1F7EA

The first egf-like domain from human blood coagulation fvii, nmr, 20 structures
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
46
structure length
46
Chain Sequence
b'SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (Blood Coagulation Factor VII)
publication title The effect of O-fucosylation on the first EGF-like domain from human blood coagulation factor VII.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 3
structure length 46
sequence length 46
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 1999-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1f7eA00
2G00L 1A3PA 1PRHA 1G2LB 1DQBA 1HREA 5L2YL 1XFEA 2BOUA 1FAKL 4D0FA 1IQIL 2F9BL 2WFTA 2YGPA 2BO2A 2WG4B 1P9JA 3NJPC 2UWLB 4AQTA 2WPKE 1YGCL 2D1JB 5CKMA 3KQEL 3M36L 1IQLL 2EI7B 1DVAL 3CA7A 4TGFA 2WG3C 5F19A 2BQ7A 3BT2A 3N8VA 1JV2B 2W2PE 1PXXA 2J4IB 4E1GA 1G1SA 4XLWA 4NA9L 4PH9A 4O1ZA 3KRKA 2TGFA 1TOZA 2VWLL 4O02B 3HO5A 1IQML 2P95L 2FLBL 3HO4A 3PGHA 1MQ5L 1F0RB 2EI6B 1APOA 2W2ME 2FLGA 4MMZB 2Y81B 3N8XA 1SZBA 3TBDA 4OTYA 2KB9A 1COUA 2Y5FL 3TZIA 1LPZA 1FFMA 2W2QE 2WYJB 1IP0A 3BT1A 3H5CB 3KK6A 2WYGB 1YUGA 5K0HB 3NTBA 3ELAL 3BPSE 1QFKL 4BTIA 4RRWA 1DX5I 3LN1A 1EPJA 2J94B 4ZH8B 1UZQA 1CVWL 1NZIA 1XKBA 1YUFA 5F1AA 1JBUL 1NFWB 1FJSL 3U73A 1L3YA 3P5BL 1HT5A 5IKVA 2J34B 1J9CL 3N8ZA 4BXSA 1UZKA 1Z6EL 1HRFA 2GD4A 3V65B 3ZYIB 2Y5HL 2VVUL 1F7MA 1OB1C 2BOXA 1C5MF 4Y7BB 2ADXA 3U7UG 1B9WA 2PHBB 2RHPA 2EI8B 1NFUB 3KL6B 4BDXA 2FD6A 1LPKA 2VJ3A 2XC4L 4Y76B 3N8WB 2YGOA 2PR3B 2Y5GL 1UZPA 2W3KB 1K36A 5I46L 3LTFB 2W2NE 1CEJA 2RA0L 1G1QA 4JZDL 1ADXA 2W86A 2P28B 1ATAA 1G2MB 1L5GB 2FLRL 2CJIB 1NFXB 2P3TA 2UWOB 4BXWA 1O5DL 1TLEA 3GISX 4X8VL 3N8WA 4M11A 1IQJL 4LORA 1ATDA 4MMXB 4RRXA 1FF7A 2KV4A 5JW1A 3LTGD 2VWNL 3SOBB 1EPHA 2XC0L 1EQHA 1CCFA 4ZAEB 3FFGL 1APQA 3QH0A 2BMGA 5JVYA 1G1RA 3LN0A 1W7XL 2OYUP 1IOXA 3Q7DA 3LAQA 5IKQA 1MQ6L 2MGRA 1WHFA 3QMOA 3F1SB 1LPGA 4JZEL 4Y71B 2XC5L 5IKTA 2PUQL 2WPME 1FE2A 1IGZA 3M37L 2Y82B 2WPIE 2J2UB 1IJQA 4FM5A 1W8BL 2K2SB 1HAFA 3NTGA 3NT1A 2VVCK 3SOQA 2XBYL 5EGMB 1UZJA 2VH0B 3KQBL 3LC3B 1DIYA 4JYVL 5FDQA 1NT0A 3KCGL 3HO3A 1PTHA 1CCVA 2P3FL 3EGFA 4BDWA 2BQWA 5COXA 4ISIL 1CVUA 4M10A 5CKQA 1HT8A 1ATEA 2B7DL 1TPGA 2VWOL 3OLUA 1I0UA 5JBBE 3HS5A 3ENSA 4Z0KB 3IJEB 3GCWE 1KSNB 1KLJL 1N1IA 2BOKL 3POYA 1JL9A 4A7IA 1ZAQA 1BF9A 2DDUA 1HAEA 1K37A 2WPLE 5KIRA 2KL7A 5CKNA 1F0SB 1GK5A 1KIGL 2RNLA 4Y79B 4D90A 1EBVA 1IOEL 2VH6B 4Y7AB 3R05A 3ZYJB 1RFNB 4BTTA 1NQLB 2I9AA 2K2TA 1IVOC 4XL1A 4ZHAB 4ZXYL 1XDTR 3GCXE 3N8YB 3RR3A 1YO8A 2OYEP 5JVZA 4X8UL 3SOVA 4JYUL 2BZ6L 3DEMA 3K9XA 3MDLA 1U8CB 1NPEB 2JKHL 4XBMA 4YZUB 1IQNL 4OTJA 1U67A 1WHEA 3CFWA 3HPTA 2J38B 5E8DA 2FZZL 1N7DA 1X7AL 4X8TL 1V3XB 1KLOA 1AUTL 2MHPA 2XBVL 3ASIA 1IGXA 2WFXB 1WU1B 4Z0LA 2XBXL 1P0SL 3F6UL 5KN5C 1LMJA 1IQGL 5L2ZL 2H9EL 1EGFA 2P3FN 3C9AC 3IITB 5JBCE 3SW2A 2BOHA 1ATBA 4NG9L 4X8SL 1URKA 4D0EA 1HJ7A 3V64C 3HS7A 1YUKB 1HX2A 3FBYA 1HCGB 4C16A 3LC5B 4ISHL 6COXA 1EMNA 3TGFA 3TK5B 1PFXL 3Q3KB 3TH3L 2BQ6A 1IQFL 1EPIA 2Y7XB 2W2OE 2AYLA 1EPGA 3CENL 3HS6A 4YT7L 5CISA 1HZ8A 4CSYA 2W3IB 2Y38A 4G1MB 2M74A 5L30L 1MOXC 4YT6L 1PGEA 1EMOA 4RUTA 1IQEL 2P3UA 4CUEA 2NPRA 2Y7ZB 2VWMK 4BTUA 1EQGA 1KLIL 4Z6AL 1F7EA 3MQEA 4NGAL 4CUDA 1IQHL 4JZFL 4COXA 2P26A 3ZYGA 3LIWB 5IKRA 4ZXXL 1LQDA 5JB9E 2P93L 1CQEA 1XKAL 2UWPB 1FAXL 4Y6DB 3FCSB 4RRZA 2P16L 2MGPA 2W26B 2WPHE 1DDXA 2I9BA 4MMYB 4RRYA 4CUFA 1FSBA 4LMFA 1EZQB 1M1XB 3KQDL 2Y80B 2J95B 3TK6B 1G1TA 1EAIC 2P94L 1Q4GA 2Q1JB 1Z6CA 4RS0A 3QCWA 5JBAE 1CX2A 2XBWL 3OLTA 1NFYB 5JB8E 3CS7L 1IQKL 3KQCL 2WPJE 3N8YA 2VVVL
chains in the Genus database with same CATH superfamily
2G00L 1A3PA 1PRHA 1G2LB 1DQBA 1HREA 5L2YL 1XFEA 2H9EC 2BOUA 1FAKL 4D0FA 1IQIL 2F9BL 2WFTA 2YGPA 2BO2A 2WG4B 1P9JA 3NJPC 2UWLB 4AQTA 2WPKE 1YGCL 2D1JB 5CKMA 3KQEL 3M36L 1IQLL 2EI7B 1DVAL 3CA7A 2JJLA 1V1HA 4TGFA 2WG3C 5F19A 2BQ7A 3BT2A 3N8VA 1JV2B 2W2PE 1PXXA 2J4IB 4E1GA 1G1SA 4XLWA 4NA9L 4PH9A 4O1ZA 3KRKA 2TGFA 1TOZA 2VWLL 4O02B 3HO5A 1IQML 2P95L 2FLBL 3HO4A 3PGHA 1MQ5L 1F0RB 2EI6B 1APOA 2W2ME 2HORA 2FLGA 4MMZB 2Y81B 3N8XA 1SZBA 3TBDA 4OTYA 2KB9A 1COUA 2Y5FL 3TZIA 1LPZA 1FFMA 2VRSA 2W2QE 2WYJB 1IP0A 3BT1A 3H5CB 3KK6A 2WYGB 1YUGA 5K0HB 3NTBA 3ELAL 3BPSE 1QFKL 4BTIA 4RRWA 1DX5I 3LN1A 1EPJA 2J94B 4ZH8B 1UZQA 1CVWL 1NZIA 1XKBA 1YUFA 5F1AA 1JBUL 2HOXA 1NFWB 1FJSL 3U73A 1L3YA 3P5BL 1HT5A 5IKVA 2J34B 1J9CL 3N8ZA 4BXSA 1UZKA 1Z6EL 1HRFA 2GD4A 3V65B 3ZYIB 2Y5HL 2VVUL 1F7MA 1OB1C 2BOXA 1C5MF 4Y7BB 2ADXA 3U7UG 1B9WA 2PHBB 2RHPA 2EI8B 2BSFA 1KKEA 1NFUB 3KL6B 4BDXA 2FD6A 1LPKA 2VJ3A 2XC4L 4Y76B 3N8WB 2YGOA 2PR3B 1V1IA 1UZPA 2W3KB 2Y5GL 5I46L 1K36A 3LTFB 2W2NE 1CEJA 2RA0L 1G1QA 4JZDL 1ADXA 2W86A 2P28B 1ATAA 1G2MB 1L5GB 2FLRL 2CJIB 1NFXB 2P3TA 2UWOB 4BXWA 1O5DL 1TLEA 3GISX 4X8VL 3N8WA 4M11A 1IQJL 4LORA 1ATDA 4MMXB 4RRXA 1FF7A 2KV4A 5JW1A 3LTGD 2VWNL 3SOBB 1EPHA 2XC0L 1EQHA 1CCFA 2WZPP 4ZAEB 3FFGL 1APQA 3S6XA 3QH0A 2BMGA 5JVYA 1G1RA 3LN0A 1W7XL 2OYUP 1IOXA 3Q7DA 3LAQA 4A94C 1MQ6L 5IKQA 2MGRA 1WHFA 3QMOA 3F1SB 1LPGA 4JZEL 4Y71B 2XC5L 5IKTA 2PUQL 2WPME 1FE2A 1IGZA 3M37L 2Y82B 2WPIE 2J2UB 1IJQA 4FM5A 1W8BL 2K2SB 1HAFA 3NTGA 3NT1A 2VVCK 3SOQA 2XBYL 5EGMB 1UZJA 2VH0B 3KQBL 3LC3B 4GU3A 1DIYA 4JYVL 5FDQA 1NT0A 3KCGL 3HO3A 1PTHA 1CCVA 2P3FL 3EGFA 4BDWA 1LMMA 2BQWA 5COXA 4ISIL 1CVUA 4M10A 5CKQA 1HT8A 1ATEA 2B7DL 1TPGA 2VWOL 3OLUA 1I0UA 5JBBE 3HS5A 3ENSA 4Z0KB 3IJEB 3GCWE 1KSNB 1KLJL 1N1IA 2BOKL 3POYA 1JL9A 4A7IA 1ZAQA 1BF9A 2DDUA 1HAEA 1K37A 2WPLE 5KIRA 2KL7A 5CKNA 1F0SB 1GK5A 1KIGL 2RNLA 4Y79B 4D90A 1EBVA 1IOEL 2VH6B 4Y7AB 3R05A 3ZYJB 1RFNB 4BTTA 1NQLB 2I9AA 2K2TA 1IVOC 4XL1A 4ZHAB 4ZXYL 1XDTR 3GCXE 3N8YB 3RR3A 1YO8A 2OYEP 5JVZA 4X8UL 3SOVA 4JYUL 2BZ6L 3DEMA 3K9XA 3MDLA 1U8CB 1NPEB 2JKHL 4XBMA 1QIUA 4YZUB 1IQNL 4OTJA 1U67A 1WHEA 3CFWA 3HPTA 2J38B 5E8DA 2FZZL 1N7DA 1X7AL 4X8TL 1V3XB 1KLOA 1AUTL 2MHPA 2XBVL 2BT8A 1IGXA 3ASIA 2WFXB 1WU1B 4Z0LA 2XBXL 1P0SL 3F6UL 5KN5C 1LMJA 1IQGL 5L2ZL 2H9EL 1EGFA 2P3FN 3C9AC 3IITB 5JBCE 3SW2A 2BOHA 1ATBA 4NG9L 4X8SL 1URKA 4D0EA 1HJ7A 3V64C 3HS7A 1YUKB 1HX2A 3FBYA 1HCGB 4C16A 3LC5B 4ISHL 6COXA 1EMNA 3TGFA 3TK5B 1LK9A 1PFXL 3Q3KB 4GU4A 3TH3L 2BQ6A 1IQFL 1EPIA 2Y7XB 2W2OE 2AYLA 2BT7A 1EPGA 3CENL 3HS6A 4YT7L 5CISA 1HZ8A 4CSYA 2W3IB 2Y38A 4G1MB 2M74A 5L30L 1MOXC 4YT6L 1PGEA 1EMOA 4RUTA 1IQEL 2P3UA 4CUEA 2NPRA 2Y7ZB 2VWMK 4BTUA 1EQGA 1KLIL 4Z6AL 1F7EA 3MQEA 4NGAL 4CUDA 1IQHL 2YGQA 4JZFL 4COXA 2P26A 3ZYGA 2KNIA 3LIWB 5IKRA 4ZXXL 1LQDA 5JB9E 2P93L 1CQEA 1XKAL 2UWPB 1FAXL 4Y6DB 3FCSB 4RRZA 2P16L 2MGPA 2W26B 2WPHE 1DDXA 2I9BA 4MMYB 4RRYA 4CUFA 1FSBA 4LMFA 1EZQB 1M1XB 3KQDL 2Y80B 2J95B 3TK6B 1G1TA 1EAIC 2P94L 1Q4GA 2Q1JB 1Z6CA 4RS0A 3QCWA 5JBAE 1CX2A 2XBWL 3OLTA 1NFYB 5JB8E 3CS7L 1IQKL 3KQCL 2WPJE 3N8YA 2VVVL
chains in the Genus database with same CATH topology
2G00L 1A3PA 1PRHA 1G2LB 1DQBA 1HREA 5L2YL 1XFEA 2H9EC 2BOUA 1FAKL 4D0FA 1IQIL 2F9BL 2WFTA 2YGPA 2BO2A 2WG4B 1P9JA 3NJPC 2UWLB 4AQTA 2WPKE 1YGCL 2D1JB 5CKMA 3KQEL 3M36L 1IQLL 2EI7B 1DVAL 3CA7A 4TGFA 2WG3C 5F19A 2BQ7A 3BT2A 3N8VA 1JV2B 2W2PE 1PXXA 2J4IB 4E1GA 1G1SA 4XLWA 4NA9L 4PH9A 4O1ZA 3KRKA 2TGFA 1TOZA 2VWLL 4O02B 3HO5A 1IQML 2P95L 2FLBL 3HO4A 3PGHA 1MQ5L 1F0RB 2EI6B 1APOA 2W2ME 2FLGA 4MMZB 2Y81B 3N8XA 1SZBA 3TBDA 4OTYA 2KB9A 1COUA 2Y5FL 3TZIA 1LPZA 1FFMA 2W2QE 2WYJB 1IP0A 3BT1A 3H5CB 3KK6A 2WYGB 1YUGA 5K0HB 3NTBA 3ELAL 3BPSE 1QFKL 4BTIA 4RRWA 1DX5I 3LN1A 1EPJA 2J94B 4ZH8B 1UZQA 1CVWL 1NZIA 1XKBA 1YUFA 5F1AA 1JBUL 1NFWB 1FJSL 3U73A 1L3YA 3P5BL 1HT5A 5IKVA 2J34B 1J9CL 3N8ZA 4BXSA 1UZKA 1Z6EL 1HRFA 2GD4A 3V65B 3ZYIB 2Y5HL 2VVUL 1F7MA 1OB1C 2BOXA 1C5MF 4Y7BB 2ADXA 3U7UG 1B9WA 2PHBB 2RHPA 2EI8B 1NFUB 3KL6B 4BDXA 2FD6A 1LPKA 2VJ3A 2XC4L 4Y76B 3N8WB 2YGOA 2PR3B 2Y5GL 1UZPA 2W3KB 1K36A 5I46L 3LTFB 2W2NE 1CEJA 2RA0L 1G1QA 4JZDL 1ADXA 2W86A 2P28B 1ATAA 1G2MB 1L5GB 2FLRL 2CJIB 1NFXB 2P3TA 2UWOB 4BXWA 1O5DL 1TLEA 3GISX 4X8VL 3N8WA 4M11A 1IQJL 4LORA 1ATDA 4MMXB 4RRXA 1FF7A 2KV4A 5JW1A 3LTGD 2VWNL 3SOBB 1EPHA 2XC0L 1EQHA 1CCFA 2WZPP 4ZAEB 3FFGL 1APQA 3S6XA 3QH0A 2BMGA 5JVYA 1G1RA 3LN0A 1W7XL 2OYUP 1IOXA 3Q7DA 3LAQA 4A94C 1MQ6L 5IKQA 2MGRA 1WHFA 3QMOA 3F1SB 1LPGA 4JZEL 4Y71B 2XC5L 5IKTA 2PUQL 2WPME 1FE2A 1IGZA 3M37L 2Y82B 2WPIE 2J2UB 1IJQA 4FM5A 1W8BL 2K2SB 1HAFA 3NTGA 3NT1A 2VVCK 3SOQA 2XBYL 5EGMB 1UZJA 2VH0B 3KQBL 3LC3B 1DIYA 4JYVL 5FDQA 1NT0A 3KCGL 3HO3A 1PTHA 1CCVA 2P3FL 3EGFA 4BDWA 1LMMA 2BQWA 5COXA 4ISIL 1CVUA 4M10A 5CKQA 1HT8A 1ATEA 2B7DL 1TPGA 2VWOL 3OLUA 1I0UA 5JBBE 3HS5A 3ENSA 4Z0KB 3IJEB 3GCWE 1KSNB 1KLJL 1N1IA 2BOKL 3POYA 1JL9A 4A7IA 1ZAQA 1BF9A 2DDUA 1HAEA 1K37A 2WPLE 5KIRA 2KL7A 5CKNA 1F0SB 1GK5A 1KIGL 2RNLA 4Y79B 4D90A 1EBVA 1IOEL 2VH6B 4Y7AB 3R05A 3ZYJB 1RFNB 4BTTA 1NQLB 2I9AA 2K2TA 1IVOC 4XL1A 4ZHAB 4ZXYL 1XDTR 3GCXE 3N8YB 3RR3A 1YO8A 2OYEP 5JVZA 4X8UL 3SOVA 4JYUL 2BZ6L 3DEMA 3K9XA 3MDLA 1U8CB 1NPEB 2JKHL 4XBMA 4YZUB 1IQNL 4OTJA 1U67A 1WHEA 3CFWA 3HPTA 2J38B 5E8DA 2FZZL 1N7DA 1X7AL 4X8TL 1V3XB 1KLOA 1AUTL 2MHPA 2XBVL 3ASIA 1IGXA 2WFXB 1WU1B 4Z0LA 2XBXL 1P0SL 3F6UL 5KN5C 1LMJA 1IQGL 5L2ZL 2H9EL 1EGFA 2P3FN 3C9AC 3IITB 5JBCE 3SW2A 2BOHA 1ATBA 4NG9L 4X8SL 1URKA 4D0EA 1HJ7A 3V64C 3HS7A 1YUKB 1HX2A 3FBYA 1HCGB 4C16A 3LC5B 4ISHL 6COXA 1EMNA 3TGFA 3TK5B 1PFXL 3Q3KB 3TH3L 2BQ6A 1IQFL 1EPIA 2Y7XB 2W2OE 2AYLA 1EPGA 3CENL 3HS6A 4YT7L 5CISA 1HZ8A 4CSYA 2W3IB 2Y38A 4G1MB 2M74A 5L30L 1MOXC 4YT6L 1PGEA 1EMOA 4RUTA 1IQEL 2P3UA 4CUEA 2NPRA 2Y7ZB 2VWMK 4BTUA 1EQGA 1KLIL 4Z6AL 1F7EA 3MQEA 4NGAL 4CUDA 1IQHL 2YGQA 4JZFL 4COXA 2P26A 3ZYGA 2KNIA 3LIWB 5IKRA 4ZXXL 1LQDA 5JB9E 2P93L 1CQEA 1XKAL 2UWPB 1FAXL 4Y6DB 3FCSB 4RRZA 2P16L 2MGPA 2W26B 2WPHE 1DDXA 2I9BA 4MMYB 4RRYA 4CUFA 1FSBA 4LMFA 1EZQB 1M1XB 3KQDL 2Y80B 2J95B 3TK6B 1G1TA 1EAIC 2P94L 1Q4GA 2Q1JB 1Z6CA 4RS0A 3QCWA 5JBAE 1CX2A 2XBWL 3OLTA 1NFYB 5JB8E 3CS7L 1IQKL 3KQCL 2WPJE 3N8YA 2VVVL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G00 L;  1A3P A;  1PRH A;  1G2L B;  1DQB A;  1HRE A;  5L2Y L;  1XFE A;  2BOU A;  1FAK L;  4D0F A;  1IQI L;  2F9B L;  2WFT A;  2YGP A;  2BO2 A;  2WG4 B;  1P9J A;  3NJP C;  2UWL B;  4AQT A;  2WPK E;  1YGC L;  2D1J B;  5CKM A;  3KQE L;  3M36 L;  1IQL L;  2EI7 B;  1DVA L;  3CA7 A;  4TGF A;  2WG3 C;  5F19 A;  2BQ7 A;  3BT2 A;  3N8V A;  1JV2 B;  2W2P E;  1PXX A;  2J4I B;  4E1G A;  1G1S A;  4XLW A;  4NA9 L;  4PH9 A;  4O1Z A;  3KRK A;  2TGF A;  1TOZ A;  2VWL L;  4O02 B;  3HO5 A;  1IQM L;  2P95 L;  2FLB L;  3HO4 A;  3PGH A;  1MQ5 L;  1F0R B;  2EI6 B;  1APO A;  2W2M E;  2FLG A;  4MMZ B;  2Y81 B;  3N8X A;  1SZB A;  3TBD A;  4OTY A;  2KB9 A;  1COU A;  2Y5F L;  3TZI A;  1LPZ A;  1FFM A;  2W2Q E;  2WYJ B;  1IP0 A;  3BT1 A;  3H5C B;  3KK6 A;  2WYG B;  1YUG A;  5K0H B;  3NTB A;  3ELA L;  3BPS E;  1QFK L;  4BTI A;  4RRW A;  1DX5 I;  3LN1 A;  1EPJ A;  2J94 B;  4ZH8 B;  1UZQ A;  1CVW L;  1NZI A;  1XKB A;  1YUF A;  5F1A A;  1JBU L;  1NFW B;  1FJS L;  3U73 A;  1L3Y A;  3P5B L;  1HT5 A;  5IKV A;  2J34 B;  1J9C L;  3N8Z A;  4BXS A;  1UZK A;  1Z6E L;  1HRF A;  2GD4 A;  3V65 B;  3ZYI B;  2Y5H L;  2VVU L;  1F7M A;  1OB1 C;  2BOX A;  1C5M F;  4Y7B B;  2ADX A;  3U7U G;  1B9W A;  2PHB B;  2RHP A;  2EI8 B;  1NFU B;  3KL6 B;  4BDX A;  2FD6 A;  1LPK A;  2VJ3 A;  2XC4 L;  4Y76 B;  3N8W B;  2YGO A;  2PR3 B;  2Y5G L;  1UZP A;  2W3K B;  1K36 A;  5I46 L;  3LTF B;  2W2N E;  1CEJ A;  2RA0 L;  1G1Q A;  4JZD L;  1ADX A;  2W86 A;  2P28 B;  1ATA A;  1G2M B;  1L5G B;  2FLR L;  2CJI B;  1NFX B;  2P3T A;  2UWO B;  4BXW A;  1O5D L;  1TLE A;  3GIS X;  4X8V L;  3N8W A;  4M11 A;  1IQJ L;  4LOR A;  1ATD A;  4MMX B;  4RRX A;  1FF7 A;  2KV4 A;  5JW1 A;  3LTG D;  2VWN L;  3SOB B;  1EPH A;  2XC0 L;  1EQH A;  1CCF A;  4ZAE B;  3FFG L;  1APQ A;  3QH0 A;  2BMG A;  5JVY A;  1G1R A;  3LN0 A;  1W7X L;  2OYU P;  1IOX A;  3Q7D A;  3LAQ A;  5IKQ A;  1MQ6 L;  2MGR A;  1WHF A;  3QMO A;  3F1S B;  1LPG A;  4JZE L;  4Y71 B;  2XC5 L;  5IKT A;  2PUQ L;  2WPM E;  1FE2 A;  1IGZ A;  3M37 L;  2Y82 B;  2WPI E;  2J2U B;  1IJQ A;  4FM5 A;  1W8B L;  2K2S B;  1HAF A;  3NTG A;  3NT1 A;  2VVC K;  3SOQ A;  2XBY L;  5EGM B;  1UZJ A;  2VH0 B;  3KQB L;  3LC3 B;  1DIY A;  4JYV L;  5FDQ A;  1NT0 A;  3KCG L;  3HO3 A;  1PTH A;  1CCV A;  2P3F L;  3EGF A;  4BDW A;  2BQW A;  5COX A;  4ISI L;  1CVU A;  4M10 A;  5CKQ A;  1HT8 A;  1ATE A;  2B7D L;  1TPG A;  2VWO L;  3OLU A;  1I0U A;  5JBB E;  3HS5 A;  3ENS A;  4Z0K B;  3IJE B;  3GCW E;  1KSN B;  1KLJ L;  1N1I A;  2BOK L;  3POY A;  1JL9 A;  4A7I A;  1ZAQ A;  1BF9 A;  2DDU A;  1HAE A;  1K37 A;  2WPL E;  5KIR A;  2KL7 A;  5CKN A;  1F0S B;  1GK5 A;  1KIG L;  2RNL A;  4Y79 B;  4D90 A;  1EBV A;  1IOE L;  2VH6 B;  4Y7A B;  3R05 A;  3ZYJ B;  1RFN B;  4BTT A;  1NQL B;  2I9A A;  2K2T A;  1IVO C;  4XL1 A;  4ZHA B;  4ZXY L;  1XDT R;  3GCX E;  3N8Y B;  3RR3 A;  1YO8 A;  2OYE P;  5JVZ A;  4X8U L;  3SOV A;  4JYU L;  2BZ6 L;  3DEM A;  3K9X A;  3MDL A;  1U8C B;  1NPE B;  2JKH L;  4XBM A;  4YZU B;  1IQN L;  4OTJ A;  1U67 A;  1WHE A;  3CFW A;  3HPT A;  2J38 B;  5E8D A;  2FZZ L;  1N7D A;  1X7A L;  4X8T L;  1V3X B;  1KLO A;  1AUT L;  2MHP A;  2XBV L;  3ASI A;  1IGX A;  2WFX B;  1WU1 B;  4Z0L A;  2XBX L;  1P0S L;  3F6U L;  5KN5 C;  1LMJ A;  1IQG L;  5L2Z L;  2H9E L;  1EGF A;  2P3F N;  3C9A C;  3IIT B;  5JBC E;  3SW2 A;  2BOH A;  1ATB A;  4NG9 L;  4X8S L;  1URK A;  4D0E A;  1HJ7 A;  3V64 C;  3HS7 A;  1YUK B;  1HX2 A;  3FBY A;  1HCG B;  4C16 A;  3LC5 B;  4ISH L;  6COX A;  1EMN A;  3TGF A;  3TK5 B;  1PFX L;  3Q3K B;  3TH3 L;  2BQ6 A;  1IQF L;  1EPI A;  2Y7X B;  2W2O E;  2AYL A;  1EPG A;  3CEN L;  3HS6 A;  4YT7 L;  5CIS A;  1HZ8 A;  4CSY A;  2W3I B;  2Y38 A;  4G1M B;  2M74 A;  5L30 L;  1MOX C;  4YT6 L;  1PGE A;  1EMO A;  4RUT A;  1IQE L;  2P3U A;  4CUE A;  2NPR A;  2Y7Z B;  2VWM K;  4BTU A;  1EQG A;  1KLI L;  4Z6A L;  1F7E A;  3MQE A;  4NGA L;  4CUD A;  1IQH L;  4JZF L;  4COX A;  2P26 A;  3ZYG A;  3LIW B;  5IKR A;  4ZXX L;  1LQD A;  5JB9 E;  2P93 L;  1CQE A;  1XKA L;  2UWP B;  1FAX L;  4Y6D B;  3FCS B;  4RRZ A;  2P16 L;  2MGP A;  2W26 B;  2WPH E;  1DDX A;  2I9B A;  4MMY B;  4RRY A;  4CUF A;  1FSB A;  4LMF A;  1EZQ B;  1M1X B;  3KQD L;  2Y80 B;  2J95 B;  3TK6 B;  1G1T A;  1EAI C;  2P94 L;  1Q4G A;  2Q1J B;  1Z6C A;  4RS0 A;  3QCW A;  5JBA E;  1CX2 A;  2XBW L;  3OLT A;  1NFY B;  5JB8 E;  3CS7 L;  1IQK L;  3KQC L;  2WPJ E;  3N8Y A;  2VVV L; 
#chains in the Genus database with same CATH topology
 2G00 L;  1A3P A;  1PRH A;  1G2L B;  1DQB A;  1HRE A;  5L2Y L;  1XFE A;  2H9E C;  2BOU A;  1FAK L;  4D0F A;  1IQI L;  2F9B L;  2WFT A;  2YGP A;  2BO2 A;  2WG4 B;  1P9J A;  3NJP C;  2UWL B;  4AQT A;  2WPK E;  1YGC L;  2D1J B;  5CKM A;  3KQE L;  3M36 L;  1IQL L;  2EI7 B;  1DVA L;  3CA7 A;  2JJL A;  1V1H A;  4TGF A;  2WG3 C;  5F19 A;  2BQ7 A;  3BT2 A;  3N8V A;  1JV2 B;  2W2P E;  1PXX A;  2J4I B;  4E1G A;  1G1S A;  4XLW A;  4NA9 L;  4PH9 A;  4O1Z A;  3KRK A;  2TGF A;  1TOZ A;  2VWL L;  4O02 B;  3HO5 A;  1IQM L;  2P95 L;  2FLB L;  3HO4 A;  3PGH A;  1MQ5 L;  1F0R B;  2EI6 B;  1APO A;  2W2M E;  2HOR A;  2FLG A;  4MMZ B;  2Y81 B;  3N8X A;  1SZB A;  3TBD A;  4OTY A;  2KB9 A;  1COU A;  2Y5F L;  3TZI A;  1LPZ A;  1FFM A;  2VRS A;  2W2Q E;  2WYJ B;  1IP0 A;  3BT1 A;  3H5C B;  3KK6 A;  2WYG B;  1YUG A;  5K0H B;  3NTB A;  3ELA L;  3BPS E;  1QFK L;  4BTI A;  4RRW A;  1DX5 I;  3LN1 A;  1EPJ A;  2J94 B;  4ZH8 B;  1UZQ A;  1CVW L;  1NZI A;  1XKB A;  1YUF A;  5F1A A;  1JBU L;  2HOX A;  1NFW B;  1FJS L;  3U73 A;  1L3Y A;  3P5B L;  1HT5 A;  5IKV A;  2J34 B;  1J9C L;  3N8Z A;  4BXS A;  1UZK A;  1Z6E L;  1HRF A;  2GD4 A;  3V65 B;  3ZYI B;  2Y5H L;  2VVU L;  1F7M A;  1OB1 C;  2BOX A;  1C5M F;  4Y7B B;  2ADX A;  3U7U G;  1B9W A;  2PHB B;  2RHP A;  2EI8 B;  2BSF A;  1KKE A;  1NFU B;  3KL6 B;  4BDX A;  2FD6 A;  1LPK A;  2VJ3 A;  2XC4 L;  4Y76 B;  3N8W B;  2YGO A;  2PR3 B;  1V1I A;  1UZP A;  2W3K B;  2Y5G L;  5I46 L;  1K36 A;  3LTF B;  2W2N E;  1CEJ A;  2RA0 L;  1G1Q A;  4JZD L;  1ADX A;  2W86 A;  2P28 B;  1ATA A;  1G2M B;  1L5G B;  2FLR L;  2CJI B;  1NFX B;  2P3T A;  2UWO B;  4BXW A;  1O5D L;  1TLE A;  3GIS X;  4X8V L;  3N8W A;  4M11 A;  1IQJ L;  4LOR A;  1ATD A;  4MMX B;  4RRX A;  1FF7 A;  2KV4 A;  5JW1 A;  3LTG D;  2VWN L;  3SOB B;  1EPH A;  2XC0 L;  1EQH A;  1CCF A;  2WZP P;  4ZAE B;  3FFG L;  1APQ A;  3S6X A;  3QH0 A;  2BMG A;  5JVY A;  1G1R A;  3LN0 A;  1W7X L;  2OYU P;  1IOX A;  3Q7D A;  3LAQ A;  4A94 C;  1MQ6 L;  5IKQ A;  2MGR A;  1WHF A;  3QMO A;  3F1S B;  1LPG A;  4JZE L;  4Y71 B;  2XC5 L;  5IKT A;  2PUQ L;  2WPM E;  1FE2 A;  1IGZ A;  3M37 L;  2Y82 B;  2WPI E;  2J2U B;  1IJQ A;  4FM5 A;  1W8B L;  2K2S B;  1HAF A;  3NTG A;  3NT1 A;  2VVC K;  3SOQ A;  2XBY L;  5EGM B;  1UZJ A;  2VH0 B;  3KQB L;  3LC3 B;  4GU3 A;  1DIY A;  4JYV L;  5FDQ A;  1NT0 A;  3KCG L;  3HO3 A;  1PTH A;  1CCV A;  2P3F L;  3EGF A;  4BDW A;  1LMM A;  2BQW A;  5COX A;  4ISI L;  1CVU A;  4M10 A;  5CKQ A;  1HT8 A;  1ATE A;  2B7D L;  1TPG A;  2VWO L;  3OLU A;  1I0U A;  5JBB E;  3HS5 A;  3ENS A;  4Z0K B;  3IJE B;  3GCW E;  1KSN B;  1KLJ L;  1N1I A;  2BOK L;  3POY A;  1JL9 A;  4A7I A;  1ZAQ A;  1BF9 A;  2DDU A;  1HAE A;  1K37 A;  2WPL E;  5KIR A;  2KL7 A;  5CKN A;  1F0S B;  1GK5 A;  1KIG L;  2RNL A;  4Y79 B;  4D90 A;  1EBV A;  1IOE L;  2VH6 B;  4Y7A B;  3R05 A;  3ZYJ B;  1RFN B;  4BTT A;  1NQL B;  2I9A A;  2K2T A;  1IVO C;  4XL1 A;  4ZHA B;  4ZXY L;  1XDT R;  3GCX E;  3N8Y B;  3RR3 A;  1YO8 A;  2OYE P;  5JVZ A;  4X8U L;  3SOV A;  4JYU L;  2BZ6 L;  3DEM A;  3K9X A;  3MDL A;  1U8C B;  1NPE B;  2JKH L;  4XBM A;  1QIU A;  4YZU B;  1IQN L;  4OTJ A;  1U67 A;  1WHE A;  3CFW A;  3HPT A;  2J38 B;  5E8D A;  2FZZ L;  1N7D A;  1X7A L;  4X8T L;  1V3X B;  1KLO A;  1AUT L;  2MHP A;  2XBV L;  2BT8 A;  1IGX A;  3ASI A;  2WFX B;  1WU1 B;  4Z0L A;  2XBX L;  1P0S L;  3F6U L;  5KN5 C;  1LMJ A;  1IQG L;  5L2Z L;  2H9E L;  1EGF A;  2P3F N;  3C9A C;  3IIT B;  5JBC E;  3SW2 A;  2BOH A;  1ATB A;  4NG9 L;  4X8S L;  1URK A;  4D0E A;  1HJ7 A;  3V64 C;  3HS7 A;  1YUK B;  1HX2 A;  3FBY A;  1HCG B;  4C16 A;  3LC5 B;  4ISH L;  6COX A;  1EMN A;  3TGF A;  3TK5 B;  1LK9 A;  1PFX L;  3Q3K B;  4GU4 A;  3TH3 L;  2BQ6 A;  1IQF L;  1EPI A;  2Y7X B;  2W2O E;  2AYL A;  2BT7 A;  1EPG A;  3CEN L;  3HS6 A;  4YT7 L;  5CIS A;  1HZ8 A;  4CSY A;  2W3I B;  2Y38 A;  4G1M B;  2M74 A;  5L30 L;  1MOX C;  4YT6 L;  1PGE A;  1EMO A;  4RUT A;  1IQE L;  2P3U A;  4CUE A;  2NPR A;  2Y7Z B;  2VWM K;  4BTU A;  1EQG A;  1KLI L;  4Z6A L;  1F7E A;  3MQE A;  4NGA L;  4CUD A;  1IQH L;  2YGQ A;  4JZF L;  4COX A;  2P26 A;  3ZYG A;  2KNI A;  3LIW B;  5IKR A;  4ZXX L;  1LQD A;  5JB9 E;  2P93 L;  1CQE A;  1XKA L;  2UWP B;  1FAX L;  4Y6D B;  3FCS B;  4RRZ A;  2P16 L;  2MGP A;  2W26 B;  2WPH E;  1DDX A;  2I9B A;  4MMY B;  4RRY A;  4CUF A;  1FSB A;  4LMF A;  1EZQ B;  1M1X B;  3KQD L;  2Y80 B;  2J95 B;  3TK6 B;  1G1T A;  1EAI C;  2P94 L;  1Q4G A;  2Q1J B;  1Z6C A;  4RS0 A;  3QCW A;  5JBA E;  1CX2 A;  2XBW L;  3OLT A;  1NFY B;  5JB8 E;  3CS7 L;  1IQK L;  3KQC L;  2WPJ E;  3N8Y A;  2VVV L; 
#chains in the Genus database with same CATH homology
 2G00 L;  1A3P A;  1PRH A;  1G2L B;  1DQB A;  1HRE A;  5L2Y L;  1XFE A;  2H9E C;  2BOU A;  1FAK L;  4D0F A;  1IQI L;  2F9B L;  2WFT A;  2YGP A;  2BO2 A;  2WG4 B;  1P9J A;  3NJP C;  2UWL B;  4AQT A;  2WPK E;  1YGC L;  2D1J B;  5CKM A;  3KQE L;  3M36 L;  1IQL L;  2EI7 B;  1DVA L;  3CA7 A;  4TGF A;  2WG3 C;  5F19 A;  2BQ7 A;  3BT2 A;  3N8V A;  1JV2 B;  2W2P E;  1PXX A;  2J4I B;  4E1G A;  1G1S A;  4XLW A;  4NA9 L;  4PH9 A;  4O1Z A;  3KRK A;  2TGF A;  1TOZ A;  2VWL L;  4O02 B;  3HO5 A;  1IQM L;  2P95 L;  2FLB L;  3HO4 A;  3PGH A;  1MQ5 L;  1F0R B;  2EI6 B;  1APO A;  2W2M E;  2FLG A;  4MMZ B;  2Y81 B;  3N8X A;  1SZB A;  3TBD A;  4OTY A;  2KB9 A;  1COU A;  2Y5F L;  3TZI A;  1LPZ A;  1FFM A;  2W2Q E;  2WYJ B;  1IP0 A;  3BT1 A;  3H5C B;  3KK6 A;  2WYG B;  1YUG A;  5K0H B;  3NTB A;  3ELA L;  3BPS E;  1QFK L;  4BTI A;  4RRW A;  1DX5 I;  3LN1 A;  1EPJ A;  2J94 B;  4ZH8 B;  1UZQ A;  1CVW L;  1NZI A;  1XKB A;  1YUF A;  5F1A A;  1JBU L;  1NFW B;  1FJS L;  3U73 A;  1L3Y A;  3P5B L;  1HT5 A;  5IKV A;  2J34 B;  1J9C L;  3N8Z A;  4BXS A;  1UZK A;  1Z6E L;  1HRF A;  2GD4 A;  3V65 B;  3ZYI B;  2Y5H L;  2VVU L;  1F7M A;  1OB1 C;  2BOX A;  1C5M F;  4Y7B B;  2ADX A;  3U7U G;  1B9W A;  2PHB B;  2RHP A;  2EI8 B;  1NFU B;  3KL6 B;  4BDX A;  2FD6 A;  1LPK A;  2VJ3 A;  2XC4 L;  4Y76 B;  3N8W B;  2YGO A;  2PR3 B;  2Y5G L;  1UZP A;  2W3K B;  1K36 A;  5I46 L;  3LTF B;  2W2N E;  1CEJ A;  2RA0 L;  1G1Q A;  4JZD L;  1ADX A;  2W86 A;  2P28 B;  1ATA A;  1G2M B;  1L5G B;  2FLR L;  2CJI B;  1NFX B;  2P3T A;  2UWO B;  4BXW A;  1O5D L;  1TLE A;  3GIS X;  4X8V L;  3N8W A;  4M11 A;  1IQJ L;  4LOR A;  1ATD A;  4MMX B;  4RRX A;  1FF7 A;  2KV4 A;  5JW1 A;  3LTG D;  2VWN L;  3SOB B;  1EPH A;  2XC0 L;  1EQH A;  1CCF A;  2WZP P;  4ZAE B;  3FFG L;  1APQ A;  3S6X A;  3QH0 A;  2BMG A;  5JVY A;  1G1R A;  3LN0 A;  1W7X L;  2OYU P;  1IOX A;  3Q7D A;  3LAQ A;  4A94 C;  1MQ6 L;  5IKQ A;  2MGR A;  1WHF A;  3QMO A;  3F1S B;  1LPG A;  4JZE L;  4Y71 B;  2XC5 L;  5IKT A;  2PUQ L;  2WPM E;  1FE2 A;  1IGZ A;  3M37 L;  2Y82 B;  2WPI E;  2J2U B;  1IJQ A;  4FM5 A;  1W8B L;  2K2S B;  1HAF A;  3NTG A;  3NT1 A;  2VVC K;  3SOQ A;  2XBY L;  5EGM B;  1UZJ A;  2VH0 B;  3KQB L;  3LC3 B;  1DIY A;  4JYV L;  5FDQ A;  1NT0 A;  3KCG L;  3HO3 A;  1PTH A;  1CCV A;  2P3F L;  3EGF A;  4BDW A;  1LMM A;  2BQW A;  5COX A;  4ISI L;  1CVU A;  4M10 A;  5CKQ A;  1HT8 A;  1ATE A;  2B7D L;  1TPG A;  2VWO L;  3OLU A;  1I0U A;  5JBB E;  3HS5 A;  3ENS A;  4Z0K B;  3IJE B;  3GCW E;  1KSN B;  1KLJ L;  1N1I A;  2BOK L;  3POY A;  1JL9 A;  4A7I A;  1ZAQ A;  1BF9 A;  2DDU A;  1HAE A;  1K37 A;  2WPL E;  5KIR A;  2KL7 A;  5CKN A;  1F0S B;  1GK5 A;  1KIG L;  2RNL A;  4Y79 B;  4D90 A;  1EBV A;  1IOE L;  2VH6 B;  4Y7A B;  3R05 A;  3ZYJ B;  1RFN B;  4BTT A;  1NQL B;  2I9A A;  2K2T A;  1IVO C;  4XL1 A;  4ZHA B;  4ZXY L;  1XDT R;  3GCX E;  3N8Y B;  3RR3 A;  1YO8 A;  2OYE P;  5JVZ A;  4X8U L;  3SOV A;  4JYU L;  2BZ6 L;  3DEM A;  3K9X A;  3MDL A;  1U8C B;  1NPE B;  2JKH L;  4XBM A;  4YZU B;  1IQN L;  4OTJ A;  1U67 A;  1WHE A;  3CFW A;  3HPT A;  2J38 B;  5E8D A;  2FZZ L;  1N7D A;  1X7A L;  4X8T L;  1V3X B;  1KLO A;  1AUT L;  2MHP A;  2XBV L;  3ASI A;  1IGX A;  2WFX B;  1WU1 B;  4Z0L A;  2XBX L;  1P0S L;  3F6U L;  5KN5 C;  1LMJ A;  1IQG L;  5L2Z L;  2H9E L;  1EGF A;  2P3F N;  3C9A C;  3IIT B;  5JBC E;  3SW2 A;  2BOH A;  1ATB A;  4NG9 L;  4X8S L;  1URK A;  4D0E A;  1HJ7 A;  3V64 C;  3HS7 A;  1YUK B;  1HX2 A;  3FBY A;  1HCG B;  4C16 A;  3LC5 B;  4ISH L;  6COX A;  1EMN A;  3TGF A;  3TK5 B;  1PFX L;  3Q3K B;  3TH3 L;  2BQ6 A;  1IQF L;  1EPI A;  2Y7X B;  2W2O E;  2AYL A;  1EPG A;  3CEN L;  3HS6 A;  4YT7 L;  5CIS A;  1HZ8 A;  4CSY A;  2W3I B;  2Y38 A;  4G1M B;  2M74 A;  5L30 L;  1MOX C;  4YT6 L;  1PGE A;  1EMO A;  4RUT A;  1IQE L;  2P3U A;  4CUE A;  2NPR A;  2Y7Z B;  2VWM K;  4BTU A;  1EQG A;  1KLI L;  4Z6A L;  1F7E A;  3MQE A;  4NGA L;  4CUD A;  1IQH L;  2YGQ A;  4JZF L;  4COX A;  2P26 A;  3ZYG A;  2KNI A;  3LIW B;  5IKR A;  4ZXX L;  1LQD A;  5JB9 E;  2P93 L;  1CQE A;  1XKA L;  2UWP B;  1FAX L;  4Y6D B;  3FCS B;  4RRZ A;  2P16 L;  2MGP A;  2W26 B;  2WPH E;  1DDX A;  2I9B A;  4MMY B;  4RRY A;  4CUF A;  1FSB A;  4LMF A;  1EZQ B;  1M1X B;  3KQD L;  2Y80 B;  2J95 B;  3TK6 B;  1G1T A;  1EAI C;  2P94 L;  1Q4G A;  2Q1J B;  1Z6C A;  4RS0 A;  3QCW A;  5JBA E;  1CX2 A;  2XBW L;  3OLT A;  1NFY B;  5JB8 E;  3CS7 L;  1IQK L;  3KQC L;  2WPJ E;  3N8Y A;  2VVV L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...