1F22A

A proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans. comparison between the reduced and the oxidized forms.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
b'ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C7
publication title A proton-NMR investigation of the fully reduced cytochrome c7 from Desulfuromonas acetoxidans. Comparison between the reduced and the oxidized forms.
pubmed doi rcsb
molecule tags Electron transport
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2000-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02085 Cytochrom_CIII Class III cytochrome C family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.10.10 Alpha Beta Alpha-Beta Complex Cytochrome C3 Cytochrome C3 1f22A00
1NEWA 1A2IA 2Z47A 2LZZA 1I77A 2LDOA 19HCA 1DUWA 2A3PA 3SJ1X 3OV0A 3CARA 2CYMA 4HB8A 4HBFA 1W7OA 1MDVA 1QN1A 1RWJA 2FFNA 1QN0A 1EHJA 3OUQA 1J0PA 1OS6A 3SJ4X 2KSUA 2A3MA 2EWKA 1GMBA 1H29A 1GYOA 1HH5A 2YYWA 4HAJA 1OFWA 1IT1A 1WR5A 3SELX 2CVCA 1WADA 1GWSA 2EWIA 2BPNA 3SJ0X 2EWUA 1KWJA 2MZ9A 2YYXA 1AQEA 2KMYA 2YXCA 3CYRA 1OFYA 3H33A 2BQ4A 4HC3A 1F22A 2CTHA 1Z1NX 2CY3A 4HDLA 1L3OA 1J0OA 1LM2A 1GM4A 2E84A 1CZJA 1UP9A 3H34A 3BXUA 1UPDA 3H4NA 2N91A 4HB6A 3CAOA 2CDVA 3OUEA
chains in the Genus database with same CATH superfamily
1NEWA 1A2IA 2Z47A 2LZZA 1I77A 2LDOA 19HCA 1DUWA 2A3PA 3SJ1X 3OV0A 3CARA 2CYMA 4HB8A 4HBFA 1W7OA 1MDVA 1QN1A 1RWJA 2FFNA 1QN0A 1EHJA 3OUQA 1J0PA 1OS6A 3SJ4X 2KSUA 2A3MA 2EWKA 1GMBA 1H29A 1GYOA 1HH5A 2YYWA 4HAJA 1OFWA 1IT1A 1WR5A 3SELX 2CVCA 1WADA 1GWSA 2EWIA 2BPNA 3SJ0X 2EWUA 1KWJA 2MZ9A 2YYXA 1AQEA 2KMYA 2YXCA 3CYRA 1OFYA 3H33A 2BQ4A 4HC3A 1F22A 2CTHA 1Z1NX 2CY3A 4HDLA 1L3OA 1J0OA 1LM2A 1GM4A 2E84A 1CZJA 1UP9A 3H34A 3BXUA 1UPDA 3H4NA 2N91A 4HB6A 3CAOA 2CDVA 3OUEA
chains in the Genus database with same CATH topology
1NEWA 1A2IA 2Z47A 2LZZA 1I77A 2LDOA 19HCA 1DUWA 2A3PA 3SJ1X 3OV0A 3CARA 2CYMA 4HB8A 4HBFA 1W7OA 1MDVA 1QN1A 1RWJA 2FFNA 1QN0A 1EHJA 3OUQA 1J0PA 1OS6A 3SJ4X 2KSUA 2A3MA 2EWKA 1GMBA 1H29A 1GYOA 1HH5A 2YYWA 4HAJA 1OFWA 1IT1A 1WR5A 3SELX 2CVCA 1WADA 1GWSA 2EWIA 2BPNA 3SJ0X 2EWUA 1KWJA 2MZ9A 2YYXA 1AQEA 2KMYA 2YXCA 3CYRA 1OFYA 3H33A 2BQ4A 4HC3A 1F22A 2CTHA 1Z1NX 2CY3A 4HDLA 1L3OA 1J0OA 1LM2A 1GM4A 2E84A 1CZJA 1UP9A 3H34A 3BXUA 1UPDA 3H4NA 2N91A 4HB6A 3CAOA 2CDVA 3OUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEW A;  1A2I A;  2Z47 A;  2LZZ A;  1I77 A;  2LDO A;  19HC A;  1DUW A;  2A3P A;  3SJ1 X;  3OV0 A;  3CAR A;  2CYM A;  4HB8 A;  4HBF A;  1W7O A;  1MDV A;  1QN1 A;  1RWJ A;  2FFN A;  1QN0 A;  1EHJ A;  3OUQ A;  1J0P A;  1OS6 A;  3SJ4 X;  2KSU A;  2A3M A;  2EWK A;  1GMB A;  1H29 A;  1GYO A;  1HH5 A;  2YYW A;  4HAJ A;  1OFW A;  1IT1 A;  1WR5 A;  3SEL X;  2CVC A;  1WAD A;  1GWS A;  2EWI A;  2BPN A;  3SJ0 X;  2EWU A;  1KWJ A;  2MZ9 A;  2YYX A;  1AQE A;  2KMY A;  2YXC A;  3CYR A;  1OFY A;  3H33 A;  2BQ4 A;  4HC3 A;  1F22 A;  2CTH A;  1Z1N X;  2CY3 A;  4HDL A;  1L3O A;  1J0O A;  1LM2 A;  1GM4 A;  2E84 A;  1CZJ A;  1UP9 A;  3H34 A;  3BXU A;  1UPD A;  3H4N A;  2N91 A;  4HB6 A;  3CAO A;  2CDV A;  3OUE A; 
#chains in the Genus database with same CATH topology
 1NEW A;  1A2I A;  2Z47 A;  2LZZ A;  1I77 A;  2LDO A;  19HC A;  1DUW A;  2A3P A;  3SJ1 X;  3OV0 A;  3CAR A;  2CYM A;  4HB8 A;  4HBF A;  1W7O A;  1MDV A;  1QN1 A;  1RWJ A;  2FFN A;  1QN0 A;  1EHJ A;  3OUQ A;  1J0P A;  1OS6 A;  3SJ4 X;  2KSU A;  2A3M A;  2EWK A;  1GMB A;  1H29 A;  1GYO A;  1HH5 A;  2YYW A;  4HAJ A;  1OFW A;  1IT1 A;  1WR5 A;  3SEL X;  2CVC A;  1WAD A;  1GWS A;  2EWI A;  2BPN A;  3SJ0 X;  2EWU A;  1KWJ A;  2MZ9 A;  2YYX A;  1AQE A;  2KMY A;  2YXC A;  3CYR A;  1OFY A;  3H33 A;  2BQ4 A;  4HC3 A;  1F22 A;  2CTH A;  1Z1N X;  2CY3 A;  4HDL A;  1L3O A;  1J0O A;  1LM2 A;  1GM4 A;  2E84 A;  1CZJ A;  1UP9 A;  3H34 A;  3BXU A;  1UPD A;  3H4N A;  2N91 A;  4HB6 A;  3CAO A;  2CDV A;  3OUE A; 
#chains in the Genus database with same CATH homology
 1NEW A;  1A2I A;  2Z47 A;  2LZZ A;  1I77 A;  2LDO A;  19HC A;  1DUW A;  2A3P A;  3SJ1 X;  3OV0 A;  3CAR A;  2CYM A;  4HB8 A;  4HBF A;  1W7O A;  1MDV A;  1QN1 A;  1RWJ A;  2FFN A;  1QN0 A;  1EHJ A;  3OUQ A;  1J0P A;  1OS6 A;  3SJ4 X;  2KSU A;  2A3M A;  2EWK A;  1GMB A;  1H29 A;  1GYO A;  1HH5 A;  2YYW A;  4HAJ A;  1OFW A;  1IT1 A;  1WR5 A;  3SEL X;  2CVC A;  1WAD A;  1GWS A;  2EWI A;  2BPN A;  3SJ0 X;  2EWU A;  1KWJ A;  2MZ9 A;  2YYX A;  1AQE A;  2KMY A;  2YXC A;  3CYR A;  1OFY A;  3H33 A;  2BQ4 A;  4HC3 A;  1F22 A;  2CTH A;  1Z1N X;  2CY3 A;  4HDL A;  1L3O A;  1J0O A;  1LM2 A;  1GM4 A;  2E84 A;  1CZJ A;  1UP9 A;  3H34 A;  3BXU A;  1UPD A;  3H4N A;  2N91 A;  4HB6 A;  3CAO A;  2CDV A;  3OUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...