1EWWA

Solution structure of spruce budworm antifreeze protein at 30 degrees celsius
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
90
structure length
90
Chain Sequence
DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-helix structure and ice-binding properties of a hyperactive antifreeze protein from an insect.
pubmed doi rcsb
molecule keywords ANTIFREEZE PROTEIN
molecule tags Antifreeze protein
source organism Choristoneura fumiferana
total genus 8
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2000-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05264 CfAFP Choristoneura fumiferana antifreeze protein (CfAFP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1ewwA00
1EWWA 1Z2FA 3SUCA 3GQAA 3GQ7A 1L0SA 3GQ8A 1N4IA 1M8NA 3GQ9A
chains in the Genus database with same CATH superfamily
5ADXU 1XHDA 3OTZA 1OCXA 1HM0A 2W0VA 4MYOA 3OW5A 4N6AA 3GQAA 1YP2A 3VBKA 4E6UA 4M9CA 3KWDA 4EQYA 2OEGA 3MQHA 2OI6A 4IHHA 1V3WA 1HV9A 4M2AA 3OUPA 1T3DA 4EA7A 2QIVX 4HUSA 4KQLA 2ICYA 3OTMA 3BXYA 3D8VA 4N27A 3FOQA 2V0JA 3FSCA 3SUCA 4EA9A 3TK8A 3R0SA 1FXJA 2WLEA 3FSXA 4M28A 1KGQA 1L0SA 3EEVA 3GOSA 3R3RA 4N6BA 1SSMA 3R5DA 1YP3A 4IHFA 2JF2A 3VBMA 2IU9A 2WLDA 3R1WA 1G97A 3BSWA 3GUEA 1KK5A 3GQ8A 3SRTA 1M8NA 3DK5A 2VD4A 3HJJA 3OGZA 4HURA 4KPXA 3TIOA 4E75A 1KRRA 1KGTA 2OI7A 3FSYA 4K6RA 5AFUU 4G3SA 2WLFA 3BFPA 1KHRA 2IUAA 3OH0A 4AC3A 3Q1XA 3IGJA 1HM9A 3C8VA 4M99A 3JQYA 1QREA 3KWEA 3GQ9A 1FWYA 4IHGA 1Z2FA 5U2KA 3MQGA 5L6SA 4J09A 2V0LA 4EAAA 2V0IA 4H7OA 3I3XA 3D98A 2OEFA 3TWDA 1LXAA 2V0KA 3I3AA 3VBIA 3BSSA 1G95A 2ICXA 2NPOA 3PMOA 3FSBA 5F42A 3R2WA 4G3PA 3VBJA 2XATA 4KNXA 4EA8A 1QRLA 4AA7A 2Q4JA 1XATA 4N69A 4KPZA 1KK6A 4R37A 3P47A 1QQ0A 2TDTA 3DHOA 3FS8A 3OH1A 3R5BA 1HM8A 1KRVA 4HZCA 3R8YA 5DG3A 3EG4A 1TDTA 5L6VA 4MZUA 1S80A 5E3PA 5ADXV 2WLGA 4G87A 3V4EA 3BRKX 3FWWA 1EWWA 4M2BA 2WLCA 4EABA 3VNPA 4G3QA 2AQ9A 3HSQA 3VBPA 3T57A 1V67A 4HCQA 3IXCA 1KK4A 2FKOA 4R36A 3NZ2A 3TV0A 1KRUA 1QRFA 4E1KA 2V0HA 1J2ZA 3OU9A 3F1XA 4ISXA 2GGQA 5DEMA 4FCEA 3TISA 3GQ7A 1QRGA 1MR7A 3GVDA 4J18A 3ECTA 1N4IA 3OH2A 3MC4A 3CJ8A 4E6TA 5E3RA 3P1BA 2IU8A 4EGGA 1SSQA 2RIJA 2IC7A 1MR9A 3KWCA 2I5KA 3DJ4A 4MFGA 1SSTA 5E3QA 1KQAA 1Z90A 2OI5A 3ST8A 2QKXA 3BSYA 4HZDA 4E79A 5DEPA 3VBLA 1THJA 2P2OA 4AAWA 3OH3A 1QRMA 2GGOA 2JF3A 3R5AA 3R3IA 3EH0A 5AFUV 2VHEA 1YP4A 3VBNA 3R5CA 4R7PA 3OH4A 1MRLA 3TDTA 2W0WA 4DCLA 3FTTA 4M98A 3SPTA 4KNRA 2QIAA
chains in the Genus database with same CATH topology
1EWWA 1Z2FA 3SUCA 3GQAA 1EZGA 3GQ7A 1L0SA 1L1IA 3GQ8A 1N4IA 1M8NA 3GQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWW A;  1Z2F A;  3SUC A;  3GQA A;  3GQ7 A;  1L0S A;  3GQ8 A;  1N4I A;  1M8N A;  3GQ9 A; 
#chains in the Genus database with same CATH topology
 5ADX U;  1XHD A;  3OTZ A;  1OCX A;  1HM0 A;  2W0V A;  4MYO A;  3OW5 A;  4N6A A;  3GQA A;  1YP2 A;  3VBK A;  4E6U A;  4M9C A;  3KWD A;  4EQY A;  2OEG A;  3MQH A;  2OI6 A;  4IHH A;  1V3W A;  1HV9 A;  4M2A A;  3OUP A;  1T3D A;  4EA7 A;  2QIV X;  4HUS A;  4KQL A;  2ICY A;  3OTM A;  3BXY A;  3D8V A;  4N27 A;  3FOQ A;  2V0J A;  3FSC A;  3SUC A;  4EA9 A;  3TK8 A;  3R0S A;  1FXJ A;  2WLE A;  3FSX A;  4M28 A;  1KGQ A;  1L0S A;  3EEV A;  3GOS A;  3R3R A;  4N6B A;  1SSM A;  3R5D A;  1YP3 A;  4IHF A;  2JF2 A;  3VBM A;  2IU9 A;  2WLD A;  3R1W A;  1G97 A;  3BSW A;  3GUE A;  1KK5 A;  3GQ8 A;  3SRT A;  1M8N A;  3DK5 A;  2VD4 A;  3HJJ A;  3OGZ A;  4HUR A;  4KPX A;  3TIO A;  4E75 A;  1KRR A;  1KGT A;  2OI7 A;  3FSY A;  4K6R A;  5AFU U;  4G3S A;  2WLF A;  3BFP A;  1KHR A;  2IUA A;  3OH0 A;  4AC3 A;  3Q1X A;  3IGJ A;  1HM9 A;  3C8V A;  4M99 A;  3JQY A;  1QRE A;  3KWE A;  3GQ9 A;  1FWY A;  4IHG A;  1Z2F A;  5U2K A;  3MQG A;  5L6S A;  4J09 A;  2V0L A;  4EAA A;  2V0I A;  4H7O A;  3I3X A;  3D98 A;  2OEF A;  3TWD A;  1LXA A;  2V0K A;  3I3A A;  3VBI A;  3BSS A;  1G95 A;  2ICX A;  2NPO A;  3PMO A;  3FSB A;  5F42 A;  3R2W A;  4G3P A;  3VBJ A;  2XAT A;  4KNX A;  4EA8 A;  1QRL A;  4AA7 A;  2Q4J A;  1XAT A;  4N69 A;  4KPZ A;  1KK6 A;  4R37 A;  3P47 A;  1QQ0 A;  2TDT A;  3DHO A;  3FS8 A;  3OH1 A;  3R5B A;  1HM8 A;  1KRV A;  4HZC A;  3R8Y A;  5DG3 A;  3EG4 A;  1TDT A;  5L6V A;  4MZU A;  1S80 A;  5E3P A;  5ADX V;  2WLG A;  4G87 A;  3V4E A;  3BRK X;  3FWW A;  1EWW A;  4M2B A;  2WLC A;  4EAB A;  3VNP A;  4G3Q A;  2AQ9 A;  3HSQ A;  3VBP A;  3T57 A;  1V67 A;  4HCQ A;  3IXC A;  1KK4 A;  2FKO A;  4R36 A;  3NZ2 A;  3TV0 A;  1KRU A;  1QRF A;  4E1K A;  2V0H A;  1J2Z A;  3OU9 A;  3F1X A;  4ISX A;  2GGQ A;  5DEM A;  4FCE A;  3TIS A;  3GQ7 A;  1QRG A;  1MR7 A;  3GVD A;  4J18 A;  3ECT A;  1N4I A;  3OH2 A;  3MC4 A;  3CJ8 A;  4E6T A;  5E3R A;  3P1B A;  2IU8 A;  4EGG A;  1SSQ A;  2RIJ A;  2IC7 A;  1MR9 A;  3KWC A;  2I5K A;  3DJ4 A;  4MFG A;  1SST A;  5E3Q A;  1KQA A;  1Z90 A;  2OI5 A;  3ST8 A;  2QKX A;  3BSY A;  4HZD A;  4E79 A;  5DEP A;  3VBL A;  1THJ A;  2P2O A;  4AAW A;  3OH3 A;  1QRM A;  2GGO A;  2JF3 A;  3R5A A;  3R3I A;  3EH0 A;  5AFU V;  2VHE A;  1YP4 A;  3VBN A;  3R5C A;  4R7P A;  3OH4 A;  1MRL A;  3TDT A;  2W0W A;  4DCL A;  3FTT A;  4M98 A;  3SPT A;  4KNR A;  2QIA A; 
#chains in the Genus database with same CATH homology
 1EWW A;  1Z2F A;  3SUC A;  3GQA A;  1EZG A;  3GQ7 A;  1L0S A;  1L1I A;  3GQ8 A;  1N4I A;  1M8N A;  3GQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...