;  3AN1 A;  2L0T A;  1FNW A;  2KYW A;  2LRU A;  2XK5 B;  2JXX A;  4USA A;  3X0W A;  2KAC A;  3JSV A;  1YX5 B;  3H9D A;  5BMG A;  1V9J A;  3HVZ A;  1ZPS A;  2N7E A;  3DVN V;  4ZRP A;  3PHW B;  2KO3 A;  1V8C A;  3ZLZ A;  1QQR A;  4GOC A;  3SEB A;  3BZD B;  1D5Z C;  1IYF A;  4NAW B;  3Q8B A;  4IOI E;  4P1B C;  1QOA A;  1S1Q B;  4S17 A;  2K22 A;  1Q10 A;  5FR3 A;  2N9P C;  3CF6 E;  2FCS A;  4E71 A;  2BT6 A;  1YN5 A;  1YNT E;  2RPQ A;  4MH0 E;  5D3D A;  3Q6B A;  4I6P A;  3AV8 A;  4EZK A;  4US9 A;  3N1X C;  1TY0 A;  3C0R B;  3K9O B;  3VHT C;  2WDQ B;  2DZJ A;  2DAJ A;  3TL5 A;  2RPV A;  1OGW A;  1DOI A;  5JXV A;  4XDD A;  4LNI A;  2C60 A;  2VZK B;  2LVQ A;  4RGM A;  3M95 A;  1HQR D;  4RCO A;  1SB3 C;  4J3O D;  3I57 A;  2WU5 B;  4FHJ A;  4MJS A;  4MEL A;  2IY0 B;  2IO0 B;  5EDS A;  5E6O A;  2VH1 A;  1WIA A;  3EHV A;  3SFD B;  2IGH A;  3QAQ A;  3VTW A;  1K50 A;  1R4M I;  4FJY A;  4C56 C;  3AEA B;  3V05 A;  3DPD A;  1KLG D;  4B0E A;  3VDZ A;  3NY5 A;  4IWO A;  3DCG A;  3Q8A A;  1Y8R C;  1VDV A;  2KDF B;  1J7B A;  3UIN B;  5HKH A;  3P2B A;  3AEB B;  1QOF A;  2N9E B;  4KGT A;  1WGK A;  2GBJ A;  2K8C A;  3A4R A;  4HDQ A;  4ZRK A;  4MT5 A;  1TT5 B;  4KGS A;  3AEC B;  1KH0 A;  1JML A;  2WXN A;  3WAN A;  2L32 A;  2BVC A;  3PRM B;  1C78 A;  4IM0 A;  4W9D A;  2QSD A;  2K3U A;  4TMA B;  2AL3 A;  2IND C;  1J8C A;  1M4V A;  1HXY D;  3KYD D;  3TUO A;  1XO3 A;  2V4I B;  1NYQ A;  2UWQ A;  3AE8 B;  2WDR B;  2HD5 B;  5CHW A;  3N1Z C;  1WX7 A;  3P1M A;  1FO4 A;  2W3S A;  2KDM A;  3LB8 C;  3R7Q A;  2GI9 A;  5JHB A;  2MQJ A;  1V1O A;  3H7P A;  3Q69 A;  4BVU C;  1YJI A;  2N7J A;  4DDG D;  4FXC A;  3SHQ A;  4NNJ B;  2N4F A;  2XK5 A;  2LGS A;  3AI5 A;  3ZJT A;  2BYT A;  2JZ3 B;  4WWM A;  3ZYY X;  1OQR A;  4PS7 A;  4NJ6 A;  1ZDV A;  4XWW A;  2SEB D;  3RZW C;  2XBB C;  2KLG A;  1I35 A;  2WXJ A;  3ZQ4 A;  2R2Q A;  1JAL A;  3AB5 A;  3C19 A;  3EFU A;  2JUO A;  4BBN C;  1EM7 A;  3KYC D;  3AEG B;  1J7C A;  4ZHO A;  1V6E A;  4GXB A;  3W2D A;  1FRR A;  2QDF A;  1WXS A;  3L13 A;  2JX5 A;  4GDL A;  2KAN A;  1SF0 A;  2KMM A;  3JVZ X;  1FCC C;  3ZJV A;  2D07 B;  1QLB B;  4ARC A;  1RLF A;  2JF5 A;  4ZYN A;  1TYG B;  2WXF A;  2BS2 B;  3TCA A;  1Q5W B;  2IGG A;  3NZ3 A;  4EOY A;  1WY8 A;  3GOE A;  5LXI B;  3VRB B;  3WAO A;  3Q8E A;  4A8X C;  3H7S A;  1TS3 A;  5I4D A;  2KWV B;  4AOF A;  2N1V A;  3QHT A;  3RNA C;  4GB9 A;  2DEN B;  1ZUD 2;  3H1U A;  1E10 A;  1ET9 A;  1XEE A;  4K3C A;  4FBJ B;  4FAD A;  4WWP A;  1L6V A;  1YIW A;  4UDU C;  3NHE B;  2OHF A;  4C4V B;  1WXQ A;  4DXA B;  4ICV A;  3CWI A;  4JX1 C;  1MI0 A;  2FID A;  1WM3 A;  4A9A A;  1I4Q A;  4HRO A;  1KTK A;  1GOZ A;  3Q3F A;  4LDT D;  3BY4 B;  1R4N B;  2OJR A;  3N30 A;  3L10 B;  4OW0 A;  1VLB A;  4YL8 A;  2KFK B;  3LJ3 A;  1C4P A;  2DLB A;  2MRP A;  3KWL A;  3RPF C;  5BYR A;  5C2T B;  3U4E G;  2L1A A;  4XWT A;  2NBU A;  2MHJ A;  2MJ3 A;  3RNG C;  1XCQ L;  1XLN A;  3PZ8 A;  5CTR C;  2CHZ A;  2JYE A;  2G9H D;  5FR6 A;  3DHH C;  5C3J B;  2IO1 B;  1C4C A;  3CSF A;  4R3D A;  1JRP A;  2IO3 B;  4I6L B;  2D3C A;  1HEZ E;  3VRA B;  4OZA A;  4EE2 A;  1WGR A;  3M62 B;  2HE7 A;  2FUG 1;  4TKN A;  1V97 A;  4IKG A;  4QAY A;  1HZ5 A;  2V3P A;  4NQL B;  3V60 A;  2PTL A;  2ONQ A;  4PYU A;  4XYC A;  3D32 A;  1L0X B;  3VTU A;  2ICI A;  4AJW A;  2WX0 A;  4MEM A;  2PE9 A;  1YJ1 A;  2BWE S;  3ZVV A;  1QF6 A;  5EE9 A;  2J0K A;  4KDL B;  2WXG A;  5EE0 A;  1EWC A;  4KZC A;  3T3N A;  4GN1 A;  2LHE A;  1X1M A;  3ONS A;  3R8B A;  5BMI A;  2CR5 A;  3B1L X;  3L54 A;  3TEW A;  1ZXI A;  4G0N B;  1Y56 A;  2JPH A;  2RD0 A;  1WFY A;  2G3Q B;  4PT5 A;  5BYQ A;  3DBH I;  3APD A;  3SFE B;  2BPS A;  3NUH B;  2N1W A;  1K53 A;  1RFA A;  2VH2 A;  4W9I A;  1V2Y A;  1V81 A;  4GU2 A;  4EKU A;  3H6N A;  2I2Y A;  4FLH A;  4EFO A;  3O65 B;  1NEN B;  1JW9 D;  4X57 B;  2WXH A;  3TEY A;  3Q3J A;  3B9J A;  1KM7 A;  1T5X D;  3AU4 A;  2BYV E;  4ZDV A;  2N0S B;  3VUY A;  1AN8 A;  1N62 A;  1WI0 A;  3NVV A;  3Q3O C;  1TS2 A;  1NDD A;  4P16 A;  1EF5 A;  4JPS A;  1UZX B;  3R66 C;  1R7S A;  4MGZ E;  1P1A A;  3IXS A;  1GB4 A;  2GBN A;  4HWI B;  5H92 C;  1HA5 A;  2QMT A;  5IP4 D;  2O2V B;  2WXR A;  2BWF A;  1ENF A;  3GZN B;  4KIK A;  4EZJ A;  1E8W A;  1J7A A;  4RGT A;  4WH4 A;  2IZV B;  4M8M A;  1E0Z A;  3I5J C;  2BW2 A;  2KFK A;  1WRI A;  2MBO A;  2DZI A;  2KJR A;  4IDI A;  2KHW B;  4E74 A;  5D2M B;  5E6P A;  1I4P A;  1VCB A;  2H89 B;  2KQS A;  2O6V A;  3OWE B;  3ZTD A;  2L7R A;  1QIL A;  2PE6 B;  4IWQ A;  2HJ1 A;  3NOB A;  1BXT A;  2E3T A;  2WXQ A;  4FA6 A;  3ABV B;  4J6I A;  4H2A A;  4XZ4 A;  2WDT B;  3VR9 B;  4CO7 A;  2W82 A;  2Z59 B;  1E8Y A;  1YOV B;  5FK9 C;  2OOB B;  4KZ0 A;  5MPO A;  2OED A;  3GB1 A;  1T0Q C;  3PRE A;  1SJE D;  1D6E C;  2AQ3 B;  3P42 A;  2VRR B;  1FIQ A;  2TSS A;  3KWV A;  2ZCB A;  5G2N A;  3QAR A;  1WE7 A;  1C3T A;  2L0F A;  3W1S C;  1TBE A;  5DCN A;  1L4Z B;  1K8R B;  3ZNG C;  5DPR A;  1YN3 A;  2GOW A;  3TEZ A;  5CX3 A;  3W5U B;  3DOW A;  2JU6 X;  1VZ7 A;  2WLB A;  1N63 A;  1FNU A;  2D5G A;  2V3N A;  3OG5 A;  2WXL A;  1H4R A;  2REX A;  4YWG G;  2M1M A;  1PUT A;  5TSS A;  1WXV A;  1AAR A;  4YTP B;  2ZEQ A;  1NYR A;  3IAS 1;  4BKG A;  1WX9 A;  2ZW1 A;  2JZP A;  4M00 A;  4EUT A;  2BYF A;  2KAJ A;  1F1H A;  2DAF A;  2BYE A;  2K6Q A;  1I7H A;  1FPY A;  1XT9 B;  3QX1 A;  2LUE A;  3QJZ A;  2LGD A;  3MFG A;  2KTF A;  5IA7 A;  1YD8 U;  1D5M C;  1C1Y B;  4HK2 A;  4HDO A;  4LNO A;  2LWP A;  1IPG A;  1SGH A;  2MJD A;  3SU8 X;  2D11 A;  3ZIM A;  2CHW A;  2VZK D;  2O2V A;  2NVU I;  1BT0 A;  1HTO A;  1OEY J;  2QC8 A;  5BMH A;  5L95 C;  3U7Z A;  2ZZP B;  5LXH A;  4C7Y A;  1UGM A;  4CQN A;  4HKQ A;  1B9R A;  4XX5 A;  2DZK A;  4W9G A;  2GBR A;  1WJ6 A;  5G55 A;  2B3A A;  1SSN A;  1I4G A;  1HTQ A;  2K0P A;  4P7I A;  2KQ4 X;  1N60 A;  3DQV A;  5JZE B;  3IHP C;  3AED B;  5C1Z A;  3TIX A;  2CKH B;  3ECI A;  1OQY A;  2ZVO A;  3T9L A;  2LMC A;  3VXW A;  3UF8 A;  2JZZ A;  2BB5 A;  1SBB B;  2NMQ A;  3CMM B;  4N9F 4;  1A5R A;  2MBE A;  1UBI A;  5J2R A;  1CZP A;  1MHX A;  2D3G A;  1FFV A;  3CIR B;  3DVG Y;  4MAC A;  1SJH D;  3MC9 A;  4ANU A;  2K39 A;  3ML9 A;  1JWS D;  3EFC A;  1LM8 B;  2BB6 A;  4LK0 M;  1IBX B;  4XGA B;  3ZDT A;  2KN4 A;  3IFW B;  2LZ6 A;  2MCN B;  3EEC A;  1SE4 A;  2KX3 A;  4I6N B;  3DBR B;  1ZXH A;  1M94 A;  3U8Z A;  2KJH B;  4KKI A;  3FAH A;  2CS4 A;  1CQV A;  2KC1 A;  1SEB D;  3NS1 A;  4WJP A;  5AZH A;  1GNU A;  3HVD A;  3N32 A;  2CU3 A;  2L76 A;  2JRH A;  3RFZ B;  3MP9 A;  3T8M A;  1BML C;  3DBL I;  1DGJ A;  4DDI D;  3PGE A;  3ZUN A;  1JCK B;  3VTV A;  2K8B A;  4IC7 B;  2J4X A;  1VJK A;  2MP2 A;  4WQO B;  3I3T B;  2I1K A;  5DPT A;  4W9K A;  2AQ1 B;  2HDE A;  4AJY B;  3DBH B;  1C4A A;  1V1P B;  3AE2 B;  4DBG A;  2ON8 A;  1SIJ A;  3EGR A;  3DHG C;  2KWD A;  4KDI C;  4WAA A;  1NVI D;  4GLS C;  2XNA C;  5D7G A;  5DPW A;  1MHH E;  2MEK A;  5KHQ A;  4REZ A;  3V6E B;  4NJ7 A;  3RD2 A;  3Q14 C;  2C7H A;  3AEF B;  4AWJ A;  4BKS D;  4ITK A;  3NZS A;  2R2O A;  2JWZ A;  2NTT A;  3S2A A;  2Q5W D;  3MJW A;  1VZ8 A;  4N58 A;  5D3I B;  3VQI A;  1NI2 A;  5HI1 A;  1WF9 A;  4HJK A;  4L2Y A;  2ZPY A;  4NAW A;  4TUU A;  1JWM D;  3ZDM C;  1FD6 A;  4RM9 A;  3QC8 B;  2KVR A;  3UGB B;  2FUH B;  4HCP B;  1YQ4 B;  4JWS C;  4K1R B;  4DHJ D;  4Q2J A;  1FXT B;  3JW0 X;  1F9J A;  2LFI A;  2BS3 B;  3TMP B;  1IGD A;  2BQQ A;  4JQW C;  4HVB A;  3KUZ A;  1FNV A;  4C80 A;  2DBY A;  4OVU A;  1E5W A;  2XEW A;  4MGK E;  3AXC A;  2JYT A;  4G50 A;  4L1B A;  3BWU D;  2INN E;  2RGF A;  1E6E B;  1IGC A;  2JVC A;  1TY2 A;  4GIV A;  2M19 A;  2MBH A;  3AE9 B;  3RNB C;  5TR5 A;  4BOZ B;  2CU1 A;  3APC A;  2L52 A;  3MC8 A;  3MHZ A;  4XC2 A;  5AZG A;  4IW0 A;  1I4R A;  2UU7 A;  1UEL A;  2J52 A;  1FEH A;  3R3M A;  1F2R C;  2WQY B;  1TKY A;  3AE4 B;  1L0Y B;  2PVG C;  2X38 A;  3U2S C;  1Q0W B;  5DPS A;  4M0W B;  1YN4 A;  3RNE C;  4ZRI A;  5E6J A;  3BYT B;  4WJO A;  2O6V D;  3TJP A;  1WMH B;  4WIP A;  1ISN A;  4F7Z A;  1QOG A;  1UUP A;  3L16 A;  2I38 A;  2QIE B;  4RF1 A;  3FKY A;  3PLV A;  2ZNV B;  4DWF A;  1ACC A;  2C7M B;  3TBL D;  1CMX B;  1TIF A;  1C79 A;  3HUI A;  2A5U A;  4HRS A;  3A9K B;  1TS4 A;  2DNF A;  1UWX A;  4OZC A;  4W9J A;  1V1P A;  4A90 A;  2Z8L A;  2W9N A;  4MSQ B; 
#chains in the Genus database with same CATH homology
 1PDX A;  1MVK A;  2KAC A;  2WXK A;  1AW7 A;  3H8H A;  1C9F A;  1XCT L;  3Q8F A;  4KX6 B;  5BMG A;  1RFK A;  3HVZ A;  1ZPS A;  3BII D;  2V0G A;  1J7A A;  4ZRP A;  4RGT A;  5G5G A;  1V8C A;  1UNS A;  4RH6 A;  4WH4 A;  1QQR A;  3SEB A;  3BZD B;  4RF0 A;  1D5Z C;  1YJJ A;  1E0Z A;  2BW2 A;  4NAW B;  1WRI A;  3Q8B A;  2FBW B;  5BYS A;  1F77 A;  1UGJ A;  2L83 A;  4IOI E;  4IDI A;  3P4Q B;  1PGX A;  2LHD A;  1QOA A;  2K22 A;  4TSS A;  1Q10 A;  5FR3 A;  1I4P A;  4YTN B;  2H89 B;  3OWE B;  3BYY B;  2BT6 A;  1QIL A;  3AE7 B;  4US8 A;  1YN5 A;  1TZO A;  1YNT E;  3PZ7 A;  5D3D A;  4YT0 B;  3AV8 A;  1ZE3 D;  1JWA D;  1BXT A;  4US9 A;  2E3T A;  2WXQ A;  1TY0 A;  2INP E;  3ABV B;  2WDQ B;  4H2A A;  1P7F A;  2XN9 C;  2PW9 A;  2B76 B;  2Y3A A;  3N9Y C;  1GB1 A;  3VR9 B;  2N9L A;  2RPV A;  2W82 A;  1DOI A;  5JXV A;  1HZ6 A;  3J9C A;  4XDD A;  1FCL A;  5FK9 C;  2VZK B;  1PFD A;  4RGM A;  1HQR D;  4WUR A;  4RCO A;  1SB3 C;  2YEP F;  3I57 A;  4J3O D;  5MPO A;  1AYF A;  2OED A;  3GB1 A;  2WU5 B;  4YSY B;  1NEK B;  4YTM B;  1SJE D;  1D6E C;  2AQ3 B;  3P42 A;  5LNK 1;  1FIQ A;  1ZP0 B;  2TSS A;  3KWV A;  4O1N A;  2PVO D;  3WCQ A;  1VZ6 A;  2QIL A;  2PKO A;  1L4Z B;  1IBX A;  1VRA B;  3SFD B;  2IGH A;  1YN3 A;  2LJI A;  1K50 A;  4A6Q A;  3TEZ A;  1PGA A;  4C56 C;  4L23 A;  3AEA B;  3V05 A;  1KLG D;  4B0E A;  3W5U B;  3Q8A A;  1VDV A;  2JU6 X;  1TKG A;  3ZGZ A;  4JE3 B;  1J7B A;  1VZ7 A;  2RDH A;  3P4R B;  2WLB A;  2AX5 A;  2PIA A;  1N63 A;  1FNU A;  2D5G A;  2V3N A;  3AEB B;  1QOF A;  1F2R I;  4KGT A;  3DWG C;  1WGK A;  3GS2 A;  2WXL A;  3O13 A;  1AWD A;  3AE6 B;  4MT5 A;  4ARI A;  4YWG G;  3EUB 2;  1PUT A;  5TSS A;  4KGS A;  3W5V B;  1CJE A;  1FRD A;  1T6B X;  4YTP B;  3AEC B;  1KH0 A;  4HKZ E;  2J53 A;  1K52 A;  1NYR A;  3IAS 1;  1JML A;  2WXN A;  1N5X A;  2ZW1 A;  2L32 A;  4A55 A;  1CK1 A;  2JZP A;  1C78 A;  4ZRQ A;  2QSD A;  1KF6 B;  2K3U A;  2WXO A;  3E9S A;  4DXF A;  3ZJU A;  1XLO A;  2KAJ A;  4TMA B;  5FKA C;  1I7H A;  5HFY A;  1I4X A;  1WYG A;  2PMV A;  1M4V A;  1B1Z A;  2YEP B;  1HXY D;  3TUO A;  1XO3 A;  2V4I B;  2WU2 B;  1NYQ A;  3AE8 B;  5HHD G;  2WDR B;  3KLS X;  3MFG A;  5AUK A;  4P6V F;  1D5M C;  1KFY B;  1C77 A;  2Y5P A;  1E9M A;  3ETR A;  3IT4 B;  3P1M A;  2LEK A;  1FO4 A;  4GDK B;  1FXI A;  2W3S A;  2KDM A;  3LB8 C;  2MJD A;  1JWB D;  4DXG A;  2GI9 A;  1T3Q A;  1JQ4 A;  3P4P B;  1V1O A;  3Q69 A;  4B0M A;  1ROE A;  1YJI A;  2N7J A;  2VZK D;  4FXC A;  3DWM A;  1KLU D;  2EEL A;  3NVZ A;  3BVZ A;  3ZJT A;  2H88 B;  3LXF A;  5BMH A;  2BYT A;  3U7Z A;  2IPK D;  4RNA A;  4WWM A;  4KGR A;  4C7Y A;  4CQN A;  1B9R A;  4HKQ A;  3ZYY X;  1OQR A;  3LYY A;  4HEA 1;  2N9K A;  1DOX A;  1ZDX A;  3NRZ A;  1SSN A;  1I4G A;  1ZDV A;  2WS3 B;  2K0P A;  1FMA D;  1QKZ A;  1KRH A;  2WP9 B;  2KQ4 X;  1N60 A;  3R2T A;  4XWW A;  2E6X A;  3AED B;  3B2G A;  1SXT A;  2SEB D;  5H8Y E;  1ESF A;  2MH7 A;  1L6U A;  4ZHP A;  2LMC A;  2WXJ A;  3ZQ4 A;  2BB5 A;  1SBB B;  1JAL A;  2NMQ A;  2ZW0 A;  2MJE A;  1N61 A;  2FE8 A;  4D2K A;  4AS1 A;  3E56 A;  1CZP A;  1JWU D;  1MHX A;  2J42 A;  2JQR B;  3MJ5 A;  3AB5 A;  1FFV A;  3CIR B;  4MAC A;  1SJH D;  4WQM A;  1EM7 A;  4YXD B;  2IJ0 A;  1XLQ A;  1JWS D;  3AEG B;  1J7C A;  4ZHO A;  1QT9 A;  4C7Z A;  2BB6 A;  2GB1 A;  1EWY C;  1P7E A;  4JWU C;  4LK0 M;  1IBX B;  2KN4 A;  3W2D A;  1FRR A;  1N5W A;  1TKE A;  1SE4 A;  2JX5 A;  1ZXH A;  1IUE A;  1SF0 A;  4KKI A;  3FAH A;  2KMM A;  1CQV A;  1FCC C;  1SEB D;  1D5X C;  3BVM A;  4ZOH C;  3ZJV A;  3NS1 A;  2DWQ A;  4MH8 A;  1QLB B;  4ARC A;  1L4D B;  3V3X A;  3HVD A;  2W54 A;  1TYG B;  2CU3 A;  2WXF A;  2BS2 B;  3P63 A;  1WSP A;  2WXM A;  3IT6 B;  2IGG A;  3NZ3 A;  2IGD A;  3RFZ B;  3TSS A;  1UWM A;  3VRB B;  4A8X C;  3MP9 A;  3Q8E A;  1STE A;  3BK1 A;  2NTS A;  3P4S B;  1WWT A;  1BML C;  1TS3 A;  1DGJ A;  5EE3 A;  4OHJ A;  5I4D A;  1RYJ A;  1JCK B;  2CJO A;  2M0A A;  2BBC A;  2J4X A;  4OZB A;  1ZUD 2;  4DQO C;  1E10 A;  1ET9 A;  5HG2 A;  4OVZ A;  1EU4 A;  1VJK A;  1SE2 A;  1XEE A;  4M0W A;  5AUI A;  1XF5 L;  1YMH E;  2QJL A;  1C76 A;  3MC0 B;  3AE5 B;  2AQ1 B;  2HDE A;  1L6V A;  3R2I A;  4UDU C;  1F0Z A;  2OHF A;  1C4A A;  1V1P B;  1WXQ A;  3AE2 B;  2ON8 A;  1SIJ A;  3CWI A;  3FIL B;  3EGR A;  1MI0 A;  4JX1 C;  3BK2 A;  3BVG A;  4A9A A;  2W3R A;  3AM9 A;  1L0V B;  2KWD A;  3AEE B;  3EA6 A;  2EKI A;  1NVI D;  1I4Q A;  4GLS C;  1KTK A;  4HRO A;  2PLP A;  1GOZ A;  2XNA C;  5D7G A;  1TJE A;  4OW0 A;  4TQ0 A;  1OQQ A;  1MHH E;  4KKJ A;  5G5H A;  2MEK A;  1VLB A;  4REZ A;  2QEJ C;  1K51 A;  3U52 E;  1C4P A;  3AE3 B;  3I9V 1;  5EE1 A;  2DLB A;  3KWL A;  3RPF C;  3SR6 A;  5BYR A;  5C2T B;  3U4E G;  5T8I A;  2L1A A;  3AEF B;  4XWT A;  2MJ3 A;  4ITK A;  2RMM A;  2NTT A;  1GPX A;  1XCQ L;  1XLN A;  3L4P A;  3PZ8 A;  2Q5W D;  1VZ8 A;  4N58 A;  5D3I B;  2JYE A;  3AE1 B;  2G9H D;  3VQI A;  5HI1 A;  1SE3 A;  5C3J B;  1QOB A;  4AQ7 A;  1RWS A;  3T3O A;  1C4C A;  4R3D A;  4L2Y A;  1NI3 A;  1JRP A;  3PO0 A;  3URY A;  2DYM A;  1JWM D;  2DYO A;  1FD6 A;  4RGN A;  1LO5 D;  1HEZ E;  3VRA B;  2K5P A;  4OZA A;  3HRD D;  4EE2 A;  1YQ4 B;  4JWS C;  2FUG 1;  1V97 A;  2LGI A;  4NJC A;  4IKG A;  3UI3 A;  4Q2J A;  4YSX B;  1HZ5 A;  1PYW D;  2V3P A;  4RFB A;  4HJG E;  1ZOY B;  2LFI A;  5GXG B;  2BS3 B;  2PTL A;  1IGD A;  2ONQ A;  4XE0 A;  2IDY A;  1L0X B;  2WXI A;  1E7P B;  3VR8 B;  3TEX A;  2ICI A;  1MPE A;  2BS4 B;  1FNV A;  2W55 A;  1QF6 A;  4C80 A;  2WXP A;  2RDG A;  2DBY A;  4LTU A;  3IAM 1;  5EE9 A;  4GDL B;  4RGO S;  2R61 A;  3KQ4 A;  1TS5 A;  2WXG A;  4NAM A;  3NVW A;  5EE0 A;  1EWC A;  3GP7 A;  2JYT A;  3T3N A;  4L1B A;  3BWU D;  4XDC A;  2LHE A;  2INN E;  1YQ3 B;  3R8B A;  1A70 A;  2G1E A;  5BMI A;  3TEW A;  2CJN A;  1ZXI A;  1E6E B;  1JRO A;  1Y56 A;  3AH7 A;  2LUM A;  3NVY A;  1IGC A;  2BTE A;  4PT5 A;  1TY2 A;  2M19 A;  3AE9 B;  1L5P A;  5BYQ A;  4N6E B;  1FFU A;  2L52 A;  1PGB A;  3MHZ A;  1I4R A;  2J52 A;  3SFE B;  1EU3 A;  1FEH A;  3NUH B;  4NZL B;  1F2R C;  1K53 A;  2WNM A;  2WQY B;  1TKY A;  1RM6 C;  3FC4 A;  1BUI C;  3AE4 B;  1L0Y B;  2HTM E;  2PVG C;  2X38 A;  3U2S C;  4MM3 B;  1YN4 A;  2Y5C A;  2K9X A;  3AMZ A;  2I2Y A;  5E6J A;  3BYT B;  2M56 B;  1NEN B;  1JW9 D;  1XLP A;  1ET6 A;  2WXH A;  2JSV X;  4WIP A;  4LLG M;  4YSZ B;  3TEY A;  1FM0 D;  3B9J A;  1QOG A;  1UUP A;  1T5X D;  4N59 A;  1DOY A;  2AQ2 B;  3W1S A;  4TQ1 A;  2I38 A;  2JWU A;  2QIE B;  2JXT A;  4RF1 A;  2N0S B;  4WAF A;  3Q8C A;  4ZYS A;  1AN8 A;  1N62 A;  2WDV B;  3NVV A;  4P16 A;  1TS2 A;  3C8Y A;  1ACC A;  4JPS A;  1OFF A;  1FXA A;  1R7S A;  3W9C B;  2SAK A;  3HUI A;  1C79 A;  2ACZ B;  3IXS A;  4HRS A;  1VR9 A;  1TS4 A;  1XXG A;  1GAQ B;  1D4B A;  1GB4 A;  3B2F A;  2GRI A;  1UWX A;  1I4H A;  5H92 C;  4OZC A;  1HA5 A;  2QMT A;  3AN1 A;  1FNW A;  1DYQ A;  1V1P A;  4A90 A;  3FIL A;  2Z8L A;  4USA A;  2WXR A;  1ENF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...