1EESB

Solution structure of cdc42hs complexed with a peptide derived from p-21 activated kinase, nmr, 20 structures
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
46
Chain Sequence
b'GSKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN
publication title Structure of the complex of Cdc42Hs with a peptide derived from P-21 activated kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 1
structure length 46
sequence length 46
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.810.10 Alpha Beta Alpha-Beta Complex SerineThreonine-protein kinase PAK-alpha; Chain A CRIB domain 1eesB00
1EJ5A 2LNHA 1T84A 1F3MA 2K42A 1E0AB 1CEEB 1EESB 4MITE
chains in the Genus database with same CATH superfamily
1EJ5A 2LNHA 1T84A 1F3MA 2K42A 1E0AB 1CEEB 1EESB 4MITE
chains in the Genus database with same CATH topology
1EJ5A 2LNHA 1T84A 1F3MA 2K42A 1E0AB 1CEEB 1EESB 4MITE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EJ5 A;  2LNH A;  1T84 A;  1F3M A;  2K42 A;  1E0A B;  1CEE B;  1EES B;  4MIT E; 
#chains in the Genus database with same CATH topology
 1EJ5 A;  2LNH A;  1T84 A;  1F3M A;  2K42 A;  1E0A B;  1CEE B;  1EES B;  4MIT E; 
#chains in the Genus database with same CATH homology
 1EJ5 A;  2LNH A;  1T84 A;  1F3M A;  2K42 A;  1E0A B;  1CEE B;  1EES B;  4MIT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...