1F3YA

Solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius l.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
165
structure length
165
Chain Sequence
b'GPLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIADENOSINE 5',5'''-P1,P4-TETRAPHOSPHATE HYDROLASE
publication title The three-dimensional structure of the Nudix enzyme diadenosine tetraphosphate hydrolase from Lupinus angustifolius L.
pubmed doi rcsb
source organism Lupinus angustifolius
molecule tags Hydrolase
total genus 30
structure length 165
sequence length 165
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1f3yA00
4KG4A 3QSJA 4S2WA 3MCFA 2A8SA 1GA7A 4IJXA 3FK9A 2GB5A 3GZ5A 3R03A 1VRLA 4YPRA 2A8TA 4V14A 1PPWA 5GHIA 3SMDA 3GWYA 1VC9A 1F3YA 1VC8A 3BM4A 3U53A 2AZWA 2I6KA 1SOIA 3GRNA 3Q93A 1Q54A 2I8TA 1G0SA 1Q27A 1U20A 3MGMA 2B06A 2G74A 3Q91A 5ANWA 3A6SA 1MUTA 3DKUA 1G9QA 4N1TA 1TUMA 2YVNA 3Q4IA 4HFQA 4NFXA 5ANUA 3Q1PA 5FSNA 2QJOA 1V8WA 4ILQA 1MR2A 3AC9A 1VHZA 2R5WA 2DUKA 5GHQA 5DD4A 1PUSA 1V8MA 2G73A 5CFIA 2J8QA 3MDGA 3Q2SA 5FSIA 2YVMA 4KYXA 4ZG0A 3A6VA 3SONA 1K2EA 1V8TA 2Q9PA 2VNPA 3J7Ye 3ID9A 3O8SA 1RRSA 4K6EA 5CFJA 1HZTA 3ZR0A 1Q33A 2VNQA 1MQEA 2YVOA 2ICJA 3HYQA 3Q2TA 1RRQA 1V8NA 2A8RA 3N9UA 4N1UA 3X0QA 1SZ3A 1VIQA 3COUA 3SHDA 1RYAA 2O1CA 3BHOA 1JRKA 1NQZA 2A8PA 1VCDA 3MDIA 2O5WA 5FSMA 1KHZA 1MQWA 3E57A 4S2VA 3A6UA 5DPKA 5ANVA 3GZ8A 2FVVA 3I7VA 4S2XA 3X0PA 5GHPA 3O6ZA 1SJYA 3X0MA 1X51A 1V8LA 3BAPA 3HHJA 5BS6A 1X84A 5FSLA 5GHMA 2GT2A 2DSBA 3GG6A 1K26A 4C9XA 1XSAA 5IW5A 5GHNA 3FFUA 2GT4A 2B2KA 5GHOA 3ACAA 2W4EA 4JZVA 3FJYA 4MPOA 4KG3A 2XSQA 2RRKA 2KDWA 2I8UA 1HX3A 4YPHA 4C9WA 1I9AA 3X0LA 3FSPA 1SU2A 2CL3A 2DHOA 3I9XA 3X0OA 1XSCA 2A8QA 2YVPA 3X0RA 2PQVA 1NFSA 5DDGA 3X0JA 2JVBA 1PVFA 3WHWA 3EF5A 3X0KA 3ZR1A 4JZSA 1JKNA 1V8IA 4JZTA 1NFZA 2O5FA 2A6TA 1VHGA 1KTGA 2FMLA 3DUPA 3FCMA 4DYWA 1PUQA 1MK1A 1IRYA 2FKBA 5C7QA 1V8UA 1V8SA 1XSBA 3F13A 5ISYA 1V8RA 1R67A 3F6AA 1PUNA 1V8VA 3L85A 5FSOA 3G0QA 5HZXA 1KT9A 4ICKA 3KVHA 5ANTA 5BONA 3CNGA 3EEUA 4JZUA 4KTBA 5LPGA 3O69A 1NQYA 4YOQA 1X83A 2PNYA 3EESA 1V8YA 2QJTA 4S2YA 4NFWA 2KDVA 2YYHA 3O52A 3X0IA 3EXQA 3N77A 1PPXA 1OW2A 5C7TA 1VK6A 5GHJA 2QKMB 3P5TA 3I7UA 5DEQA 5FSKA 5C8LA 2DSCA 3P6YA 2B0VA 3X0NA 3H95A 1VIUA 3OGAA 1MP2A 5I8UA 1PPVA 3RH7A 4HVYA 3GZ6A 1QVJA 2ICKA 2DSDA 5IW4A 3A6TA 3O61A 5ANSA 3X0SA
chains in the Genus database with same CATH superfamily
4KG4A 3QSJA 4S2WA 3MCFA 2A8SA 1GA7A 4IJXA 3FK9A 2GB5A 3GZ5A 3R03A 1VRLA 4YPRA 2A8TA 4V14A 1PPWA 5GHIA 3SMDA 3GWYA 1VC9A 1F3YA 1VC8A 3BM4A 3U53A 2AZWA 2I6KA 1SOIA 3GRNA 3Q93A 1Q54A 2I8TA 1G0SA 1Q27A 1U20A 3MGMA 2B06A 2G74A 3Q91A 5ANWA 3A6SA 1MUTA 3DKUA 1G9QA 4N1TA 1TUMA 2YVNA 3Q4IA 4HFQA 4NFXA 5ANUA 3Q1PA 5FSNA 2QJOA 1V8WA 4ILQA 1MR2A 3AC9A 1VHZA 2R5WA 2DUKA 5GHQA 5DD4A 1PUSA 1V8MA 2G73A 5CFIA 2J8QA 3MDGA 3Q2SA 5FSIA 2YVMA 4KYXA 4ZG0A 3A6VA 3SONA 1K2EA 1V8TA 2Q9PA 2VNPA 3J7Ye 3ID9A 3O8SA 1RRSA 4K6EA 5CFJA 1HZTA 3ZR0A 2CZRA 1Q33A 2VNQA 1MQEA 2YVOA 2ICJA 3HYQA 3Q2TA 1RRQA 1V8NA 2A8RA 3N9UA 4N1UA 3X0QA 1SZ3A 1VIQA 3COUA 3SHDA 1RYAA 2O1CA 3BHOA 1JRKA 1NQZA 2A8PA 1VCDA 3MDIA 2O5WA 5FSMA 4J7GA 1KHZA 1MQWA 3E57A 4S2VA 3A6UA 5DPKA 5ANVA 3GZ8A 2FVVA 3I7VA 4S2XA 3X0PA 5GHPA 3O6ZA 1SJYA 3X0MA 1X51A 1V8LA 3BAPA 3HHJA 5BS6A 1X84A 5FSLA 5GHMA 2GT2A 2DSBA 3GG6A 1K26A 4C9XA 1XSAA 5IW5A 5GHNA 3FFUA 2GT4A 2B2KA 5GHOA 3ACAA 2W4EA 4JZVA 3FJYA 4MPOA 4KG3A 2XSQA 2RRKA 2KDWA 2I8UA 1HX3A 4YPHA 4C9WA 1I9AA 3X0LA 3FSPA 1SU2A 2CL3A 2DHOA 3I9XA 3X0OA 1XSCA 2A8QA 2YVPA 3X0RA 2PQVA 1NFSA 5DDGA 3X0JA 2JVBA 1PVFA 3WHWA 3EF5A 3X0KA 3ZR1A 4JZSA 1JKNA 1V8IA 4JZTA 1NFZA 2O5FA 2A6TA 1VHGA 1KTGA 2FMLA 3DUPA 3FCMA 4DYWA 1PUQA 1MK1A 1IRYA 2FKBA 5C7QA 1V8UA 1V8SA 1XSBA 3F13A 5ISYA 1V8RA 1R67A 3F6AA 1PUNA 1V8VA 3L85A 5FSOA 3G0QA 5HZXA 1KT9A 4ICKA 3KVHA 5ANTA 5BONA 3CNGA 3EEUA 4JZUA 4KTBA 5LPGA 3O69A 1NQYA 4YOQA 1X83A 2PNYA 3EESA 1V8YA 2QJTA 4S2YA 4NFWA 2KDVA 2YYHA 3O52A 3X0IA 3EXQA 3N77A 1PPXA 1OW2A 5C7TA 1VK6A 5GHJA 2QKMB 3P5TA 3I7UA 5DEQA 5FSKA 5C8LA 2DSCA 3P6YA 2B0VA 3X0NA 3H95A 1VIUA 3OGAA 1MP2A 4J7HA 1PPVA 5I8UA 3RH7A 4HVYA 3GZ6A 1QVJA 2ICKA 2DSDA 5IW4A 3A6TA 3O61A 5ANSA 3X0SA
chains in the Genus database with same CATH topology
4KG4A 3QSJA 4S2WA 3MCFA 2A8SA 1GA7A 4IJXA 3FK9A 2GB5A 3GZ5A 3R03A 1VRLA 4YPRA 2A8TA 4V14A 1PPWA 5GHIA 3SMDA 3GWYA 1VC9A 1F3YA 1VC8A 3BM4A 3U53A 2AZWA 2I6KA 1SOIA 3GRNA 3Q93A 1Q54A 2I8TA 1G0SA 1Q27A 1U20A 3MGMA 2B06A 2G74A 3Q91A 5ANWA 3A6SA 1MUTA 3DKUA 1G9QA 4N1TA 1TUMA 2YVNA 3Q4IA 4HFQA 4NFXA 5ANUA 3Q1PA 5FSNA 2QJOA 1V8WA 4ILQA 1MR2A 3AC9A 1VHZA 2R5WA 2DUKA 5GHQA 5DD4A 1PUSA 1V8MA 2G73A 5CFIA 2J8QA 3MDGA 3Q2SA 5FSIA 2YVMA 4KYXA 4ZG0A 3A6VA 3SONA 1K2EA 1V8TA 2Q9PA 2VNPA 3J7Ye 3ID9A 3O8SA 1RRSA 4K6EA 5CFJA 1HZTA 3ZR0A 2CZRA 1Q33A 2VNQA 1MQEA 2YVOA 2ICJA 3HYQA 3Q2TA 1RRQA 1V8NA 2A8RA 3N9UA 4N1UA 3X0QA 1SZ3A 1VIQA 3COUA 3SHDA 1RYAA 2O1CA 3BHOA 1JRKA 1NQZA 2A8PA 1VCDA 3MDIA 2O5WA 5FSMA 4J7GA 1KHZA 1MQWA 3E57A 4S2VA 3A6UA 5DPKA 5ANVA 3GZ8A 2FVVA 3I7VA 4S2XA 3X0PA 5GHPA 3O6ZA 1SJYA 3X0MA 1X51A 1V8LA 3BAPA 3HHJA 5BS6A 1X84A 5FSLA 5GHMA 2GT2A 2DSBA 3GG6A 1K26A 4C9XA 1XSAA 5IW5A 5GHNA 3FFUA 2GT4A 2B2KA 5GHOA 3ACAA 2W4EA 4JZVA 3FJYA 4MPOA 4KG3A 2XSQA 2RRKA 2KDWA 2I8UA 1HX3A 4YPHA 4C9WA 1I9AA 3X0LA 3FSPA 1SU2A 2CL3A 2DHOA 3I9XA 3X0OA 1XSCA 2A8QA 2YVPA 3X0RA 2PQVA 1NFSA 5DDGA 3X0JA 2JVBA 1PVFA 3WHWA 3EF5A 3X0KA 3ZR1A 4JZSA 1JKNA 1V8IA 4JZTA 1NFZA 2O5FA 2A6TA 1VHGA 1KTGA 2FMLA 3DUPA 3FCMA 4DYWA 1PUQA 1MK1A 1IRYA 2FKBA 5C7QA 1V8UA 1V8SA 1XSBA 3F13A 5ISYA 1V8RA 1R67A 3F6AA 1PUNA 1V8VA 3L85A 5FSOA 3G0QA 5HZXA 1KT9A 4ICKA 3KVHA 5ANTA 5BONA 3CNGA 3EEUA 4JZUA 4KTBA 5LPGA 3O69A 1NQYA 4YOQA 1X83A 2PNYA 3EESA 1V8YA 2QJTA 4S2YA 4NFWA 2KDVA 2YYHA 3O52A 3X0IA 3EXQA 3N77A 1PPXA 1OW2A 5C7TA 1VK6A 5GHJA 2QKMB 3P5TA 3I7UA 5DEQA 5FSKA 5C8LA 2DSCA 3P6YA 2B0VA 3X0NA 3H95A 1VIUA 3OGAA 1MP2A 4J7HA 1PPVA 5I8UA 3RH7A 4HVYA 3GZ6A 1QVJA 2ICKA 2DSDA 5IW4A 3A6TA 3O61A 5ANSA 3X0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KG4 A;  3QSJ A;  4S2W A;  3MCF A;  2A8S A;  1GA7 A;  4IJX A;  3FK9 A;  2GB5 A;  3GZ5 A;  3R03 A;  1VRL A;  4YPR A;  2A8T A;  4V14 A;  1PPW A;  5GHI A;  3SMD A;  3GWY A;  1VC9 A;  1F3Y A;  1VC8 A;  3BM4 A;  3U53 A;  2AZW A;  2I6K A;  1SOI A;  3GRN A;  3Q93 A;  1Q54 A;  2I8T A;  1G0S A;  1Q27 A;  1U20 A;  3MGM A;  2B06 A;  2G74 A;  3Q91 A;  5ANW A;  3A6S A;  1MUT A;  3DKU A;  1G9Q A;  4N1T A;  1TUM A;  2YVN A;  3Q4I A;  4HFQ A;  4NFX A;  5ANU A;  3Q1P A;  5FSN A;  2QJO A;  1V8W A;  4ILQ A;  1MR2 A;  3AC9 A;  1VHZ A;  2R5W A;  2DUK A;  5GHQ A;  5DD4 A;  1PUS A;  1V8M A;  2G73 A;  5CFI A;  2J8Q A;  3MDG A;  3Q2S A;  5FSI A;  2YVM A;  4KYX A;  4ZG0 A;  3A6V A;  3SON A;  1K2E A;  1V8T A;  2Q9P A;  2VNP A;  3J7Y e;  3ID9 A;  3O8S A;  1RRS A;  4K6E A;  5CFJ A;  1HZT A;  3ZR0 A;  1Q33 A;  2VNQ A;  1MQE A;  2YVO A;  2ICJ A;  3HYQ A;  3Q2T A;  1RRQ A;  1V8N A;  2A8R A;  3N9U A;  4N1U A;  3X0Q A;  1SZ3 A;  1VIQ A;  3COU A;  3SHD A;  1RYA A;  2O1C A;  3BHO A;  1JRK A;  1NQZ A;  2A8P A;  1VCD A;  3MDI A;  2O5W A;  5FSM A;  1KHZ A;  1MQW A;  3E57 A;  4S2V A;  3A6U A;  5DPK A;  5ANV A;  3GZ8 A;  2FVV A;  3I7V A;  4S2X A;  3X0P A;  5GHP A;  3O6Z A;  1SJY A;  3X0M A;  1X51 A;  1V8L A;  3BAP A;  3HHJ A;  5BS6 A;  1X84 A;  5FSL A;  5GHM A;  2GT2 A;  2DSB A;  3GG6 A;  1K26 A;  4C9X A;  1XSA A;  5IW5 A;  5GHN A;  3FFU A;  2GT4 A;  2B2K A;  5GHO A;  3ACA A;  2W4E A;  4JZV A;  3FJY A;  4MPO A;  4KG3 A;  2XSQ A;  2RRK A;  2KDW A;  2I8U A;  1HX3 A;  4YPH A;  4C9W A;  1I9A A;  3X0L A;  3FSP A;  1SU2 A;  2CL3 A;  2DHO A;  3I9X A;  3X0O A;  1XSC A;  2A8Q A;  2YVP A;  3X0R A;  2PQV A;  1NFS A;  5DDG A;  3X0J A;  2JVB A;  1PVF A;  3WHW A;  3EF5 A;  3X0K A;  3ZR1 A;  4JZS A;  1JKN A;  1V8I A;  4JZT A;  1NFZ A;  2O5F A;  2A6T A;  1VHG A;  1KTG A;  2FML A;  3DUP A;  3FCM A;  4DYW A;  1PUQ A;  1MK1 A;  1IRY A;  2FKB A;  5C7Q A;  1V8U A;  1V8S A;  1XSB A;  3F13 A;  5ISY A;  1V8R A;  1R67 A;  3F6A A;  1PUN A;  1V8V A;  3L85 A;  5FSO A;  3G0Q A;  5HZX A;  1KT9 A;  4ICK A;  3KVH A;  5ANT A;  5BON A;  3CNG A;  3EEU A;  4JZU A;  4KTB A;  5LPG A;  3O69 A;  1NQY A;  4YOQ A;  1X83 A;  2PNY A;  3EES A;  1V8Y A;  2QJT A;  4S2Y A;  4NFW A;  2KDV A;  2YYH A;  3O52 A;  3X0I A;  3EXQ A;  3N77 A;  1PPX A;  1OW2 A;  5C7T A;  1VK6 A;  5GHJ A;  2QKM B;  3P5T A;  3I7U A;  5DEQ A;  5FSK A;  5C8L A;  2DSC A;  3P6Y A;  2B0V A;  3X0N A;  3H95 A;  1VIU A;  3OGA A;  1MP2 A;  5I8U A;  1PPV A;  3RH7 A;  4HVY A;  3GZ6 A;  1QVJ A;  2ICK A;  2DSD A;  5IW4 A;  3A6T A;  3O61 A;  5ANS A;  3X0S A; 
#chains in the Genus database with same CATH topology
 4KG4 A;  3QSJ A;  4S2W A;  3MCF A;  2A8S A;  1GA7 A;  4IJX A;  3FK9 A;  2GB5 A;  3GZ5 A;  3R03 A;  1VRL A;  4YPR A;  2A8T A;  4V14 A;  1PPW A;  5GHI A;  3SMD A;  3GWY A;  1VC9 A;  1F3Y A;  1VC8 A;  3BM4 A;  3U53 A;  2AZW A;  2I6K A;  1SOI A;  3GRN A;  3Q93 A;  1Q54 A;  2I8T A;  1G0S A;  1Q27 A;  1U20 A;  3MGM A;  2B06 A;  2G74 A;  3Q91 A;  5ANW A;  3A6S A;  1MUT A;  3DKU A;  1G9Q A;  4N1T A;  1TUM A;  2YVN A;  3Q4I A;  4HFQ A;  4NFX A;  5ANU A;  3Q1P A;  5FSN A;  2QJO A;  1V8W A;  4ILQ A;  1MR2 A;  3AC9 A;  1VHZ A;  2R5W A;  2DUK A;  5GHQ A;  5DD4 A;  1PUS A;  1V8M A;  2G73 A;  5CFI A;  2J8Q A;  3MDG A;  3Q2S A;  5FSI A;  2YVM A;  4KYX A;  4ZG0 A;  3A6V A;  3SON A;  1K2E A;  1V8T A;  2Q9P A;  2VNP A;  3J7Y e;  3ID9 A;  3O8S A;  1RRS A;  4K6E A;  5CFJ A;  1HZT A;  3ZR0 A;  2CZR A;  1Q33 A;  2VNQ A;  1MQE A;  2YVO A;  2ICJ A;  3HYQ A;  3Q2T A;  1RRQ A;  1V8N A;  2A8R A;  3N9U A;  4N1U A;  3X0Q A;  1SZ3 A;  1VIQ A;  3COU A;  3SHD A;  1RYA A;  2O1C A;  3BHO A;  1JRK A;  1NQZ A;  2A8P A;  1VCD A;  3MDI A;  2O5W A;  5FSM A;  4J7G A;  1KHZ A;  1MQW A;  3E57 A;  4S2V A;  3A6U A;  5DPK A;  5ANV A;  3GZ8 A;  2FVV A;  3I7V A;  4S2X A;  3X0P A;  5GHP A;  3O6Z A;  1SJY A;  3X0M A;  1X51 A;  1V8L A;  3BAP A;  3HHJ A;  5BS6 A;  1X84 A;  5FSL A;  5GHM A;  2GT2 A;  2DSB A;  3GG6 A;  1K26 A;  4C9X A;  1XSA A;  5IW5 A;  5GHN A;  3FFU A;  2GT4 A;  2B2K A;  5GHO A;  3ACA A;  2W4E A;  4JZV A;  3FJY A;  4MPO A;  4KG3 A;  2XSQ A;  2RRK A;  2KDW A;  2I8U A;  1HX3 A;  4YPH A;  4C9W A;  1I9A A;  3X0L A;  3FSP A;  1SU2 A;  2CL3 A;  2DHO A;  3I9X A;  3X0O A;  1XSC A;  2A8Q A;  2YVP A;  3X0R A;  2PQV A;  1NFS A;  5DDG A;  3X0J A;  2JVB A;  1PVF A;  3WHW A;  3EF5 A;  3X0K A;  3ZR1 A;  4JZS A;  1JKN A;  1V8I A;  4JZT A;  1NFZ A;  2O5F A;  2A6T A;  1VHG A;  1KTG A;  2FML A;  3DUP A;  3FCM A;  4DYW A;  1PUQ A;  1MK1 A;  1IRY A;  2FKB A;  5C7Q A;  1V8U A;  1V8S A;  1XSB A;  3F13 A;  5ISY A;  1V8R A;  1R67 A;  3F6A A;  1PUN A;  1V8V A;  3L85 A;  5FSO A;  3G0Q A;  5HZX A;  1KT9 A;  4ICK A;  3KVH A;  5ANT A;  5BON A;  3CNG A;  3EEU A;  4JZU A;  4KTB A;  5LPG A;  3O69 A;  1NQY A;  4YOQ A;  1X83 A;  2PNY A;  3EES A;  1V8Y A;  2QJT A;  4S2Y A;  4NFW A;  2KDV A;  2YYH A;  3O52 A;  3X0I A;  3EXQ A;  3N77 A;  1PPX A;  1OW2 A;  5C7T A;  1VK6 A;  5GHJ A;  2QKM B;  3P5T A;  3I7U A;  5DEQ A;  5FSK A;  5C8L A;  2DSC A;  3P6Y A;  2B0V A;  3X0N A;  3H95 A;  1VIU A;  3OGA A;  1MP2 A;  4J7H A;  1PPV A;  5I8U A;  3RH7 A;  4HVY A;  3GZ6 A;  1QVJ A;  2ICK A;  2DSD A;  5IW4 A;  3A6T A;  3O61 A;  5ANS A;  3X0S A; 
#chains in the Genus database with same CATH homology
 4KG4 A;  3QSJ A;  4S2W A;  3MCF A;  2A8S A;  1GA7 A;  4IJX A;  3FK9 A;  2GB5 A;  3GZ5 A;  3R03 A;  1VRL A;  4YPR A;  2A8T A;  4V14 A;  1PPW A;  5GHI A;  3SMD A;  3GWY A;  1VC9 A;  1F3Y A;  1VC8 A;  3BM4 A;  3U53 A;  2AZW A;  2I6K A;  1SOI A;  3GRN A;  3Q93 A;  1Q54 A;  2I8T A;  1G0S A;  1Q27 A;  1U20 A;  3MGM A;  2B06 A;  2G74 A;  3Q91 A;  5ANW A;  3A6S A;  1MUT A;  3DKU A;  1G9Q A;  4N1T A;  1TUM A;  2YVN A;  3Q4I A;  4HFQ A;  4NFX A;  5ANU A;  3Q1P A;  5FSN A;  2QJO A;  1V8W A;  4ILQ A;  1MR2 A;  3AC9 A;  1VHZ A;  2R5W A;  2DUK A;  5GHQ A;  5DD4 A;  1PUS A;  1V8M A;  2G73 A;  5CFI A;  2J8Q A;  3MDG A;  3Q2S A;  5FSI A;  2YVM A;  4KYX A;  4ZG0 A;  3A6V A;  3SON A;  1K2E A;  1V8T A;  2Q9P A;  2VNP A;  3J7Y e;  3ID9 A;  3O8S A;  1RRS A;  4K6E A;  5CFJ A;  1HZT A;  3ZR0 A;  2CZR A;  1Q33 A;  2VNQ A;  1MQE A;  2YVO A;  2ICJ A;  3HYQ A;  3Q2T A;  1RRQ A;  1V8N A;  2A8R A;  3N9U A;  4N1U A;  3X0Q A;  1SZ3 A;  1VIQ A;  3COU A;  3SHD A;  1RYA A;  2O1C A;  3BHO A;  1JRK A;  1NQZ A;  2A8P A;  1VCD A;  3MDI A;  2O5W A;  5FSM A;  4J7G A;  1KHZ A;  1MQW A;  3E57 A;  4S2V A;  3A6U A;  5DPK A;  5ANV A;  3GZ8 A;  2FVV A;  3I7V A;  4S2X A;  3X0P A;  5GHP A;  3O6Z A;  1SJY A;  3X0M A;  1X51 A;  1V8L A;  3BAP A;  3HHJ A;  5BS6 A;  1X84 A;  5FSL A;  5GHM A;  2GT2 A;  2DSB A;  3GG6 A;  1K26 A;  4C9X A;  1XSA A;  5IW5 A;  5GHN A;  3FFU A;  2GT4 A;  2B2K A;  5GHO A;  3ACA A;  2W4E A;  4JZV A;  3FJY A;  4MPO A;  4KG3 A;  2XSQ A;  2RRK A;  2KDW A;  2I8U A;  1HX3 A;  4YPH A;  4C9W A;  1I9A A;  3X0L A;  3FSP A;  1SU2 A;  2CL3 A;  2DHO A;  3I9X A;  3X0O A;  1XSC A;  2A8Q A;  2YVP A;  3X0R A;  2PQV A;  1NFS A;  5DDG A;  3X0J A;  2JVB A;  1PVF A;  3WHW A;  3EF5 A;  3X0K A;  3ZR1 A;  4JZS A;  1JKN A;  1V8I A;  4JZT A;  1NFZ A;  2O5F A;  2A6T A;  1VHG A;  1KTG A;  2FML A;  3DUP A;  3FCM A;  4DYW A;  1PUQ A;  1MK1 A;  1IRY A;  2FKB A;  5C7Q A;  1V8U A;  1V8S A;  1XSB A;  3F13 A;  5ISY A;  1V8R A;  1R67 A;  3F6A A;  1PUN A;  1V8V A;  3L85 A;  5FSO A;  3G0Q A;  5HZX A;  1KT9 A;  4ICK A;  3KVH A;  5ANT A;  5BON A;  3CNG A;  3EEU A;  4JZU A;  4KTB A;  5LPG A;  3O69 A;  1NQY A;  4YOQ A;  1X83 A;  2PNY A;  3EES A;  1V8Y A;  2QJT A;  4S2Y A;  4NFW A;  2KDV A;  2YYH A;  3O52 A;  3X0I A;  3EXQ A;  3N77 A;  1PPX A;  1OW2 A;  5C7T A;  1VK6 A;  5GHJ A;  2QKM B;  3P5T A;  3I7U A;  5DEQ A;  5FSK A;  5C8L A;  2DSC A;  3P6Y A;  2B0V A;  3X0N A;  3H95 A;  1VIU A;  3OGA A;  1MP2 A;  4J7H A;  1PPV A;  5I8U A;  3RH7 A;  4HVY A;  3GZ6 A;  1QVJ A;  2ICK A;  2DSD A;  5IW4 A;  3A6T A;  3O61 A;  5ANS A;  3X0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...