1EXHA

Solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
b'ASSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTPCTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,4-BETA-D-GLYCANASE
publication title Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Cellulose degradation
total genus 12
structure length 110
sequence length 110
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1exhA00
2XBDA 3NDYE 2CWRA 1HEJC 1XBDA 1E5BA 1EXGA 1C7SA 3NDZE 2RTTA 1QBAA 1EXHA 1HEHC 2CZNA 1QBBA 5DHDA 5DHEA 1E5CA 1C7TA
chains in the Genus database with same CATH superfamily
4FC3E 2I69A 5C07D 3CFNA 5KJ7E 4UT9A 1QASA 2DMHA 4PJGE 3VXQA 4AI7A 2WO4A 2APTA 3OQRA 3PV7A 1MVFA 2I07A 1AGEA 1AFVL 2F7OA 1S9XB 3L9YA 4WHTA 4J3OC 3H2QA 3QZBA 4TTDC 2QT6A 8FABB 3C2AL 1A3QA 3D18B 3T04D 3TCLB 3U0TB 5FR3A 4U1MB 4X6BB 3IVKA 2JQAA 5ICXB 3INUL 5E8PA 3RVTC 2NOYA 3UTTD 2GJJA 3ZK0A 1A4AA 1FL6B 3MRBB 4UTAA 3RAJL 3ZTNL 2F54A 4FJ6A 2WN2A 3JWOH 3C5ZC 3NSXA 1IARB 5DEFB 3C5JB 4S0TD 3JV4A 3BN9C 4P5MA 3O2WH 1KB5A 5FGBC 5IJDC 3DGCR 3DSFL 3J27A 3O6FD 2MCG1 1WWCA 4P4KD 2DLIA 4AUJA 4EI5A 3BYYA 2Y1VA 4IIQC 4ATWA 1EO7A 2VDLB 3KNBA 4Y1AA 2X9XA 2Q6WA 4WEMB 3P1VA 5JIIA 3PDDA 3VI3E 2LABA 3OHMB 3HKFA 4XPHH 3MV9A 4GBXC 2Q86A 4K8RC 3SCMA 5KG9B 1NMCC 4LVEA 4OFKA 3TVMA 5D1ZC 1V10A 4QOKE 4MNHB 3PV6B 4JE4B 5EZIH 3IMRA 5E5RB 1ACYL 4P05A 2FX9L 3AREA 3DX9A 5JQIB 1NEZA 4V1DD 3G6AA 4M56A 3L3DA 4LCIH 4NKOA 4JHAL 1HOCB 3VG9B 4Q9RH 3PGDB 1AO7E 3S36L 5TDOB 1AACA 3PWVB 3FQXB 2VDMH 4UQCA 3WG7B 1FE8H 5D2LA 1C8QA 4LCYA 4UMSA 4G3YL 3MRQA 3BUYA 4Z7WF 3LH2H 4PWGA 4A68A 1UWYA 4JE0A 3KPQB 3CFEA 3DMMA 5J5EA 4NFDA 3O4OC 2BRRH 1N59A 5AAMC 3F01A 4C57C 2BRQA 2HUEA 4NRYB 2X3AA 5T3XL 1C7SA 5TK2A 3VWKC 3BJLA 3KWUA 3UAFA 2EC8A 1LP9B 3RDTB 5EF3A 5TFSH 3S34L 4GEIA 1UM6L 3KGRA 3WS6A 2F58H 2VDNL 2OYKA 1M56B 3B3BA 1QKZH 4NXSA 4PSPA 3BZFB 4JG1H 5DFWH 1YY9D 4KKLD 3WLBA 3F05A 4MFHA 5C08A 4PJFF 1I1AA 4DUWA 3V4UL 5ISZE 1ZSDB 1ZCRA 3OHXA 3WE1A 2QZ5A 1BAFH 3VXTA 1WYJA 1F4XL 2N0MA 4XBEH 4XN2A 3RPIB 3S96A 2BFGA 5KVMC 1HWWA 1CXIA 2VLKB 2BP3A 2Y5QA 3FB5B 3MO1B 5LG6A 1YO4A 4D0DB 3S35X 4P3DB 4X9YA 5HDOA 4Y2DA 1ZGLP 3AS3A 1DVSA 4LARH 3VGFA 5ID0A 1J05A 1GGBL 1HS6A 3SJVD 1RUPL 1G84A 1VCBC 1JSYA 3T6VA 2BSSA 4HFWB 4M7LL 4PW9A 3N0PB 3U1SL 3FT2A 2MHAA 1MF2L 4G6KH 1G6RB 1NGWA 3DYOA 5EU7C 4K7FA 4WWKD 2MQCA 5AW2B 3NJVA 1Y0LA 4IKLA 1I9RL 5JR1H 4KK8D 4HK0A 1DZ0A 1F4AA 4X6DB 5DZNA 4YEFA 1OGTA 1F4YH 2FNBA 1N2RB 3GSQA 3E80A 1YN6A 5C0BB 3ZKSD 1L0PA 3HUJA 4U4IA 4JPKH 3BPOC 5E8DL 5GJTL 5E1HB 3FO9A 3WAJA 3TTSA 1FVDB 1Q1JL 5JHDB 1SY6H 2P5WD 3IJHB 5AW8B 2W38A 1UKTA 4FHKA 3P3TA 1TFHA 4LHUA 1UB6A 4P07A 5DC2A 5BMFL 1TSRA 2FX7H 4HOXA 1ZGLM 3HZYB 4U3SA 3LPGA 3MLWH 2P80D 2ZG2A 2ITDA 3A6BH 5I8OL 4NUMA 1NC2A 3SDDA 3MBWB 3T8VA 3CU1A 1F18A 4UNTA 3TO4D 1R6VA 4FQXC 2ENPA 1IQDA 2KT6A 4NQXA 4KJWD 1U3NA 3BH4A 3HHSB 4K94L 3A6CH 3GKWL 1KV7A 4RAHA 4FA8A 4RWYL 5EEYA 4XAWH 2FYYB 4E42A 3QI9A 2J5WA 1O7SA 2ZWYA 3ZN6A 3VXSE 4UQ2B 1WK0A 4ESKA 2Z8SA 4HOZA 4OF3A 3FB6B 4DGYH 2GIXA 4JPVH 1MCBA 3PJNA 1S7QA 4JFDD 1ZLSH 4EDXA 5JPNA 3VSVA 5FHBL 3S8GB 3FNKA 4O00A 5KVDE 5T3ZD 1DQDL 5C0RH 3NIFF 1TLMA 2C1OB 4FQLL 4K3EH 3ATEA 4YHLL 1C9SA 4C56E 4NKQB 1TJMA 2AXGB 2Q2LA 4ONHB 1IAIH 1OAXL 3BUTA 4AK1A 4RX4D 2HFEA 3KEDA 5DZJA 3EF7A 4HPOH 4WVRA 2YD1A 3TIEA 4PLKC 4M1CC 4N24A 4WI9A 2OR9H 2B8OT 1EHNA 2VE6A 2J21A 2NZIA 4ODVH 1FVCA 5G5DB 1KCSL 4MLIA 3T3ME 3ESOA 3MROB 2PF6A 3GBNL 1H6UA 4O2CB 5KSAD 5EU4B 3DVIA 4OCYH 2DF3A 2FYVA 2VZ3A 3UJJH 5B38A 5JHLA 2JQMA 2WO3B 3Q8CA 4ZPTB 1OAQH 5DJZB 2NSQA 1GVIA 1S9YB 2CH8A 2QVFB 3NCXA 3ZR6A 3QRFM 4XHJC 5L4JA 4HAFA 3QUML 3UIZA 4JDTH 1GL4B 1PLGL 4PGBA 1BX2B 4HJTA 1S7XB 3DK2A 3TJHD 2Y6SC 2E59A 4GSDL 4BKLB 4IK7A 1BMGA 5HI3C 4PGCB 4RESB 1KIUB 1VSCA 3PDGA 2PETA 4XN9A 1AZZC 5BQDA 4MD4B 5JMOC 3HJEA 1NCAH 2X05A 3GUFA 1DUYA 3Q43A 2YD8A 4TULH 1KFAH 2AJ3A 3LNHA 1JPST 4BK4A 4JDEB 1AR1B 3OAZH 1QFWI 1T89C 2WXNA 4K3HA 3CFMA 2VH5L 3U6XA 1FFPB 2EJ1A 3P30L 4UQEA 2BS8A 5JW4Q 5DVNA 3JQOB 3SPCA 4ONFL 4LSUH 1HSBB 4N6RA 1CR9L 2UZIL 5C7XL 2CHDA 3EO1A 1AKJD 5I1JH 3PJSB 3GSNH 4MRCA 2HWZH 1UEYA 1HU8A 1F56A 4JM4L 1V3LA 1DJGA 2BSRB 3WNIA 2NYKA 3WEMA 3K8MA 4FRWA 4KRMB 5DMGC 3U1QA 4UOQA 4BH7B 3T65B 3CJJA 5DJDA 4JY6A 4L3FA 3L54A 3ES6A 3V5DB 2NNCA 1LE9B 1CGWA 3IDMA 2NX5A 2XN9A 1TJIL 1QUNA 1FLRH 2JCCA 3BVWA 5C2UB 1G7MB 3HPJB 1CFQA 3C9NA 5SWSD 2J56A 1TYRA 4YMPA 3H2WA 2ZWZA 3NFSL 3RI5K 4Q56A 4QWWD 2JSFA 3EOTL 2VDRL 4ZPVA 1YEFH 1J48A 1MY5A 1CF8H 1YEWA 3UPCA 1L0YA 4HUNB 1J1XL 4PUBH 3F6IA 2CJTA 4NGHL 5J13C 2TAAA 3FF8A 4NWUH 2IWKA 5D5MA 3FT3A 4N1HB 3LXUX 4NOBA 1F3JB 5FHAL 1CICB 1HNYA 4C4UA 1AS7A 3OAWA 4K5MA 4AVJA 3A6OA 5FUZH 1MUJA 3HA0A 1AH1A 1YVLA 4LEEA 1A4CA 1PBYA 3UTZA 5C0AB 2Y6TE 1WE5A 4XVTL 4P2QA 3FFCB 3STBA 3GMOA 1H0DA 2VDPL 3UZVB 4XWGH 2WMPB 3ARGB 3B2MA 3O4LB 3OKMB 4RBPH 5EORL 1QSFE 2W92A 4HLZH 3AXIA 3FPYA 5E00A 1A21A 5ESAA 3RKDC 3ULVE 3N44B 4BGDA 6FABL 1GPOL 1Y6KR 4X4MA 3OKDA 1EMTH 1UKQA 3FOLA 2XV2A 3GSRB 3NJFA 3ZRSA 1XSIA 2RA1A 3BEVA 4EI0A 3AT0A 2AZAA 3UMTA 1ZHNB 2R0KL 4DSYA 4E5XA 2EO9A 3QSKB 1RLWA 4Q6KA 1Q9KA 1I4FB 2CO3A 4J3OH 1AP2B 3L1EA 1NEUA 3G5VA 3OZ9L 3RWIA 3HN3A 3CFTA 1HESA 1RQ5A 2JTDA 2EYTA 3QIBD 2C3WA 1KEGH 2VR9A 1S6NA 2MWCA 1HAWA 2NZ9D 3FQ4A 5AB9A 2W88A 4L8SB 1LMKA 1NCHA 3H9SB 2BM3A 5DJYA 1J1OL 2UYLA 3BD5A 3DARA 4I2XA 4YZFF 3BRDA 1TVBB 4M7JH 2MOQA 4C4BA 3PXJA 4POZD 2Z93B 5I8EA 4FFTA 3WL9B 3RZCA 1J8HD 4MJ4A 4UM8B 4BIKA 2I60L 4P2CG 5FEBA 3DUSB 3KPNB 3LEVL 4KRPC 4BZ1L 3I9GH 1W6WA 2VRQA 4N90D 3ARVA 5IBUB 5HHVH 3RFZB 1GOFA 1OAYH 3KVDD 5I0VA 4QAMB 4XXCC 4X7CC 3P0VL 4K8RH 2HLFC 4HUXB 1CVSC 4S2SB 4X80H 4JUSA 2WAHA 3QWNA 1EEQA 1MZZA 2HFTA 3S35H 3HS0A 2YWYA 4MB3A 3GHBH 4OZFG 3TJPA 3FU8A 1BIHA 1E5BA 1UWXH 3BOVA 4WJG3 3QPQD 1PJWA 2F54D 2GJZA 2XUWA 3CVHL 4JFSA 2AXHA 3VQMA 3IDGA 4G8EB 2EIMB 1JYXA 4JAMB 2EYSA 2O30A 2OA9A 5IB5A 2G5BA 4OF8A 3OXRB 4QR7A 2EICA 4B50A 1HYSC 4NQCA 3AQXA 4GKZA 5D7JB 4EI5D 1KPUA 2CM5A 2E75C 2EXSA 2ZCZA 4NRXB 5I5JA 3VG9C 4NJAH 3VO0A 4Y1AD 4R97B 2Q87A 1M1XA 1Q4NX 3PUCA 5DMIL 3GPEA 1MIMH 2OAAA 1G7HB 3QEHA 2DJMA 3BZ4A 3MV9D 1UOVA 3BZ5A 4QHPA 3DV6A 5C3TA 3SCMD 5C0EB 1WFUA 5CEXA 3TVMD 2UZYA 2H4EA 3QEUA 3WS3B 4NKDA 2C9AA 2WV3A 1LNUB 4DFHA 2FATH 5DLLA 4HV8A 1IAIM 5KYXB 2WVSA 4ADJA 3ARED 3ISYA 3L13A 3V4PL 3PAUA 2G0LA 1QBLL 1HILA 3RDTC 3OX8A 5AOKA 5KSBE 5K9JL 5GRUL 5A1AA 1IC4L 4R2GB 2ZT9C 3BFQG 3P9LA 3PP4H 2NY5H 3GSXB 4NQDB 5ICUA 3IJ9A 3QZWA 5D6DA 1IBGH 4TSBL 5IVXF 3QJUB 1VZGA 1ZDQA 2AEQH 2XXGA 4P9HC 3KYKL 1U8HA 2V17H 3SQOL 1IEBB 9CGTA 2F8IA 1KIRA 2C7FA 5E9NA 4M6NL 4AYMC 4ZFOA 5H4ZA 1SGKA 2IWFA 3DMMD 3IJYB 3FK3A 2DB8A 1RH8A 2CKBL 1UXMA 1YEHL 2PTVA 3WJJC 2X4OA 4X0KA 5DQDH 1HKLL 1U8JB 5E6UB 1PZBA 4KQ3H 1A1MA 3PAYA 1TJHL 1DBAH 1XQ4A 1BZOA 4A7GA 5D93B 3B8SA 4O58H 1GGYA 4LOVA 4EN3A 2JCWA 3P3UA 5C08D 1CLYL 2BDNH 3IU4L 1J5DA 1I1AD 4BZYA 1FPTH 2XV0A 3K6FA 1CLOL 3E9UA 2AQSA 4LKXB 2PYEB 2RGSA 2DQFB 3VX1A 4F7MB 2UUDK 2JXMB 2OQJB 5AW6B 1S8DB 1AG6A 2BOBA 3QXDA 3HE7C 4HKBA 1A1OA 1TYEB 2NYYD 3ILQC 2ZXEB 4KDTA 2ZX6A 5HHXL 2MMXA 1CFVL 3MJWA 4Y19E 1JPTH 1MRFH 5E94B 4LGPB 3COOA 2D4DA 1CXLA 4Y2DD 3L16A 5D7IA 3WD5H 4BFIA 5E6SB 3BIBX 3S2AA 3G08A 2XY1A 3GF8A 4L8DA 2LTQB 2OK0L 4RMRA 4JZOB 3QFJA 5D1XA 5EZOH 3LJ3A 3P11H 3IXAB 2EXTA 3CZFA 4HT1H 1UXWB 1BZ9B 2E7CA 1SOKA 1NZRA 3AWGA 3ROOB 1I7TA 4PMFA 3CFQA 4K7PX 2JIXA 4FJZA 4JFPB 3O8XA 4UNVA 1OM9A 2VDOH 1HVXA 4R4ND 5DRNB 1H8NA 4ZX3A 1URZA 1E42A 2H3XC 4O02H 1T6BX 4MX7A 4R26H 3APNA 3JWOL 3HW7A 3CQQA 3BP6B 3HKZA 4EAEA 3VRJA 2QFPA 3U2JA 2EVGA 2E7MA 3L4XA 2ZX9A 2IPUK 3PGCB 2IVFC 3WO4B 3D2UB 4CGTA 4OJCA 5IQ9A 3UGXA 2BVQA 4LASH 4UTBA 3PIQA 3SE9H 1PZ3A 4RFNB 2X09A 4B27A 5B3SB 5FYLD 1SDDA 4N5EC 5BUPA 1LD9B 2J2ZA 4LHUD 2KZBA 5I1DB 2UWEF 5IB4B 1TZOA 4IRZH 4NSKA 1ODAA 2BY1A 2R7EA 4XPHL 5HGGS 1U8NB 5F7DB 5CEZD 4LLQB 2QTVA 1DQQA 1NC2D 3SDDD 3ZZ1A 4E9VA 4F8NA 1IAMA 4GMSH 3L7FB 5DRWB 5KUKA 5EZIL 3MUY1 5B7FA 4HU2A 3BH9A 1QSEB 3QWQB 5DS2A 3Q8AA 1XZWA 2BH0A 4PJIB 1EDHA 1G5GA 1QBBA 2GK0B 4JZNB 1G4MA 4HW6A 4XMZA 5H2BB 1IEHA 4PJDF 3MYJB 3QI9D 5HVGB 4HD9A 4L3EB 4LCIL 3ZYJA 3TA3C 1P84J 3PP3K 1WFNA 1F3DJ 3HG5A 5DVPA 1GZHC 4Z3JA 4X8JA 3HG1E 4OCNC 4Q9RL 5LGJB 4IS6B 2GTZB 3OSVA 4HMDA 4CU6A 4GW1B 4WFGE 4XMKL 2VDML 4FA6A 3BVNA 1FE8L 3GXDA 3R19A 5CLXA 4A2FA 5DD1H 3UBXB 1MCDA 1NANI 3FRUA 3LH2L 1OP4A 1FZKA 4KZ0A 3C2SA 1DJZA 4YUEH 1QR4A 5IHWA 3S4SB 2BRRL 3DYPA 2W0PA 5EDXA 4QRBA 2G9HB 4ZUTB 4CRPA 4ILDA 1D2PA 4N20A 1XD1A 5TFSL 4FLHA 3OLDA 4DNLA 2VB5A 2BIIA 5J6HB 1JZ2A 1OGAE 3S5LB 4PJ5B 4I9WD 4DEPC 2F58L 1KY6A 5FIEA 3NP3A 5HHOA 4HEPG 1QKZL 3ZDXF 2QPEB 3MCYA 4JG1L 4BK5C 4D94A 4F7PB 2D9CA 3KPRB 1GKEA 3PLYA 2AW2A 4BQCA 1AYOA 2AKRB 3T2LA 1VB9A 3P9WB 1BAFL 4P06A 4K3DH 2WANA 1TVHA 5C9JA 1AR1C 5E9DE 2CCVA 4XBEL 3D0VB 5CWSA 1NTDA 5HVHC 4GLRI 3V6BR 3WAKA 4BEIA 2IGLA 1ZD6A 4RGNB 2BVYA 3MBEB 5DFVD 4EJ1C 4GG6A 3W2DH 1R33A 1TNMA 2JJTC 2XKNA 4O2EB 5I8KL 3WOVA 4YBLB 5BUAA 4J3BA 1J5CA 2J71A 4FYTA 2B3RA 4PJEA 4LARL 2Y06H 4X98A 4G71B 3V4VH 1G5AA 3ZE2F 2GCYB 3E8VA 5TF1H 3FSOA 5ANMB 2KBGA 3CHPA 2X4RB 1NAMH 4ZSOB 1PEZA 3L81A 1UG9A 2CZNA 4G6KL 4OUOA 2SEBB 1DJHA 2OXGB 4WZ9A 5DUMH 4Z77A 1A3ZA 3EH1A 5JUEH 4BCZA 3V55A 4P2RE 3NIGF 1UVQB 5JR1L 1BQRA 1Z0MA 3VWJB 3X11B 3HZVA 3B2DC 4FOMA 5AZ2H 3CSYB 1EFXA 1F4YL 1EZSA 1TQCC 3AY4C 3PWUA 3V0WL 3WHE1 1FCCA 4GOSA 1TZGH 3QUZB 5AVTB 1VGEH 1NDMB 3DTXB 3P3YA 1K9TA 3UL4A 1IBFA 3LRSB 3E6HA 2RTTA 4ZO9A 2ZNXA 4YDLB 1AXSA 4JPKL 4C54A 1J9QA 1H3VA 4AC4A 1I8IB 1CICC 3ARBB 4ELMB 1LQBC 1SY6L 5JZ7D 1FG9C 1KYAA 1HL9A 1IAKA 2NX5D 1G0YR 2XN9D 3KXFB 1XEDA 2VKWA 3PPEA 4AX3A 1X5AA 3VH8G 2OMUA 3AS0A 2FX7L 3DDGA 4S1DC 1EA9C 3BWAA 4OZFB 1DYZA 5FW6A 3FU0A 3MLWL 4ICWA 3VCLB 2XFXA 3A6BL 4RAVB 2EDOA 3ZHFA 3ZUNC 1HXMB 4XNDA 2AJZA 3NTCH 1Y6NR 1KXQA 3RIKA 2B7DT 1CL7I 2B1OA 3N1PC 1NIBA 2IFGA 5I82A 3HE6B 4GXVH 1FA4A 1I31A 1FJ1A 5F71A 2N56A 3D7PA 2N7SA 3A6CL 1ZT1B 4FYSA 4XAWL 4G80B 1ESOA 3TYFA 2B2XL 3QULB 2X3CA 1E8ZA 2CAKA 1SZNA 4MJHA 3CZKA 1JRHH 2Y69B 4DGYL 4JPVL 3B7YA 4NUJB 3EF4A 3F7KA 1H19A 3MJ9H 1MCWM 1XF5B 2K8QA 2RB8A 1UXSA 2XVGA 3PWPE 1KBKA 5B1JC 3I6GB 2H32A 4P2QD 2R8SL 2ZWSA 4HJSA 4TVPH 2PCFA 1NLDH 1OB1A 4HIEA 3MUZ1 3TPUA 1KDIA 3U6RB 3PJLA 4L8CB 2HVBA 5I5IA 5C0RL 4L8SC 4K3EL 3LSOA 2J7LA 2YQGA 5DWUH 1UH4A 3RWGB 2G3NA 1IAIL 1OAJA 2R15A 3B7TA 4U1JB 5DT1L 4B95C 4RISH 2VLLA 3MLXH 2YARA 4JG5A 3CFIC 4HPOL 2GFBB 2X2IA 3ARQA 1XO8A 2E4FA 2R27A 4OFPA 4FG6C 1L9RA 4ODVL 5DUPH 1WZKA 2NY7H 3CQFA 2GT9A 4APQA 3R7QA 4JVWA 2NCMA 3GSWB 4YDIH 4HKXB 4QNPF 5DVOA 2W9LA 3UJJL 2H45A 3QJFA 2CIKA 2ZYSA 2L7UA 1HI6B 4FAAB 1OAQL 5DYOB 1X4ZA 1RV6X 2XI9A 3D8MA 4Z1PA 1BWMA 2A3TA 3ZRFC 4JDTL 4N8UA 3MGOA 1KTLB 4OQTH 4H5SA 3MTRA 4OLUH 3T4YB 3O41A 3LH8A 1CDHA 4KK6C 3DJ9A 3RZCD 4XN7A 3FO1B 3CXHJ 2DRUA 1U8QA 3OXSA 4NRZB 3QIUB 1NCAL 2FGZA 4K9JA 4JRWA 4TULL 3S3CB 1KFAL 3WJMB 1GGCH 2IPKB 1W72B 1U95A 2Q1EA 3EJCA 5JXEC 4HX1A 3DVNA 3RWHB 2V2TB 1E2WA 1L0QA 1MHHA 2YXWA 1BZ7A 4G1MB 2G3XA 1ZIAA 1NLBH 1ZJBA 1BLNB 3MRIB 4LSUL 1JPGB 3WKNA 1DQVA 1VHPA 3RGVA 1ZY9A 2YD4A 3OZLA 1BPLB 3C08L 4DJMA 5I1JL 4Y2LA 1FP5A 3GSNL 3ZLQC 3ZTDC 1ZV2A 3VXPA 2HWZL 1T7WA 3FJTA 5KBNC 2W65B 1CD1B 5L9DH 2BP5M 4ETYA 4NQCD 5F7LB 5EH1A 3W39A 4UV7H 4DW2H 2D7QA 4K7PH 5D71H 1T80A 2QDWA 4R2GC 4X8XA 4LP5A 1LP9E 1RY7B 4BKTC 1DUZB 2WNKA 4IRZA 3QDMB 2GHWB 4NO3B 3MOBH 4P5RA 4P9HH 5F0PB 5I17B 4FL4C 4AZ8A 3DX0A 1FLRL 4P46B 1IFGA 4L1SA 2OMTB 1CGYA 4Q6IA 3IXTA 4F80A 5EOCH 1GS8A 3OMAB 5CSBA 3ECUA 3ZHDA 2X6VA 1OPOA 4CC0A 4H2AA 5JPMA 1SLVA 1YEFL 2HT4C 2NLJA 1EEZB 1CF8L 1WWAX 2ADFH 2EXYC 1KWGA 4PUBL 2YPVH 3D85A 1RIHH 4Q9BA 2A9BA 4ZXBB 1G7IA 3UC2A 2A38A 3O6LL 4NWUL 2CRYA 5LXVA 5L2JA 1RPQA 2J44A 5D93C 5C09B 5A3IC 2ZSWA 5JIPA 2VR5A 1RPKA 3MRKA 4IDJH 1G6RH 2CM6A 4NC0B 3UBFA 1GSKA 3VGGA 2KPNA 3WFZA 1X3DA 2BNUA 1SJEA 4JRXE 4A7UA 2Z9TA 5DK2B 4ODSH 2DBLH 4P59H 4XWGL 3PQYB 1I7ZB 4LIQE 4ZX4A 3IKKA 3A3YB 3NCJL 1F97A 3MNZB 2W1NA 3RWCA 2VXQA 1PKOA 1PD1A 1DEDA 1P69B 4H7VA 3NH7H 5CZKA 2JJSC 3QJHA 4JKMA 4QAWA 4RMVA 4XXWA 3N0AA 5DLMH 4QRQA 4P49A 2ADJA 4Z7NB 1EMTL 1KXVC 4WKXA 1FNEB 4YNYB 1XMEB 4MD5B 2BSDA 2LTQC 2YEZA 4EN3D 4ISVB 3W0WB 4OZGB 4JO3H 5ESVB 3KJ4B 2PPFA 2OJZH 2OSLA 4DZBA 4MKMA 3NSCA 3EBHA 2X7LA 4H8HA 4WI0B 5IM7B 2ADGA 3MJ6A 4ZT1A 2O61A 2XPGA 1KEGL 2AJVH 4HUWA 3ABZA 3P02A 5SWQB 2OL3H 3GMLB 2P8LB 4KI5C 4NAMA 4P23A 3MLTB 5TDNB 1PAZA 2CLRB 4M48H 5D2LF 4CJ0A 1TKWA 4KO5A 4PRAA 4UOW0 2VR8A 4M8RA 4TSAH 4YHIA 5DJXA 1PY9A 1W8OA 4OLYH 5EU6A 2H9GB 5AVZB 4PV9B 5C2BH 4FNQA 4QXGH 2DQIH 2AEOA 4DOHE 2AK4B 2YEQA 1XXDC 1PJ9A 1R46A 2IADA 3QFJD 5D1XD 2FBJH 3I9GL 4FFWC 1NBYA 1OP5K 3WO4C 2ZKXA 1X5KA 3NEXA 5HHVL 3K8LA 4HSCX 1BAWA 4W6YB 3Q06A 4PFEA 4PP2B 1OAYL 2WWMD 4RFNC 5EIVA 5F1IA 3SYQA 3UYRH 3HC4H 4K8RL 2COVD 4X80L 4N2MA 4B60A 2JIXD 3S35L 1ET5A 2V2XA 3O8XD 3GHBL 1DSWA 3TIDA 2C9SA 2GAZB 4LEOB 2X2JA 3DVGB 3GBEA 2VUOA 1E4KA 1YYMH 2NQCA 3Q48A 2QPDB 5JOPE 1P5UB 4D9QD 4DVBB 4PAZA 4AQEB 4JGNA 3Q2VA 3GZPA 4BFFA 4NJAL 1F1GA 2A1WH 4FGMA 2F74A 3UACA 1MIML 1U33A 5J6GB 2AQNA 5J1SC 2E9GA 1RULH 3PPSA 1P7QA 3X1NA 4TQIA 3M1OA 4EUPG 3WN5A 4PGJA 3BZEB 2YBRA 4RGMC 3ZKND 5BW7A 4DHLA 5CFHA 2FATL 3FSAA 3E2HB 1NH6A 2F7IA 5IFHL 3TNMB 4ZMZA 5GISH 1AY1H 2DMCA 1YEJH 4YO0B 5HJDA 4B7IA 4L0YA 4U1GB 2EP6A 4R4BA 3CV5A 3PP4L 5FF6B 2NY5L 3SODB 3TN0B 2VC2B 3TBSB 3RZWA 3HUJF 4JFHD 3L3JA 2Z1PA 4TQ8A 2RH0A 5IWLC 1IBGL 3KL5A 4FJYA 2WQVA 4P5TA 2AEQL 1NIDA 2V17L 3I6KB 2GC4C 4H8WH 4QHKI 5HTSA 1UJ3B 4WHYG 2QR0A 4XXDB 3FRPB 1TEYA 5CP7A 5MERA 4MXQC 1O7VA 2YAMA 4RGNC 3VFPB 3MBEC 1QP1A 2HLAA 4XI5D 2GJPA 1DJYA 3ZMEA 5HYEA 2F18A 4HP5A 4BUGA 4H2CA 4FXGC 2ERJC 4KQ3L 4R7DB 1EHKB 3BAEH 4YBLC 4JRYA 1DBAL 2D7MA 2W0FA 1BG9A 4H0HB 3GZOA 5HHOD 4LRIC 3BIKA 4O58L 3LRMA 2X4TA 1EDYA 2BDNL 3RWJB 3KDMB 5I6KA 1MCJA 1VADB 3LDBB 4AQAA 2XNAB 4JPIA 3DROA 4DQOH 2BIHA 1A3LH 4BWTA 1Z9LA 3UO1H 3EG9A 4NPYA 3EJPA 5FKAB 3FMGH 3CH1A 4QXTB 5KYUA 3CN3A 1GOHA 3PL6A 3GSUB 1M3IA 2BC4B 2ZYIA 3K80A 4LLMA 4KDVA 3VWJC 5AENA 1RMFL 4A2EA 5F7HA 5IMOA 2K4AA 4MXVF 4HKZA 1JPTL 1MRFL 4HS8H 2UXVA 4HJGB 4J6IA 4N9GB 1HDMA 4I9XA 5IHUH 5JHAA 3BP7B 3F04A 3QJSB 1YNLL 1V8HA 3U4BH 4MAYB 3FTVA 2HG0A 3UZQA 3WD5L 1A9VA 4IMKA 4B9PA 1A0QH 1X4XA 2QKIB 4KKPA 4YDLC 2VDKB 3GHPA 3GB7A 5EZOL 3US0A 5GGRB 5IMLB 1FO0B 3P11L 1WV7T 2IH8A 3NN8A 3ARBC 4NKMB 1I3VA 1KT2A 4HT1L 4U1NA 3D69B 2D3NA 2IH1B 4XO9A 1BREA 1BVNT 4M61B 5LAXA 3K81A 3K4ZA 4ZMVA 1SXAA 4QJ4B 3NIDF 4EO5A 3C8KB 2OMYB 5IJKC 4M5YH 4Q97A 2VDOL 2HRPH 1XMWA 3FQTB 2RR3A 2OMXA 1EFXD 5C0AE 4O02L 5T1JA 3U9UA 1SF3A 3BESR 3KLHC 4R26L 1TEGA 2DQTH 2E46A 1SBBA 2NY1B 2YK1H 4L29B 5I24A 2YPLE 4JB9L 2WLKA 2BCKB 1JV2B 3MDJA 4ICXA 1E28B 2EE2A 3MRLB 2MQ0A 2N7AA 3B3IA 3BT0A 1OSZB 1WH0A 1MCKA 4IBVA 2B77A 2YGQA 1S7SB 3LVTA 3SE9L 2F19H 1EHLH 4HF5L 4PRPB 9PCYA 5HDLA 3R7RA 5KVEE 4UBDD 2EIZB 2LFGA 3BFOA 1DVUA 4HKJB 4LFHG 3DK0A 5D1QB 4U1KB 2C9PA 1FFQA 5I1AB 2GJRA 4FG0A 4BFEA 2IDQA 4HEMA 1R47A 2YPVA 4GMSL 3V5HB 2BHYA 1KPRB 1K4CA 2LVEA 3NABH 4OGQC 5EPMA 4QRRB 5AKRA 3SPJA 5E5MA 1I8MB 2VQTA 1ANUA 1FQ9C 5FOBA 3V0JA 5HHNB 3H9SE 4LNRB 5JIMA 3CX5K 1WCBA 3UAJC 43C9B 1M42A 4JFFA 4LKCB 5E9AA 2ITCA 2J1KA 1BJ8A 3IFOB 5A2LH 4WNQA 3VRIA 2HKFH 2N4IA 2VRKA 4MMXB 4WSKA 2LQRA 1K3ZA 2XZQH 5DD1L 3MYZA 1ETJA 2B4CC 1AGBA 5DYFA 3RVUC 3UTPD 1L5GB 2JCCF 5MENA 3N1FC 1ZVSA 1DDHB 3IDYB 5DVLA 3CHSA 5AYUH 3WGVB 3EO0B 3VSTA 1BFOA 4R0LA 2H6PA 4FKHA 3ULUE 4RIRB 3IPFA 3BC9A 4JDVA 2P5EA 5IREA 3CX2A 1XEUA 2H2SD 4W6WB 3AXLB 4E9SA 5ITFA 2DL9A 5B4MD 1X5MA 3ETTA 4CILA 3QIUC 4F3FA 4Z7WB 1KPVB 5BZDA 1MI5E 2LW3A 4APQD 1HQ4A 5D5MF 2OL3A 2HYMA 2PW2A 1UUNA 3FB7A 4K3DL 5JO5B 5EOTA 3C75A 4Q8BA 1AYRA 2MOVA 3VFWB 5L2KA 2QSCH 4ZMPA 3W2DL 3DXAA 1NGQH 2V7HB 1JTOA 1ZHBA 3DPDA 4JLRA 1U9KA 1O5DT 2XIIA 5E2VH 4F2EA 1OT1A 4ZYKA 3OMZA 4YGAB 3Q3GA 4MQ7A 1V5JA 2NQDA 3MRNA 2Y06L 5E6IB 4AIZA 1KJVA 1QRNE 3I84A 3V4VL 5K69A 3WTVA 2EDTA 1HL4A 4YSDA 3AG4B 4IJTA 3SGJA 5TF1L 1FNSH 1GS7A 1GYAA 4NYLB 3BPCA 3FQWB 1OL0A 4MJ6B 5DDHB 4M7ZB 1NAML 2LE9A 1DVYA 1FF5A 4AENA 3F84A 5DUML 2Z34A 4QF1A 5F7EL 1GR7A 5JUEL 2VLJA 4NQDE 2LFEA 4U6XB 3RGVD 3AS2A 1QW9A 4F7EA 2H5UA 2H41A 5KTEH 4MWFA 3G5XB 3PS6A 4EMZA 1GHFH 1TZGL 3ARSA 1P1ZB 1A22B 1VGEL 2AMUA 2CRIA 2AP2A 4OD1H 2CLVB 4LPCA 4GRMA 2BCMA 5ADPH 1D5BA 3IGLA 4FADA 1LEIB 1IGJB 5EN2B 3WIAA 3H9HA 1UEMA 3NJGA 5CNHA 4OGAC 1P0SE 2IQAA 1X4YA 4HULB 4UM9B 4BSWA 3L4ZA 2VCOA 4NO0B 3VFMA 4M03A 4PY7B 5BZWA 5DJCB 4GKNB 3EOAA 2BO0A 5F88B 1GRWA 3CUPA 1RJCA 3VFRB 2BP8A 5IW1A 5JQ6H 3QRGL 1NBZB 4ZW5A 3NTCL 1SOXA 4WWOA 2C3VB 4M1GH 1JFQH 2VZSA 2PYEE 4AM0A 3OR6B 1IFHH 4YR6A 1QQDA 4GXVL 3RTQB 3OJVC 5K9QI 1J87A 2YC1B 2F1EA 4YXLH 3D85D 4I0PB 2R23B 3OLGA 1ACCA 1Z5HA 2K6WA 3WNMA 3ZMNA 1WBZB 4PJ8B 2ZP8A 1MLBA 2GBAA 4JN1H 1SUJA 4D3CH 1KXHA 4JM0A 2YS4A 2A9AA 2VAAB 1JRHL 2XXMB 1NCCH 3M46A 3O9WA 1EAJA 1QLRB 2DS4A 4GS7B 4ZMWA 3MJ9L 5DA4A 4KY2A 3VRLE 1DLHB 1ZLWK 5ES4B 4Y5VC 3ARPA 3IYLW 3SKJL 4E9RA 5BZXA 1LO0H 3NT0A 3QFDA 4PS8A 1NLDL 3KLQA 4ENED 3EUDA 5JA8B 4UNUA 1ZWIB 3BPNC 5M7QA 5AD0A 4HCRA 1HT6A 1YCSA 2W0LA 4ZFZA 3WSQH 3F62A 3JZ7A 2GI0A 3B34A 4OGYH 4AL8H 2W60A 1KIQA 4RISL 3MLXL 4PR5B 5ABDE 2X4QA 4JHVA 3WUWB 4MNQA 2OI9B 1RK0B 3L1GA 1FFNB 2FJSA 4QHKJ 3IFNH 4JKNA 1I85A 2NW2B 5DUPL 2NY7L 4TF4A 1XF2A 3QUHA 1JHTA 3H9ZA 3B2UC 3BGAA 4XPBH 5GS3A 4PLJD 4OD2A 4YDIL 1FIEA 3GS4A 3DX8B 4Y0GA 1C16A 3APDA 1WQVT 4A55A 1MQ8A 4QPEA 2JF1A 2DYPB 1P9MC 4P23D 5GS2H 3OKOA 5MEPB 5HVWA 4IKJA 3AT8A 4OQTL 4BJLA 1JZ7A 1ZSHA 3EDKA 1EXHA 5EU6D 4OLUL 4QRPB 4DZ8B 1R3KB 3GLEA 1RJYB 2CMRH 1TJXA 4HJUA 3RY6A 1AIFA 4LAQH 4PRNB 2IH3B 4R8WH 4I4WA 4WI5A 5I6XB 4ONGH 4PJIE 1E9OA 4E2OA 5T1KA 4OV5B 4ZW6A 1GGCL 2G2RA 2WK2A 7PAZA 4J8QA 4RLDA 4A7GF 3NJIA 3MV01 2FL5A 4XNMA 5LXGH 5D7KD 1N19A 4MZRA 3EJTA 4IEFA 4IBWA 1NLBL 4QY8A 1FG2A 1MAMH 1VEOA 2DD8L 3RX8A 4AVHA 5JW5B 5B1AB 4G8GB 4L9LB 4CMMB 4UZUA 1ICTA 3HAEB 3QCUH 4RRPA 2OX5A 1U93B 3E2HC 2Z35A 3BRGC 3DO7A 2BNQE 1QNIA 4ODWB 4Q89A 5CBAB 3CSTA 2Y4SA 5L9DL 1PAMA 3SOBH 2ICWB 4X6FA 4DW2L 1INDH 4UV7L 4V2CB 4K7PL 5D71L 2PKDA 4EVNA 1PIGA 4U0RC 1LYQA 4Y4FA 3F85A 4ZS7H 3ARUA 3T4AB 1WHPA 3MOBL 4P9HL 4PJ5E 3AMLA 1NFDB 5F89B 1S9VB 4ZMOA 1P7QD 2NXZD 3L7EA 5EOCL 1N68A 1VFBA 4PTUB 1UJ3C 2CPCA 3D39A 4KV5E 5HYSB 4WU7B 3MI6A 2ARJB 4E9LA 4IHOB 3O3DB 1N70A 2F15A 2ADFL 3S3SA 4LLYB 2YPVL 4RGNE 1IT9H 3QJVB 4PYHA 4MA1B 2NY3C 1PMYA 5G55A 1TQBB 4FS0A 4WTZA 1TENA 4OFDA 3DYMA 4G9DA 5MHSD 4IDJL 4F58L 4TVPD 1G6RL 1SDAB 4Q58C 3LDBC 1KB9K 3GT6A 5KAQF 4P5TD 1PG7L 4N2NA 1SPDA 4X7EC 3SGDI 2QBWA 5A6LA 1FGVH 1QABA 4ODSL 2DBLL 4P59L 5ANME 3DUUB 4KUZH 2NNAB 3ELQA 4FMKA 1S5HB 4ZSOE 3K74B 3WN6A 1J0ZA 4L5FH 3V0VA 1RIVH 4MLSA 1W0VA 1G4RA 1AGFA 3NH7L 2WTRA 2BIQA 4IDLA 1SXSA 3D3VB 2EO1A 4JG9A 2OMVA 5DLML 5IOKA 3RU8H 5CD5C 1AC0A 2D2CC 4JRYD 1JN6A 5FA4A 1JPFA 2WXMA 1GZPA 2Q8AH 2Y0SA 1JZIA 2AQTA 3EYFB 3SDXE 1NDGB 3GGWB 5INDB 4JO3L 4JMNA 1NKRA 2OJZL 1X7SA 5LBSH 4A38A 5EV7A 4KNTA 4LSPL 3VI3A 2ZUVA 4OZFH 43CAB 4MZIA 1NGYA 5AB1A 4ELME 3BFWA 5TPWH 3H6AA 4HS3B 1KXTB 3PL6D 3IT8D 4MCMA 2FJHA 5HPMB 3OD3A 3FZUD 4OR1A 4BUHA 3ECVA 2BS9A 3DPBA 3MZTA 1JGUH 3B9KA 3LHPH 3WIHA 2DLFH 2HFFA 4NNYA 4TSAL 5IQ7H 4PYGA 4N2LA 4OLYL 2NY1C 4CGUB 4W9EC 5C2BL 3QQNA 2DQIL 5IJVB 2D0HA 4O2FB 3LVEA 2CUIA 3QQ9D 1TPXC 2DYSB 1AO7A 2FBJL 2XV6B 4XMUA 5SV4A 4FQHB 4RVBA 1CWVA 2Z6FA 3KPPB 2B15A 4LCWE 2R4SH 5FK9B 2IV8A 3HC4L 1PY0A 3UYRL 2F5AH 3C12A 2WLIB 3HMXH 5I6PA 4Y1SA 3CFBB 4MSWB 5D1QC 5D2NB 2Z4TA 2EDYA 2PCPB 3VXOB 1IKNC 3IDJB 1SJXA 4GPVA 2ROXA 4WIQA 4P57B 4TMPA 2C3XA 2XC8A 1YYML 3HB3B 2FWOB 4YDVB 4GG6F 5IIEA 1ED3B 2QSVA 5T1MB 4FZEH 4Z0BH 2Z92B 4FZ8H 4RZCB 1P5VA 4IQHA 2NY2B 4PG9A 5ISZA 4PJEF 1MFEH 5HGDB 3DJSA 4AYBA 4YSQA 2NY6B 1AGDA 3LN5A 2A1WL 3U2SB 3EFOB 4JEGB 5GSVA 4X9GA 2HVKB 2ZWKA 1CFNB 1NFKA 1RULL 4XBPB 1AQDB 1WAPA 3EJYD 1BYNA 2BVEA 2P42B 2WYTA 4HD5A 2AGJH 1XH3B 2H3NB 1HSAB 5CZRA 3LB6C 1JVKA 2FEEI 1CLZH 1IM9A 1BBJA 4Z0XB 5E0FA 1XIWB 4BFJA 1E4XH 4Z9KB 4UTCA 1AY1L 3IDYC 5GISL 5GRYA 5I0YA 1FI8C 1YEJL 3KGSA 3VXUB 3VFOB 5B1KA 3HR6A 4F9LC 5D70H 4E0RA 1Y6MR 1E6JH 3FUFA 4JFFD 5E8NA 2HB0A 5IEKA 1W80A 1E6OL 4OLWH 2R2CA 1W72H 4ABQA 3QUGA 1INQB 2PLTA 2XWBB 3CHQA 3GSOB 1XGRB 3O3EB 1EO5A 5LCVH 1RAMA 1D9KA 2MTPA 4GKSA 3DIFB 1UOKA 1MFUA 3BXNA 3DX7B 1DBJH 1NM4A 4N28A 4H8WL 1MCSA 2IAMA 4QXUH 2XTJD 2ADIB 2NYZA 5CSZB 3UTTB 3UOAB 1KG0B 3U7YH 3TTYA 1L6ZA 1NL0H 5MEND 5EC2B 5D7SH 2A4CA 1T21A 1EAOA 4QDGA 2ID5A 3BAEL 4HJJH 4Z76A 1SN5A 3CC1A 4P4KB 2P5ED 5IVXB 2A83B 3ECWA 4GW4B 4PVNA 3NCYP 5E6IC 4ODTH 1TJGH 2BHFA 2BY2A 3W9EA 3JVGA 4JY5H 4Y9CA 2C7UA 4LLWA 1F41A 2FK9A 2HPOA 4M7ZC 1EV2E 4LVHB 4JJ5B 3LPOA 4DQOL 1A3LL 5DK0A 3VXME 3L5JA 3UO1L 3AM8C 5KW9H 2G75B 2IXQB 1HCFX 1MHEA 3GTVA 4DFIA 5L2KD 5D9SA 3W5MA 3QDME 2CO6A 5IV2A 2YPKA 2F0CA 4HHWA 4QRTB 3DXAD 4MASA 3W9DB 4HS8L 5FGSA 4DP4X 3MV7E 5IHUL 1Q9LA 5AW3B 1JD9A 1OANA 1T7XA 2ATKB 2HT2C 3GRGA 1EEYA 3JT2A 3LKPB 4UQ9A 4V1DB 5DZOA 3T0BA 3VXSA 4K5NA 5DO2D 4M8QB 4UU9B 3RILA 1UZ6F 1A0QL 1TTBA 4PLOB 3DETC 4U1SA 4A6YH 5JDSB 3QYMA 5ANHA 5I1IH 5HY9A 1MDTA 2C1PB 2F8OA 1QHOA 1OE3A 3ZYIA 1AZVA 1JYVA 2VLJD 5GGUA 4GY4A 1U58A 5CU9A 1JV5B 4LHJB 4C56A 3LEYH 4IJ3B 3VMNA 3CDCA 3A67H 3F83A 3GJFA 5EZPA 4KKBC 5GIRA 4UDUB 4XP4H 3II1A 1WT5A 4ELDA 3RTQC 2YK1L 3PQYE 1P7HL 2BP0B 3DV4B 4G2AA 5GRWA 1DVFA 1MG3C 3G5YA 4PJ8C 1SBSH 5BVJA 3TBWA 2X4SA 2UZXA 3KE0A 2F19L 4JQIH 5I75C 1EHLL 4Z7NE 2IBBA 3B1TA 3ECBA 1L4IA 2PYFA 5JYMA 2DICA 2EXWD 1FZMB 1JZGA 4Z95H 3W0WE 3WIFB 3W5NA 2YQBA 2ZKMX 1T0MB 3CWGA 4PIBA 2A4ZA 5L4FA 4PN6A 2XWCA 1VACA 2CRMA 4RSYA 2FUQA 5D7EA 3VXNA 4DEUA 4YDKH 3BSZH 3NABL 1W0WA 3BW9A 5JLZB 4MBRA 1DQTA 4H88H 1IKFH 1PFCA 1AIZA 4CN4A 3SJVB 1Z0NA 4HIIB 3G6JB 1F42A 3LQMA 5B39A 2DKSA 1V7MH 1FL5B 3GS0A 5GSRA 5JNYB 3MVSA 3AJ7A 4XAKD 1WAEA 3NRQA 2HKFL 3IJ8A 2HT3C 3O9WD 3SGDH 3TONA 2AK4E 4U1IA 3H4FA 4WWKB 5IW3A 5F9JB 4YPGA 2XZQL 1L9NA 1J8RA 3FUDA 2KDGA 1URIA 1YPZE 2XBTA 3LRLA 4M3JA 4PJDB 4TUOB 4GH7B 3QUYA 1MWAA 3ROLA 3IRCA 5DU7A 2GSMB 2DY2A 1BLIA 3SDYH 4NQUA 2N0KA 1JG9A 3WXVH 5AYUL 4P2OA 3B2PA 2JB6A 4QTHA 4XPFH 4N0UB 1IU1A 4MNQD 1NEZG 4U4BA 5LBSA 3VDAA 4OZIA 3HI1A 1BXXA 1KV3A 1NCWH 2PW1B 4Z7OB 5I6XC 4JS7A 5EF2A 4XO4A 2MTAA 1B2YA 1ROWA 4XN1A 1UGNA 5EC1A 2H7WA 2O5ZH 5K59E 1RCYA 1JWMA 1VFUA 1MRDH 3O3AA 1I7RA 2X6UA 4AK2A 3LQZA 3U36B 3HRZA 1PW3A 4WNJA 1AD0A 2P48B 2QSCL 4XNZB 1AD9A 2XQYG 3TO4B 4BZ2H 3HTLX 1NGQL 4L9LC 3BGMB 3WJLC 3GMQB 4ODBD 4HIHB 5E2VL 1NFIB 1S7VA 1U91A 5JA9A 2B5IB 1EXUA 4HZAA 5DF0A 3V0GA 2DQEH 2VC2H 2V8LA 1A6ZA 4KBPA 4YBQD 3HLAA 5T1KD 4XVJH 3EFFA 1E50A 4P99A 3DSNB 4A1RA 3T4AC 4YH6A 1LO4H 3LS4H 3KMDA 2GC7C 1GZQB 4HS6B 1AG0A 1Q9OA 2LU5A 4OZHE 4F15B 3BSHA 3WFEH 1ZK5A 3WV0A 1EEUA 1QSFA 3V7AE 5KTEL 3G7TA 3Q2CA 4WDIB 1B6UA 1DJXA 4PJHE 4XWOC 4EXKA 2YKLH 3ZZLA 2VOTA 1QO3B 2VDNB 1XR9B 3I6LE 4OD1L 2NPLX 4WFFD 3CN1A 2J55A 2AJSH 5ADPL 5L0QC 3EYOA 2L8AA 5I76A 4MA1C 4D0CA 3OZKA 4ZTOH 4BDVB 1TQBC 1VEPA 3QUXA 3WEBA 3NIGB 4PREA 1R34A 1Q1PA 3MRDB 4U3XA 4Y4FD 4F20A 4PWKA 3WKMH 1ZT7A 3GMRB 4HH9A 5EIIG 4Z6AT 2P49B 3VUAA 4LSRL 5JQ6L 1BQHG 2AANA 3D39D 3KPMB 1KLGB 2HFGH 4FXKB 4M1GL 1JFQL 1RERA 1YMMB 4PJ7E 4IBZA 4PD4J 3UPRA 3HPLA 1DBBH 1MCQA 1OW0A 3RWEA 1YNKH 2Y2YA 4YXLL 4JO5A 2AHIA 3O0LA 2P1YA 3TU6A 2A5UA 5E6RB 2BSTB 3OLIA 4JN1L 2B59A 5FYKE 1FO0H 4I77H 2ZAIA 3G3LA 5IKCA 1NCCL 3S97C 3GD1C 4NHUB 2FO4A 4AKOA 1A9EB 4PG2A 3LEXB 5FB8A 4HIQA 2BOCA 4K5PA 5C8JB 4BWWA 3I9PA 2WCSA 4LHUG 2PXYC 4QT5B 5I1EL 1NA8A 3QWOA 2XETA 5I1HH 2PO6B 2WXJA 3HLKA 3Q1EA 1FIGL 5TJWK 3I85A 4M6AA 5HYQA 2WZ6A 4CVXA 3OBAA 4OGYL 2W91A 1NAKH 4JO1H 1KLUB 4X6EB 1NMAH 3NSDA 1VGKA 4OJEH 4W9JC 1M4KA 2BIPA 1VEMA 2YQ3A 4Z3HA 3ULAB 4LPYA 3P73B 3IFNL 4PJXB 5EF1A 4ZUWA 1ROCA 4BQ9A 5AOZA 4EZMA 1WFJA 2OZ4L 1QPXA 1OZTG 1C08B 1QD0A 2P7TB 3T6WA 4XPBL 5B1CA 2AFNA 2WVVB 1SLUA 5SWSB 2D7NA 2XOTA 1HE7A 3T6ZA 4NZTH 5D2NC 2KL6A 1ONQA 1U8PB 4L1TA 4LCCA 4GAAA 4ZFFB 3SQBB 4QLRA 2YIHA 4J1UA 3B9KD 4OKVA 5DA0B 1GC1C 1SVBA 4NCC2 4UT6A 3JWDC 2OMZA 5FOJA 1BVZA 4GW5B 4Q14A 3U48A 5EU3A 4A6YA 5KSBA 2CMRL 1UCBH 1GJIA 3KYMA 4XNUH 4LAQL 4R8WL 3R06B 1J12A 2FBOJ 3WTWA 4M4RB 1AO7D 4ONGL 1RZIA 2NY2C 2WLMA 3F65A 4LDLB 2D7PA 1CQKA 2GSGB 4CU8A 2NY6C 1K4DB 3PWLA 4X83A 3ZJAA 1T03H 1EH9A 5LXGL 3IRZA 1CE6A 1WIPA 2F9BT 4YHNB 4WV1B 2Z4QB 5HHQB 4YDJA 4XBGA 5FLVA 1N10A 1MAML 1AS8A 2Y7QB 3IS1X 3QCUL 3F7YA 5DQJB 3CN2A 3H42H 4BFRA 3O0RH 2APVA 1ECZA 5T5NF 4AW4A 1NCDH 1N7MH 1SYVA 3LQAC 1CC3A 3DKHA 3SOBL 4Q9CA 1INDL 1V55B 3MUHL 1N6QH 4J2XA 3EYVB 2DWEB 5ISZD 2IDFA 5HSFA 4ZS7L 2CIIA 4LQ1A 1NUGA 2BW5A 1FCGA 3II3A 4FABH 3NCBB 5DHVB 3FUJA 5KBLA 5DJ8B 3QUMB 5DMJB 5EB9A 3BSZA 4WUUE 1G1KA 1K2DB 4HEPA 4Y19A 3V79C 5IK3B 1IM9D 1E3XA 2WZ5A 3RRQA 2VL5A 3BT2H 1IT9L 4GMTH 2H1XA 4OT1H 3LPFA 1AHWA 2X4UB 4P4KC 3ZL2A 2EVHA 2EH8H 4GKLA 1IBHA 2X28A 3VXQB 2EH7L 4K4KA 1RJLA 2I07B 3SGEH 3ZDZF 4JFQA 3NAAL 3T2QA 1IAOB 1O6SA 2O5NA 1D9KD 4LVHC 4FNLH 1C5DA 2ZCLL 2X9WA 1FGVL 1JNHA 2IAMD 4ZUUA 1B3IA 4X5RA 1IE5A 5E8PB 1YQVH 2GB2A 4L5FL 4DUXA 1RIVL 4I13B 1PD0A 2WYIA 1T22B 2R1YB 1E27A 1V54B 2F54B 2NTSP 3STZB 5IR1A 3PXHA 1Z9OA 3N55A 3NCCB 4FF9A 3JV4B 3RU8L 4PI0A 4UQIM 1DJWA 4XN5A 1KB5B 2XBZA 3BH8A 4W6XB 2YN5A 5E6ZA 4MRBA 3F58L 3PAZA 3GK8L 2Z31A 2Q8AL 5JHBA 4EI5B 5DJ2A 2CO1A 1MIEH 3KNBB 4Y1AB 2A73A 5LBSL 1D7CA 3CMOH 3OJMB 2Q6WB 5JXAL 1PVHA 3E6FA 2XA8H 1SUHA 4WW2A 4PTTA 3CH8A 4DETA 1AZUA 2VDRB 5GS2D 4KFMA 2NNFA 2YEVB 2YMOA 3MV9B 2Q86B 3UG4A 5FGCB 2GQHA 3SCMB 5TPWL 3SE3C 4CVUA 5IP4A 1DCEA 3FQYA 3TVMB 2CHZA 3KBEA 4LOEA 4Q2ZB 3MX0A 4GEJA 1W0YT 2NXYB 3B9AA 2DEWX 5B8CC 4IJ3C 3LHPL 3AREB 2BINA 2DLFL 4DO4A 1MOEA 2WLLA 5IQ7L 2OKMA 1NEZB 2C9UA 3G6AB 5CBEA 3VXSD 3NPSB 2KUTA 3ARXA 3L3DB 5IUSA 4NKOB 3Q8BA 3QQ3A 3HG1A 4KTEH 4UYQA 1YY9C 4KKLC 3MGTB 3UZEA 2J3SA 3NCYS 5A2AA 1LXMA 4EUPH 2F5AL 5D2LB 1AKPA 3HMXL 4AT6B 5GGSB 3BUYB 1AQHA 1RZ8A 3C6SA 4U7KA 5GS1A 1N59B 4C56D 1U36A 3DTDA 3ZT5A 5BXFB 4J39A 4XX5A 4K0OA 3RX5A 1A7PH 3CCHA 3CSGA 4FQCH 4BFGA 4LSVH 1FNLA 4XMXA 1OE1A 4G1EB 1HHHA 1OHZA 2IALA 2DWDB 4HPHA 4FZEL 1DVFD 4Z0BL 1DQLL 4FZ8L 3WLBB 1WZLA 3HMWL 5T5FA 5GZNA 4OZ4A 5JIDA 4ZOBA 5C08B 1I1AB 1L6PA 1MFEL 1JMXA 3FO0L 4BH8B 4TNEA 4B9IA 1CFTB 1SEBA 1CDIA 4WHYH 3VXTB 2B4CL 5E9DA 1D5ZA 1PQZA 2P46B 4WWKC 5FXCH 2LVCA 4H26A 4LVOB 1HH6A 3S96B 2AGJL 1OALA 2QADB 5GRXG 3GSVA 2VTFA 5E7FA 4M7KH 5DUJA 4KK8C 2XJKA 2P52A 4MA3A 3U2IA 4J5VA 3G04A 5HGAA 2E7HA 1CLZL 3EBIA 5B3JF 3P40A 1E4XL 3H1ZA 1SEQH 4DP1X 1HXYA 2AEIT 5LHDA 1J05B 4B3VA 5D70L 5BRZB 7PCYA 4JK0D 4PV1C 1A4JA 4DGUA 1QAWA 4A2LA 3K72A 1R3HB 3OV6A 4OLWL 1W72L 3NSFA 4QRPE 5AKSA 3VD9A 4LT7A 2GJ6E 3QW9A 5DZ9A 1FRGH 4YGVA 5LCVL 4P2RA 1DBJL 4MKTA 2HUHA 4OLXH 3QJQB 4Y2OA 1MCLA 5K1JA 2KQMA 4NPKA 3GJEA 4UQAA 4QXUL 3CVHB 2Q3ZA 5DJ6A 1OGTB 3QUYD 2Q3AA 3U7YL 1PKQE 1NL0L 1NFAA 4XNZC 5FCUH 3TO4C 4EZLA 3GSQB 1EGJA 4KQ4H 1IGIL 5D7SL 1N9PA 4P2OD 5E23A 2CO7B 4KJWC 5TH2A 4HJJL 1GMIA 3HUJB 3VI4B 4G8GE 2OMWA 2P24A 1P6AB 3K1DA 4YN3A 3FO9B 5C0FA 4FTDA 4ODTL 2A6IA 2JKNA 3AUWB 1TJGL 1U8KA 1A6PA 4JY5L 4KXAA 3SYOA 1TU2B 3NDYE 1OSEA 2BPBA 2P3YA 4MDJA 4F1SA 1KGCE 3SE8H 4LHUB 3H0TB 4RH4A 3VYPA 3QZWG 3B5GA 1M05A 5KW9L 3U4KA 4U3SB 3DIVA 1UB5B 3V0EA 2EVIA 3LYRA 4LRNH 1NC2B 1RHFA 2B1HH 1LVEA 2WZ0A 3SDDB 3V4PB 2I9LA 1NFDE 1UWXK 2W81C 1IQDB 4JPQA 4A7VA 4NQXB 5AOLA 2EEBA 2GUOA 4E42B 5AVYB 2VLRA 2UX7A 4WFEE 2VMJA 2ZX5A 4E9XA 4HC1A 3TBYA 2ZXAA 2VABB 1MAJA 1TO4A 2ENJA 2IBZX 4PJ9A 1LWJA 5I1IL 1G9NC 2ZUQC 3ARTA 3W38A 2ENYA 1FL3A 4KHTH 4EDXB 2Y24A 5JPNB 2YAPA 1XF1A 3EDEA 5A43C 1ZHLA 5KSAC 1DQMH 3WNJA 3SB3A 3ZKXB 2X4PB 3MLVH 4CL7A 2EUZA 1QSFD 4AYFA 1TTFA 2R69A 3IDIA 8FABA 1L9OA 3A67L 3ULVD 4FXKC 3TCLA 3QDJB 1OP5H 3HBZA 3U0TA 4X6BA 3S5YA 1RSYA 5ICXA 2CCLA 3TJHC 3ZTEA 4LBEA 4QIRA 2HFEB 3K0YA 2KKQA 1QLEB 2X4NB 3AQYA 3TIEB 2CU9A 3UG3A 3SOTA 1SBSL 3HC0A 1OPGL 3D3VE 5DFAA 3QUXD 3OC5A 2VE6B 2WBJA 3MRHA 4FFZH 4JQIL 4C47A 1HQRA 1FVCB 1VJSA 2ZOUA 1IIIA 1U2HA 4UQDA 1GYVA 2NTFA 1NCJA 1JF1A 5B38B 3GMMA 1DBMH 3CHXA 3S3PA 1MCIA 3QRLA 4I3GA 4YAQB 2FR4A 5AAPA 3BSZL 1QEWA 4PJBE 3RNKA 4H88L 4X7SH 2Z91A 4Z3IA 3IS0X 1IKFL 3K5SA 2XG4A 5DEGA 1V7ML 2B14A 4IKKA 1DUYB 2XV3A 4GXUN 4ZUSB 5GJSH 2AJ3B 1DQKA 1G43A 3DOHA 1DN0B 4QJ5B 1GY2A 5J57B 5LNGA 3PWVA 5C6TH 3FQXA 4TYUA 1GC1H 2WSPA 3JWDH 1J0HA 3EO1B 4QWWC 4TLTA 1JAEA 4XODA 4B9FA 4NQEE 4GP4B 1C5BH 1UENA 3SDYL 4L1LA 3KPQA 5D2NE 3LNIA 3WXVL 3MA7B 3GIVB 2HKHH 1EANA 4XPFL 1TZAA 2ENSA 2VL4A 3TBCA 3MRGA 3GM0A 3UBXI 1LP9A 1NCWL 4JY6B 4OF7A 3ES6B 2FJFA 4JFEE 3IDMB 2NX5B 3KLAB 2MNJB 3BZFA 2O5ZL 1CFQB 1UURA 1WBXA 2MFNA 1MRDL 3D6GA 4PJGF 1ZSDA 4WV1C 3BUDA 2A6DA 4KGJA 1CYWA 3BP4A 4ZPVB 4YSOA 3B9EA 3HZMA 3SBWA 1WRFA 5IVNA 2V0AA 4YE0A 3I50H 3LQAH 2FE0A 3IPEA 3HN8A 3T2OA 1CXHA 3FB5A 3LTVA 2WOYA 5D5MB 4M4PA 2YD5A 2B9BA 5CIPA 3RPKA 2DQEL 2VC2L 4GAYA 1IVTA 4EUPA 2AS5M 1KELH 2FQFA 4KJYA 1MUJB 3K2UH 1MEXH 4HBQA 4XVJL 3C8HA 3VXUE 3UTZB 1TVDA 1P84K 2QL1A 3GRWA 4JRXA 5FYJE 5F44A 2JKLA 4HFWA 4P2QB 4JN2A 4X5WB 3GMOB 3QIBC 4C8XA 1H0DB 3T08A 2NZ9C 5M94B 3WFEL 3SZ6A 1J0IA 3GKZA 3VI3F 1M2VB 1Q94B 4ECNA 5E00B 4MB4A 5ESAB 3BP5A 2CHWA 4PS3A 3BGFB 3OKLA 1RXLA 3OKDB 3RB5A 1GYWA 5AOJA 2AJSL 5ELIA 3FOLB 4Z7QE 1N2RA 1NIAA 4POZC 3FU7A 3WY2A 3K46A 4E5XB 1NUNB 4KKZA 3UH8A 2XIBA 2Y7NA 4LXFA 3U0WH 3CFJA 2H26A 5T1LB 5IQLA 3WLWD 1Q9KB 4DPRA 4YFLI 2Q20A 4NN5B 3RWIB 3G5VB 2KZKA 2L0DA 3MBXH 4KJPD 4UAHA 4AV0A 3PCYA 4ZRGA 2BHUA 3IJHA 3RPBA 2RAMA 4DAGH 3MLRH 1TMQA 1JJUA 5DJYB 2HFGL 1B9KA 4Y19D 1G1YA 4X6CA 1BF8A 3HZYA 1DEEB 5DRZB 4X4XA 4BFKA 3QPQC 1A6TA 1T1WA 4I2XB 3O6MH 3LS5H 1YNKL 4F2MA 3MBWA 4N2GA 2AZUA 2VYRE 1HOEA 4LEXH 2X89A 3K4DA 2E9JA 5IEHA 4NP4H 2WSKA 3SPVA 4A7SA 1FO0L 4I77L 2DMKA 4EI5C 3VD7A 5C0JB 2B39A 3R8QA 1KZYA 5ILTH 2EZ0D 3X2QB 5L8KB 4JGMA 3VYNA 1SDYA 5EBLB 4P3CH 5H37A 3SCMC 4XB7A 1NC4B 1UADC 5I1HL 1KULA 1JCKA 2K8MA 3TVMC 5ALCH 1D5RA 3OKEA 3BQUB 1IL1A 1I8KB 1CDCA 5D4JA 4OJFH 1IX2A 4H20H 5A7BA 1ZA3A 3CBRA 1NAKL 3AREC 1UOLA 3KR3H 4JO1L 2EYSB 4ZW3A 1CTOA 2C1OA 2G5BB 3VGBA 1E9QA 4OF0A 4JFYB 3NPSC 2Z31D 4GKZB 4GO8A 3TBTA 1GIGH 1KPUB 3F5WA 1I9IH 2PABA 4ES8A 3UBGA 5E4AA 3NA9H 4F37F 4D0BB 5HDWA 3QEHB 4UDTA 2X2UA 1H3WM 3DV6B 4NZTL 4N3TA 2GG1A 2WKGA 2ZX7A 5GPRA 1JZ4A 4NKDB 1JZJA 4HBCH 3FCUB 4O2CA 3DMMC 3SN6N 4HV8B 1P53A 4CAGA 4OBRA 3ZDYB 1BVLA 3D30A 4KAQH 1ILUA 1S9YA 1CPUA 2ICEA 1UCBL 3OX8B 5F3BA 1ZE3C 2R29H 5F93C 3WS6C 3HG1D 2KS0A 1MSPA 3P9LB 3V95A 2UV3A 4PGCA 4QKTA 4WFGD 2ZOKB 4R7NA 1I1AC 2OP4H 3KCPA 3VCLA 3LZQA 1F2QA 1MZYA 4MD4A 4N25A 5EA0H 5FYKU 3G6JE 3OHXC 3RUGE 4EIBA 1T03L 1MFDH 2EEFA 1U8HB 2HJLA 4OI9A 4K3GA 1KJ3H 1KIRB 2HJFB 3MU3A 4GSUA 4LVOC 4JDEA 4UANA 1KTJA 4X9FA 2FSEA 5BVPH 2NYYC 3AB0B 3C6EA 3FCTB 1XL6A 1LM8V 3TOPA 1R5VA 1HSBA 2P26A 3O0RL 4RMUA 2J6EA 1R5IB 2HSIA 1NCDL 1N7ML 4Y2DC 2XSKA 4I88A 4MAUL 4DO5A 4FFZA 1FYTB 1WFOA 1ZEAL 2F7RA 1T83A 5GZND 2XBDA 3O45A 4EN3B 1N6QL 4PRBA 5FS5A 2WKLA 4U1LB 2EDDA 2QPUA 2B0SH 3DWTA 1P4UA 5DZAA 1Q0XH 1ID2A 1HEJC 4XCFH 4G7QB 5E9DD 4GRLA 4FABL 1AS6A 2YUZA 2TRHA 4QKXB 2BSEA 4DK6A 4Z7OE 2BOBB 5EO0A 3ML9A 2JH2A 2BIOA 4HKBB 4XN8A 4YXHH 1G7MA 2PCXA 3L6FB 4R4NC 3T0EE 4PIRF 1UASA 3MLSH 4W9HC 1GCFA 4N4YB 3BKYH 4JZJA 3QUKA 4HIJA 2MSPA 5D7IB 4N0FA 3BT2L 4OT1L 3QA3B 4HFUH 4BFIB 2Y2TA 1G0XA 4FCAA 1JWUB 4PBVC 3QFJB 3F64A 3F7VA 4QYAA 4X4YA 4YHPA 5CP3A 1XVSA 2EH8L 5C3LD 1RZKC 3CZFB 1IILE 1CN4A 5E5UB 1WG3A 3CXHK 1F3JA 4XMTA 2DH3A 1I7TB 2MCPH 3GINA 3D52A 4FNLL 4P2RD 4F91B 2JIXB 5E8EA 5T3ZH 3O8XB 5F6HI 3GSNB 4IOIB 3IMBA 3T3MF 3EHBD 5AOMA 2CR0A 5C0AA 3VFTA 1YQVL 5SWZE 3SDDC 2V2WB 5FUCC 2CK0H 2AK1H 5K5YA 2R2BA 1YMHA 4HCIA 4MX7B 1N0LA 5ENWA 1MFVA 1K5NB 2F7QA 3ARGA 2YPLA 1WBYA 5T3XE 3MCKA 4I48A 3S48A 2VRAA 3QG6A 4NNXA 2H0PA 3QI9C 1KENH 1NJ9A 2EDHA 1R5WA 1G9NH 1YY8B 3VNZA 2V9UA 2KZ1B 2XTLA 1MIEL 5F3HB 5IQ9B 4F33A 1YJDC 3EW3B 3P2DA 2ZWLT 4L48A 1JZ3A 1SDDB 1ZHNA 2XA8L 2J2ZB 5JPNC 2AVGA 5BV7C 4NSKB 2R7EB 4X50A 2QGBA 4WWPA 4PVLA 4LBAA 1SXNA 2W0KA 4HDIA 3X3GH 1IGMH 4Z7VE 1DQQB 3UADA 4NI3A 4QRUB 3IETA 3K91A 1ZS2A 3QNZA 2EO7A 5EBWA 3UAAA 3BH9B 2X1WL 3FSVA 3ETBJ 1KBPA 4AQ1A 4FXLA 4NQTA 3X1FA 4ZOCA 5DI8A 4NM8H 1YMME 5DURD 2VLRD 1TVBA 3BMWA 4KTEL 4MB1A 5TTRA 4BSVA 7FABH 5F0JB 4NBZB 3WL9A 4PJ9D 1T0NB 4YWGL 3CFCH 3KPNA 3BVNB 5DSCB 2G3ZA 1QFPA 3KLLA 1N8ZB 2VN5A 2X1PA 3RFZA 1PCXA 3FRUB 3KWWB 2YLKA 1FZKB 4HCFA 1KCUH 4Z7AA 2Y07H 2GEQA 1FFOA 4UIKL 2WVTA 3LD8B 2C4FT 1B2WH 1P6WA 5DFVC 2JK5A 2WD0A 1FSKC 1TCRB 4ZBJA 1KTBA 1TQSA 1A7PL 4FQCL 5FM8A 3HIZA 5IB1B 4LSVL 2AQ3A 2IMMA 3MV8B 4M93C 4D8PB 1CD0A 5D6CA 4XO5A 1DHKA 1URLA 1ASOA 1BV8A 4G8EA 4XPAH 1MI5A 2WBJD 4JKLA 1T6WA 5D7JA 4S1QH 1SOSA 1BCIA 2WXFA 4PJXE 2A0LD 3E0GA 5CWSB 1PFOA 3R1GH 2VITB 4M7KL 4GG6B 5JYLA 2WIIA 2XKNB 1H6TA 4C83A 4OI8A 1VZIA 3QNYA 2H1LM 2PWDA 4IIQB 2QVKA 3OM3B 3WS3A 2I26N 1SEQL 2IGFH 1PZ5A 1FNGB 5AFAA 5KEZA 1QRNA 3CE1A 4Z8FH 2CDEA 5IGXH 3ULVF 1PZAA 1AQMA 1B0GA 4JX0A 2VMFA 3LKQA 5I6LA 3QEGH 4WEEA 1N6UA 5D1ZB 5E7BA 5B7EA 4WO4A 3OKYA 5JZ7C 1FRGL 1ZDSA 2B16A 4AMWA 4P3WA 3SY0A 5TF0A 4Z77B 5CAYB 4NQDA 2FLBT 3W82A 2FEDD 4OLXL 1A5FH 4BQ8A 1ITCA 2JELH 3FPXA 2O5XH 3A4FA 3FUKA 3ZHKA 5DHDA 4HOWA 2ALAA 5IOPA 1T04A 3KPSE 3PWUB 3R4DA 4HU8A 1MCOH 5FCUL 3PHOA 3FT4B 4KQ4L 4EDWH 1SM3H 1PPIA 1SXBA 4QHMA 4TSCH 1LEGA 3TO2B 2FO8A 5E8OB 3OJDA 1E4WH 5KBKA 1IAKB 3Q2LA 2AEWA 4HMEA 25C8H 4UQ3A 3SE8L 4K9EC 4L37A 2OMUB 3WGUB 3S37X 3VWKB 1A66A 1XCTA 1UFGA 1KLFA 2BFVH 4F7CB 1I3GH 4HJ1A 4LRNL 2PYEA 2B1HL 2AJZB 5FCSH 2JXMA 1CDUA 3CQPA 4R9HA 4QYOA 5A2IH 1FJ1B 3AW5A 1KJ2A 4KJQD 3KWVA 3VAEA 2NT1A 3BGFC 4MA7L 2RQ8A 4ZO6A 2WXGA 3TYFB 2X40A 4UT9H 1FZOA 5BOPA 1ZV5A 4LB8A 1OF2A 5TQ2L 1F90H 3KL3A 4L4VA 2PUQT 1XHHA 5H8DA 4JRXD 4KHTL 2CR6A 1DP0A 3BI9X 3IXAA 1BEXA 4HIEB 1OB1B 1DQML 2BXZA 1UXWA 4LPTA 2Y1ZA 3MLVL 4UTAH 5FA3A 3LSOB 4JFWA 1BOGA 1GKOA 3JXAA 3M86A 3KLSA 2DQDH 3INOA 1KB5H 2IMNA 3LKSA 2VLLB 4GI9A 2COQA 5J06A 5CGYD 4AIXA 4G83A 4I0CC 3RZCC 4ZZFA 2J1YA 3T0VA 1TZ8A 5I0XA 3NRPA 3LPWA 2F54E 3BP6A 2FECI 3PREA 2RFXA 2ZXDA 5KSBF 4A37A 3TF7C 3PGCA 4U6VL 2GT9B 4APQB 3RTLA 1AGCA 2CQVA 2Y36L 1KN2H 5DHYB 2OS7A 5KZCB 3ARFA 2LU3A 3QJFB 2CIKB 5KS9E 2EE6A 1DBML 3FTUA 3HS0C 1E0OB 2OMBA 3L3GA 4ZX6A 2C9QA 5AYTA 5I1DA 3DGDA 3U7WH 5IB4A 3FN0L 3WKPA 4M00A 1X7TA 2EECA 4FG2A 1U8NA 3MGOB 1DFXA 4JHUA 2WUCL 4H5SB 3ET9F 1L9TA 1Y1UA 3JWNE 2PCYA 1AOHA 1TIUA 3O41B 1ETA1 2X89D 1INEH 2CCWA 4FG4A 1UQSA 2GK0A 1PSKH 3NJKA 5F9AC 1DSYA 1BXAA 1CDJA 5GJSL 3Q6FA 2X87A 2XCMC 4A66A 3VXRB 2J43A 5DC0A 1E5UI 3ARDA 3AADB 4HX1B 4FQXB 3DVNB 4G6JH 2GITA 4CDGC 1MHHB 3VFGH 1E2ZA 1EVTC 3F7QA 4IS6A 3QGVA 3QO0B 2GTZA 4O02B 5T1DH 5KYYA 2XDHA 2VW4A 2ZXCA 3RGVB 1GC1L 1NMBH 3QNXA 1DCLA 3JWDL 5DS1A 1K6QH 3T3PE 5D2LE 3UBXA 1C5BL 2BNQA 3NZHL 5DC9B 1JXDA 1ZE3H 2HKHL 1J0YA 1T1ZB 2XWTA 3P77A 5JOPD 1AZCA 4ZUTA 1FGNH 3W39B 2R9HD 4L0PB 4DP0X 2V33A 3TH2T 5F6HJ 1S78D 3CVIH 2R0LL 4OCWH 1R19A 3S5LA 1HZKA 4PJ5A 4R5XA 4B5EA 4EQ3A 2UX6A 2ZE0A 3QJZA 4AZ8B 5D6DC 4O4YH 1JOIA 2WYHA 4ZUVA 4Q6IB 2Q10A 4YHKH 1U3YA 3IXTB 2DQJL 1HZHH 3QHZL 4LGSB 2AKRA 4Q9QH 5J8OA 3E3QC 1CFSA 5L8JB 1EIBA 3D0VA 3AB0C 2NLJB 4MTMA 3UTSE 1GMEA 3I50L 1HYRC 3LQAL 1EPFA 3LIZA 4HIPA 3D85B 1JS4A 1S3KH 4BK8A 3MUUA 1KB3A 1G7IB 2XZCH 4HJ0D 2A9NH 4O2EA 1A4KB 5L2JB 1XCQA 1A25A 2ZSWB 2BWIA 1KELL 2EC9T 3H56A 4EN3C 3K2UL 4CC4A 1MEXL 2JJWA 4RNRB 1T66D 3IGAB 3MRKB 3O6KH 1BFVL 5F9DC 5CLYA 5BRZE 3QXAA 3EJUA 5FW7A 2GCYA 2YSTA 5K33A 4OCSH 2BNUB 4UIMA 5CMAA 4FXTA 5ANMA 3ZZSA 2QVTA 5DHEA 2OYPA 5J9PA 3C5SA 1HN1A 2A74A 5FLUA 2X4RA 4ZSOA 1T5WA 3T8XA 4LSTH 3X13A 5FW8A 3TP4A 1KTRL 3CD4A 3WFHA 2OXGA 3BZDA 5C0IB 4KDTC 3C09B 1J9TA 2ODHA 1MJJA 2YGVA 3QJHB 4QRQB 4XNQA 3NK4A 2ADJB 3CSYA 4GT7A 2XWZA 2AQRA 4QHLA 2ED9A 4JPWH 3CDFA 4IBSA 2DM7A 3QUZA 1YN7B 3SDXA 1RZKH 2DQUH 2YEZB 3U0WL 1KBVA 3EH2A 5D1XC 3B2XA 2OSLB 5FYLH 4DZBB 1D7DA 2XWJA 4N87A 4M6OH 4WENB 3VI4E 2ADGB 4H4NA 1AI1H 2I25N 2WWMC 4GRLD 2O61B 3MBXL 4NWTH 4ELMA 1UA3A 4GFTB 2BSED 5CEZH 3DGGB 4HUWB 4XRCA 1TTUA 2N3JA 4XZ4A 3WHXB 1N6VA 1G94A 3EH3B 4POUB 4DAGL 3MLRL 3O8XC 1PLAA 2KC0A 1P2CB 3MJ8B 2E74C 3V6FA 4U0QB 3D50A 1TKWB 4PRAB 3GBDA 2X41A 1JZEA 3V4VB 3LS5L 5EU6B 3NCEB 1DLFH 1CXFA 3QC6X 4LEXL 5IF0A 2DLTA 3HE6A 1YJDH 1NAMB 5L8LB 4NP4L 4LESA 2IADB 4XP5H 1ZT1A 1JE6A 1NBYB 1MRCL 4XOAA 3LH9A 5LN8A 4LCWA 1ET7A 4M3HA 2XTSA 5BV7H 5F1IB 3QULA 3BD3A 5ILTL 3M17B 4MJJA 2FX8H 2CE6A 5IQMA 3VFVA 1MHPH 3N43B 5C0AD 4S1DD 3TIDB 5FECB 1CGSL 5FYJU 5ALCL 3ZKNC 5IW6A 2VLME 4OJFL 4AYID 1EJ8A 3ARGD 2YPLD 4K5OA 4ZAKA 5HDQH 1MW3A 1QLEH 1MFMA 3KR3L 4F7TA 5EEZA 1GA2A 4NJ9H 2V5YA 2FGWH 3QC5X 3SKMA 1N5AA 3QDJE 4ZDHA 1GIGL 3MFFA 5ACMA 1I9IL 1GH7A 2WXOA 4U6YA 4YXKH 4FNTA 5FWRA 1KDJA 2GFBA 3NA9L 4YQXH 4DKDC 5FV1L 1XSOA 1WICA 2BVOB 5JHLH 3B9DA 1KGXA 2NXZB 5D7LE 5F9WB 5AVSB 1QFUH 1YG9A 4JG0H 3D2TA 5E99H 3V0AC 5M95B 2J73A 3WN5B 2YBRB 5E24E 4H25B 2FJUB 4IRJA 1D2OA 3GSWA 4HBCL 5ACZA 4HKXA 1ZV9A 3REVA 2ZKHH 3LD8C 1HI6A 4XI5C 3BD4A 2VUYA 4KAQL 5DYOA 5C1MB 4AY0A 1OAUH 1OF0A 3ELAT 2YRLA 3OAUH 1KTLA 3V6OE 3WNNA 2R29L 3S37H 3D9AH 3DX4A 4L8BB 4R4BB 4ODXA 3DURA 3P3RA 4PCKA 2OP4L 3FO1A 3L3JB 1R3LB 3QZMA 4YSPA 5EA0L 4P5TB 1BVKA 3X3FH 1F8TH 1MFDL 4E41E 3WJMA 1KJ3L 2QR0B 3RYMA 5CN1A 5CP7B 1LO5B 5MERB 2YRZA 1ZTXL 2NR6A 3BUBA 5BVPL 2V2TA 4G1MA 5E4EC 4KRPB 2HLAB 1IGCL 1YYCA 2ZOTA 1JPGA 2GEEA 3C60A 3ULUD 4FQ1H 3JTSB 4X42A 1DJIA 2K1MA 4JRYB 1JPSH 2CO4A 2W0FB 2QDVA 3TBVB 5TQ0H 4H1LG 1VF5C 3BIKB 2PMZA 1SJHB 2X4TB 3TEXA 3C87A 1O5PA 1MI5D 3DA0A 4KK6D 3WEXB 1JUFB 2B0SL 5DR5H 4WWNA 1Q0XL 3V0DA 4AQAB 4F37K 5D7JD 4JPIB 3DROB 3LKNA 4XCFL 3VXMA 4Y1TA 2E6QA 2GABA 5EBMB 4MNGB 5E2TH 2LGNA 1THCA 3QDMA 3EZJB 3CH1B 4NO3A 5I17A 4P04A 4EF3A 2G4GA 4YXHL 4P46A 4PS4H 1LQSR 2VN3A 2OMTA 4AKPA 3Q05A 2HTLD 5IMOB 3MLSL 3MV7A 4HKZB 3U9PH 3BKYL 1HDMB 2J6WA 4RRPG 4NHCH 1QRND 4YL9A 3N41F 3HNTH 4HFUL 5A7EA 2ZF9A 3CC5B 1X7QA 3ZZQA 1O7DC 3GB7B 2E6JA 1QR1B 1IGTB 4X8CA 4ZXBA 1XB3A 3NN8B 4K9EH 1KT2B 1WGVA 4WO4D 2XQYA 2YRPA 4U1NB 1JGDB 5CJBA 5HVFB 4UBDC 5F97E 3D0AA 2MCPL 5BOJA 4NQDD 3KLKA 3AG3B 5T3ZL 2WXPA 4NNPH 5AALA 2XZZA 2V6HA 2WINA 2WM0A 3MJ7A 4XPGH 4EIGB 2CK0L 2AK1L 1AQ8A 1G7LA 1AVAA 1H15B 5DK2A 3U9UB 4MJIA 1BEYH 1D6EA 3HC2A 3PQYA 3WU1A 1J9RA 3SDAA 1COBA 1JZFA 2E27H 1OQOA 3E1F1 5FPIA 3SGKA 2DWSA 1L9MA 2VXSH 5FC9A 1TQWA 2NY5C 3WELA 1KENL 2AV1B 4FHBD 1WS7A 1G9NL 1D5IH 3B3IB 2ZXGA 5IVZA 1EAQA 2IF7A 4Z7UB 5INCA 4WTZG 1FNEA 3THMH 2YOCA 5GHWH 1QWUA 3K2MC 1B4LA 1BQLH 3W0WA 4LAJH 3EGXB 5ESVA 3T2PA 1U8MA 2C9VA 4WFHD 1HHIB 1QBAA 4JQVA 5GGTA 4FMFA 2XU9A 4WI0A 1IGML 3IMSA 2IPTH 2PYED 2QSQA 3TGXA 4NS0A 4UNIA 3P4OA 4Y89A 4Z3FA 1K4CB 5DS8B 1SFHA 1J5IA 5SWQA 4I8DA 2A9DA 2DYRB 4GSRA 2P8LA 3B6SA 2LU7A 1DBKL 5E5MB 2P4AB 5FOBB 5TDNA 1BWWA 1YYLH 2CLRA 2K9UA 3QAQA 1HZLA 1WCBB 4TQHA 1PZCA 3GJFK 5EIIA 1QLFA 2N1TE 2ITCB 4EPSA 5EF0A 5MP6H 4YLBA 7FABL 2ZXWB 2H9GA 2H2SC 4WNQB 3HE7B 5B4MC 1BQHA 2AK4A 4L4VD 5HHPA 2YD0A 3DTUB 4L18A 3CFCL 4WU5A 4APQC 5A6MA 1C1EL 3OMIB 2NCEA 2ZUWA 4Q6YA 1LP9F 5I74C 4ACTA 1YPZA 4PP2A 3D5OF 3X14A 1KCUL 2Y07L 1B2WL 1JBJA 1ZVSB 3TL5A 5KOMC 2JWYA 2X9ZA 3AU1A 4R0LB 5FGRA 5C0CE 3DVGA 4QHUA 1UZ8A 4JDVB 1TTCA 4Z78A 3D09A 5BJTA 4XPAL 4F3FB 3HS8A 1AJ7H 2EYRB 2FT8A 3UTOA 1EUUA 1UKSA 2OL3B 4S1QL 1P5UA 2PW2B 1PL3A 1U4EA 2WXIA 3FB7B 3ARFD 3ZMRA 3WENA 4ZMTA 4GP8B 2BS71 5L2KB 1XGTB 1FN4A 2Y7MA 3R1GL 5J6GA 4M62H 2P8MA 1IC0A 3RGVC 4AUUA 3B4NA 4EOWH 3ARRA 3VTAA 4BKSC 3HJ0A 3RBSA 1ZHBB 3O11A 4KPHH 3BZEA 4JLRB 4PJAE 4CBZA 3FTWA 4ZYKB 4L9DA 3Q3GB 4MQ7B 3JSSA 3MRNB 4AIZB 4Z8FL 1KJVB 5IGXL 4E68A 4DPAX 4LZKA 4KVCH 3ZDYE 3BLKA 1WF5A 6PCYA 4F33B 3QEGL 2FT7A 3ARDD 4OZHA 3U0PA 4AENB 3TN0A 4QF1B 4G43A 2ZAGA 4Q6IC 3ABKB 2VLJB 1XB8A 5SV3A 1A5FL 2JELL 4ZK8A 2O5XL 2YGNA 3MLZH 4PJHA 4D8OA 3BO8A 3TA3B 1A1NB 1KBBA 4KOCA 1MCOL 3QZNA 5JPMC 1T5XB 2BNQD 2VMDA 4YE4H 4EDWL 3O2DA 1SM3L 3BVDB 4XVUD 5LGKA 4TSCL 4GRMB 2TSBA 3VFPA 1D5BB 4PB9H 5J1AA 5CR1A 3VJ6A 4X6CF 4QI3A 12E8H 1S7UA 2X44D 4O51A 3H9HB 1JMZA 3BEWA 2CRZA 4PJ5D 4BSWB 1HNGA 3VFMB 25C8L 3RKPA 2IWEA 3LZFH 1FYTE 2IFFH 3SZKC 4KK9D 3EOAB 2X1OA 5ECGA 1F1AA 1VADA 2BP8B 3DRQB 2XNAA 5IW1B 2BFVL 1QTSA 1I3GL 4PJ7A 4ENEC 4CBPA 1UYWL 5ERWB 4DEPB 3T6QC 4AM0B 1S9KC 4YR6B 1QQDB 4QXTA 3C09C 5JIHA 5CN2A 2I9TA 2BC4A 1XX9C 5C9KA 4G6AD 4XXWC 1RUAH 1A6AA 1IZJA 1H8SA 2XA3A 2ICCA 2YA0A 3GFUA 4ZD3H 4F57H 4UT9L 4MAYA 5CCHE 5HVHB 2UY6A 1F90L 1CU4L 3JTTA 5D7IE 5K39A 3BVXA 3G5ZA 2QKIA 5F6IC 1F6AA 2YFOA 2FQGA 4HQQH 4JCMA 3HI5L 5KSVA 1S3RA 5GGRA 3QFJE 4PLJC 3QFDB 4X9IA 3BQVA 1PNCA 4HWBA 1FNAA 3D69A 3QQXA 1UC6A 2B08A 4M61A 5A2FA 1M57B 4UTAL 4JKKA 4P23C 5GGVY 1Q0YH 3ZPDA 1VPOH 4FA7B 1TF4A 2DQDL 3H7LA 1KB5L 2W60B 1KIQB 1QX1A 2Q76B 4PJCE 4I89A 5D4HA 2X4QB 3AGVA 1KBWA 3WY4A 2JLPA 3QUZD 1BG1A 4UTBH 1MPAH 1XV8A 4AVIA 1WAAE 3ISWA 2V7NA 4ZNCD 4WGKA 1E28A 2M8XA 1XF2B 1JHTB 1MVUA 5AUMA 1TQCB 5KVFH 3Q13A 3KM1A 3HR5A 1OSZA 4OD2B 1KN2L 1S7SA 1C16B 4AEFA 4H40A 2RALA